3Q8HA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with cytidine derivative ebsi01028
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
151
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 51
structure length 151
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3q8hA00
1U3LA 3FPIA 3JVHA 1U3PA 4C8IA 3IKEA 2AMTA 5B8FA 1GX1A 3Q8HA 3B6NA 3GHZA 3P0ZA 3IEQA 3T80A 1YQNA 3K14A 1VHAA 1VH8A 4C81A 1W55A 3RE3A 3IKFA 1U43A 1H47A 1U40A 4C82A 1IV1A 3F6MA 4C8GA 1KNJA 3IEWA 3F0GA 3F0EA 4C8EA 3EORA 3ERNA 2GZLA 1H48A 3ESJA 3KE1A 3FBAA 3MBMA 1JY8A 3P10A 2PMPA 1T0AA 1W57A 1IV3A 3F0DA 1KNKA 1IV2A 2UZHA 3ELCA 1IV4A 3QHDA 1JN1A 3K2XA 3F0FA
chains in the Genus database with same CATH superfamily
2YXZA 1NJIH 4YJ3B 5LYJB 2HVYD 4G88A 1GX1A 4E6EA 4F6RA 3CCSF 1N8RH 3CCQF 2Z1UA 4O4HA 1YJ9F 2W8BC 1W5FA 2ZF8A 2VGMA 4BT2A 2IG8A 4C82A 5LA6B 3G4SF 3F6MA 1FNKA 2CVLA 2CWJA 4LNUA 1VQKF 4BW0B 3KE1A 3ZO8A 5DCVA 3J80M 4TV8A 5EZYA 3CCEF 1FNJA 5KMGB 1GZ0A 4I50A 1W5BA 4M8IA 2VGNA 4BVSA 1J7HA 1K9MH 4RHAA 3I7TA 5IYZA 4DXDA 1UFYA 5HXZA 1U40A 1VQ7F 2HRUA 2HS3A 2I6DA 2AIFA 3F0GA 4IIJA 4HNAA 3ZP7A 2GZLA 5MN6A 1SA0A 1RLGA 1E7KA 4WBNA 2FC3A 4O2AA 1M1KH 3JCMM 1COMA 3J7AR 4X3MA 5FNVB 2R6R1 3I55F 1ODEA 3JVHA 4RQOA 2OTJF 3CCVF 2IQQA 4X3LA 1QVFF 4U3JA 4I55A 1XRGA 3CMAF 2HP0A 3IKFA 1TVKB 1RQ7A 5HXUA 4YJ2A 2EWCA 3LWVC 3N2GB 3RYFB 2H8CA 3N2KB 4G4ZA 3S06A 2BTUA 3HKEA 4PWTA 1OFUA 4ZHVA 5C8YA 2UZHA 5GIOC 2BTQB 3KIZA 3E1YA 3LWOC 1UI9A 4G4WA 3LDTA 2ZODA 3GHZA 2WALA 2BTOA 4YJ3A 5LYJA 3VYTC 3M84A 2CHTA 1VHAA 3FD6A 2H8EA 3HKDB 5ITZB 3CYQA 2AIZP 2R751 3V4DA 3TD5A 3I3FA 5MN5A 1W41A 3D54A 5LA6A 3RA6A 2QI2A 3ZOPA 3MBMA 2I6RA 2FGYA 3WPWA 3ON1A 2KGWA 1VQVA 3C9TA 2VAMA 5KMGA 2CSLA 2RHLA 3R0PA 4ZHQB 1FFXB 3KHNA 1Q82H 1QD9A 2VAWA 5GAPK 3MCAB 1RLUA 3TD3A 2KTVA 5EIBD 3NK7A 1Q81H 3GTZA 3JALB 4BT7A 3CYPB 4XCQA 4R40B 2UYPA 2IAFA 3CXCF 5J2UB 2PMPA 3SIVA 3C9RA 3WPXA 3CMEF 1JN1A 2UYNB 1JD1A 2Z01A 1VQ6F 5G4UC 1GO0A 3L7QA 4BVTA 5FNVA 2ALEA 1T0KB 5HY1A 3DC2A 1QVGF 3ZP4A 4O4LB 2OTLF 1VQOF 1ZWZA 3WJPA 1FSZA 1XBIA 5EWRA 4C8GA 3S0YA 2CW4A 1TVKA 2KG4A 4O2BB 1RQ2A 3CCLF 3DDNA 4NWOB 3JARB 1CLIA 3J81M 1M90H 3V7EA 3N2GA 3RYFA 3HKCB 3V3TA 4IHJB 3N2KA 4BT3A 3JAMM 5HY2A 3RYCB 3NK6A 2N48A 1YI2F 1JJ2F 4BVQA 3TD4A 4TV9B 1VQMF 3HAXD 3LWRC 3P0ZA 5LXTB 2F9ZC 5JQGB 1RA4A 1W40A 1H7MA 4X1KB 4X1YB 3HKDA 5EYPB 5ITZA 2CZWA 4TUYB 4DRXB 3ESJA 1JY8A 3P10A 3UT5B 3M4SA 3RYIB 3E20B 3LWPC 1W581 1W59A 4G4XA 5EO3A 5JCOA 4LCKA 3QTYA 4C8IA 1VQ8F 3HJWC 3E22B 3CC4F 3BYQA 4ZHQA 1FFXA 2UYKA 3JAWB 3FD5A 5GINC 1ONIA 3WGNA 5LP6C 3D01A 1IV1A 4B62A 3WXMB 3JALA 5CB4B 3IR9A 1H48A 3FBAA 3CCJF 3FFMA 3VIUA 3KJJA 2HQSC 4EB6B 4KWEA 5J2UA 3HWUA 4NUTA 1YITF 2RHHA 2P6YA 1U3PA 2HS0A 1QAHA 2Q1YA 2UYNA 3VYUC 4BT5A 3VOBA 1XV2A 5EB1B 5JVDB 1U43A 2H6LA 4NQ3A 1YHQF 1Q7YH 3CCMF 3JAKB 4O4LA 3G71F 5GIPC 1W2BF 3JASB 3CPQA 5J2TB 4ZK7A 3EORA 3CB2A 3K12A 4O2BA 1YJWF 4X1IB 1X52A 2QEXF 3JARA 1IV3A 3P4EA 3HKCA 3K2XA 2NMUA 4IHJA 3MDOA 3FPIA 3MCQA 3RYCA 2AMTA 5LOVB 3VMFB 3IEQA 1JFFB 4TV9A 5GONB 1VH8A 3RE3A 2RB9A 3RA5A 5HY4A 3S0HA 3GYQA 4ZOLB 5A2QM 5LXTA 5JCOC 5JQGA 1NMUB 2OHWA 2JNBA 3V7QA 2DT4A 2YYEA 4X1KA 4X1YA 3HKBB 5EYPA 2OZBA 1XHOA 4TUYA 4DRXA 1VK3A 1K73H 1IV4A 1R1MA 3NVKE 3N4YA 3UT5A 5BMVB 3RYIA 3OBYA 3WGKA 3D00A 5IJ0B 5KX5B 4BT4A 5HWEA 1QU9A 3CD6F 1W42A 3B6NA 4EI7A 2ZVYA 1YQNA 3VCZA 3VTIC 3E22A 3OBWA 2LBWA 3S0WA 4B45A 1TUBB 1W5EA 3JAWA 4ZI7B 3CC2F 1Z5VA 3F0EA 1NQ3A 3C9SA 4C8EA 2KTUA 1IPAA 3O85A 2L26A 3U0OA 5CB4A 5CA1B 1T0AA 3F0DA 1Q86H 3PLAC 2LCAA 2RHJA 3F0FA 1SZQA 4EI9A 1U3LA 4EB6A 3I56F 4B46A 1CN7A 1KC8H 1X7OA 4ZHYB 5IJ9B 5FJ4C 5G4VC 1VQ5F 2G9IA 2RHOA 5JH7B 3M1XA 5AVMA 4G4VA 3VI6A 1VQLF 4BY9D 5EIBC 5JVDA 1KNJA 4ZHWA 3K0TA 5GANK 3G6EF 3JAKA 3JASA 1Q8RA 5J2TA 5HP8A 3N4ZA 1X25A 3JATB 3CG6A 3RYHA 1YIJF 4X1IA 4C4WC 4I4TB 2ZOVA 3KJKA 2QTPA 2LBXA 5B8FA 3LWQC 1GO1A 4X20B 5HY0A 2HRYA 4C81A 5CA0B 4O4JB 2K1SA 5LOVA 1H47A 2OTMA 1JFFA 4O4IA 5GONA 2HS4A 5IT9M 5EAZA 3LYBA 4ZOLA 2VAPA 3C8LA 3NVIB 3CPWF 4BVRA 4U39A 3MQWA 5LP6B 4FFBB 3CC7F 5EB0A 2Q1XA 2UYJA 3HKBA 3K14A 1VQNF 2B33A 4F6RB 1CK2A 3IKEA 3VYSC 4O4HB 5BMVA 2V9YA 5IJ0A 3CCRF 1S72F 5KX5A 1W55A 3WGMA 3WJRA 4BT6A 3LMEA 4LNUB 2CHSA 2QA4F 1TUBA 4TV8B 5EZYB 4ZI7A 3CCUF 4B5CA 4I50B 3WGJA 3VOAA 4G4YA 3RYHB 1W57A 2MQEA 2HP3A 3ELCA 5MN4A 3NMUC 1W3EX 5CA1A 5IYZB 2ZAUA 2GLZA 3IMPA 3C9UA 3SIUA 3Q8HA 2LBTA 3LFOA 3T80A 1YJNF 4ERHA 3HTNA 4O4IB 1X7PA 5IJ9A 1SDSA 4IIJB 4HNAB 2Z1FA 3OONA 1SA0B 1DT9A 5JH7A 3S03A 4WBNB 4O2AB 3VO8A 1KD1H 1VQ4F 3WJQA 4TZZA 4EI8A 1Z5WA 1OAPA 3S02A 2VXYA 4U3JB 3QUWA 4I55B 3JATA 2Z1EA 1VQPF 2HP0B 2ZVZA 4I4TA 2PHNA 4YJ2B 1YGYA 4X20A 2BO1A 1PF5A 1PXWA 5CA0A 4O4JA 2Z1TA 3AGKA 2GVIA 3WGLA 1VQ9F 3IEWA 1K8AH 5FLXM 3OW2F 1DBFA 3HKEB 1KQSF 3PAFA 5HP7A 2DYYA 3ERNA 5C8YB 2HX0A 1W5AA 1KNKA 1IV2A 3QHDA 5LP6A 4FFBA
chains in the Genus database with same CATH topology
1U3LA 3FPIA 3JVHA 1U3PA 4C8IA 3IKEA 2AMTA 5B8FA 1GX1A 3Q8HA 3B6NA 3GHZA 3P0ZA 3IEQA 3T80A 1YQNA 3K14A 1VHAA 1VH8A 4C81A 1W55A 3RE3A 3IKFA 1U43A 1H47A 1U40A 4C82A 1IV1A 3F6MA 4C8GA 1KNJA 3IEWA 3F0GA 3F0EA 4C8EA 3EORA 3ERNA 2GZLA 1H48A 3ESJA 3KE1A 3FBAA 3MBMA 1JY8A 3P10A 2PMPA 1T0AA 1W57A 1IV3A 3F0DA 1KNKA 1IV2A 2UZHA 3ELCA 1IV4A 3QHDA 1JN1A 3K2XA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  3FPI A;  3JVH A;  1U3P A;  4C8I A;  3IKE A;  2AMT A;  5B8F A;  1GX1 A;  3Q8H A;  3B6N A;  3GHZ A;  3P0Z A;  3IEQ A;  3T80 A;  1YQN A;  3K14 A;  1VHA A;  1VH8 A;  4C81 A;  1W55 A;  3RE3 A;  3IKF A;  1U43 A;  1H47 A;  1U40 A;  4C82 A;  1IV1 A;  3F6M A;  4C8G A;  1KNJ A;  3IEW A;  3F0G A;  3F0E A;  4C8E A;  3EOR A;  3ERN A;  2GZL A;  1H48 A;  3ESJ A;  3KE1 A;  3FBA A;  3MBM A;  1JY8 A;  3P10 A;  2PMP A;  1T0A A;  1W57 A;  1IV3 A;  3F0D A;  1KNK A;  1IV2 A;  2UZH A;  3ELC A;  1IV4 A;  3QHD A;  1JN1 A;  3K2X A;  3F0F A; 
#chains in the Genus database with same CATH topology
 2YXZ A;  1NJI H;  4YJ3 B;  5LYJ B;  2HVY D;  4G88 A;  1GX1 A;  4E6E A;  4F6R A;  3CCS F;  1N8R H;  3CCQ F;  2Z1U A;  4O4H A;  1YJ9 F;  2W8B C;  1W5F A;  2ZF8 A;  2VGM A;  4BT2 A;  2IG8 A;  4C82 A;  5LA6 B;  3G4S F;  3F6M A;  1FNK A;  2CVL A;  2CWJ A;  4LNU A;  1VQK F;  4BW0 B;  3KE1 A;  3ZO8 A;  5DCV A;  3J80 M;  4TV8 A;  5EZY A;  3CCE F;  1FNJ A;  5KMG B;  1GZ0 A;  4I50 A;  1W5B A;  4M8I A;  2VGN A;  4BVS A;  1J7H A;  1K9M H;  4RHA A;  3I7T A;  5IYZ A;  4DXD A;  1UFY A;  5HXZ A;  1U40 A;  1VQ7 F;  2HRU A;  2HS3 A;  2I6D A;  2AIF A;  3F0G A;  4IIJ A;  4HNA A;  3ZP7 A;  2GZL A;  5MN6 A;  1SA0 A;  1RLG A;  1E7K A;  4WBN A;  2FC3 A;  4O2A A;  1M1K H;  3JCM M;  1COM A;  3J7A R;  4X3M A;  5FNV B;  2R6R 1;  3I55 F;  1ODE A;  3JVH A;  4RQO A;  2OTJ F;  3CCV F;  2IQQ A;  4X3L A;  1QVF F;  4U3J A;  4I55 A;  1XRG A;  3CMA F;  2HP0 A;  3IKF A;  1TVK B;  1RQ7 A;  5HXU A;  4YJ2 A;  2EWC A;  3LWV C;  3N2G B;  3RYF B;  2H8C A;  3N2K B;  4G4Z A;  3S06 A;  2BTU A;  3HKE A;  4PWT A;  1OFU A;  4ZHV A;  5C8Y A;  2UZH A;  5GIO C;  2BTQ B;  3KIZ A;  3E1Y A;  3LWO C;  1UI9 A;  4G4W A;  3LDT A;  2ZOD A;  3GHZ A;  2WAL A;  2BTO A;  4YJ3 A;  5LYJ A;  3VYT C;  3M84 A;  2CHT A;  1VHA A;  3FD6 A;  2H8E A;  3HKD B;  5ITZ B;  3CYQ A;  2AIZ P;  2R75 1;  3V4D A;  3TD5 A;  3I3F A;  5MN5 A;  1W41 A;  3D54 A;  5LA6 A;  3RA6 A;  2QI2 A;  3ZOP A;  3MBM A;  2I6R A;  2FGY A;  3WPW A;  3ON1 A;  2KGW A;  1VQV A;  3C9T A;  2VAM A;  5KMG A;  2CSL A;  2RHL A;  3R0P A;  4ZHQ B;  1FFX B;  3KHN A;  1Q82 H;  1QD9 A;  2VAW A;  5GAP K;  3MCA B;  1RLU A;  3TD3 A;  2KTV A;  5EIB D;  3NK7 A;  1Q81 H;  3GTZ A;  3JAL B;  4BT7 A;  3CYP B;  4XCQ A;  4R40 B;  2UYP A;  2IAF A;  3CXC F;  5J2U B;  2PMP A;  3SIV A;  3C9R A;  3WPX A;  3CME F;  1JN1 A;  2UYN B;  1JD1 A;  2Z01 A;  1VQ6 F;  5G4U C;  1GO0 A;  3L7Q A;  4BVT A;  5FNV A;  2ALE A;  1T0K B;  5HY1 A;  3DC2 A;  1QVG F;  3ZP4 A;  4O4L B;  2OTL F;  1VQO F;  1ZWZ A;  3WJP A;  1FSZ A;  1XBI A;  5EWR A;  4C8G A;  3S0Y A;  2CW4 A;  1TVK A;  2KG4 A;  4O2B B;  1RQ2 A;  3CCL F;  3DDN A;  4NWO B;  3JAR B;  1CLI A;  3J81 M;  1M90 H;  3V7E A;  3N2G A;  3RYF A;  3HKC B;  3V3T A;  4IHJ B;  3N2K A;  4BT3 A;  3JAM M;  5HY2 A;  3RYC B;  3NK6 A;  2N48 A;  1YI2 F;  1JJ2 F;  4BVQ A;  3TD4 A;  4TV9 B;  1VQM F;  3HAX D;  3LWR C;  3P0Z A;  5LXT B;  2F9Z C;  5JQG B;  1RA4 A;  1W40 A;  1H7M A;  4X1K B;  4X1Y B;  3HKD A;  5EYP B;  5ITZ A;  2CZW A;  4TUY B;  4DRX B;  3ESJ A;  1JY8 A;  3P10 A;  3UT5 B;  3M4S A;  3RYI B;  3E20 B;  3LWP C;  1W58 1;  1W59 A;  4G4X A;  5EO3 A;  5JCO A;  4LCK A;  3QTY A;  4C8I A;  1VQ8 F;  3HJW C;  3E22 B;  3CC4 F;  3BYQ A;  4ZHQ A;  1FFX A;  2UYK A;  3JAW B;  3FD5 A;  5GIN C;  1ONI A;  3WGN A;  5LP6 C;  3D01 A;  1IV1 A;  4B62 A;  3WXM B;  3JAL A;  5CB4 B;  3IR9 A;  1H48 A;  3FBA A;  3CCJ F;  3FFM A;  3VIU A;  3KJJ A;  2HQS C;  4EB6 B;  4KWE A;  5J2U A;  3HWU A;  4NUT A;  1YIT F;  2RHH A;  2P6Y A;  1U3P A;  2HS0 A;  1QAH A;  2Q1Y A;  2UYN A;  3VYU C;  4BT5 A;  3VOB A;  1XV2 A;  5EB1 B;  5JVD B;  1U43 A;  2H6L A;  4NQ3 A;  1YHQ F;  1Q7Y H;  3CCM F;  3JAK B;  4O4L A;  3G71 F;  5GIP C;  1W2B F;  3JAS B;  3CPQ A;  5J2T B;  4ZK7 A;  3EOR A;  3CB2 A;  3K12 A;  4O2B A;  1YJW F;  4X1I B;  1X52 A;  2QEX F;  3JAR A;  1IV3 A;  3P4E A;  3HKC A;  3K2X A;  2NMU A;  4IHJ A;  3MDO A;  3FPI A;  3MCQ A;  3RYC A;  2AMT A;  5LOV B;  3VMF B;  3IEQ A;  1JFF B;  4TV9 A;  5GON B;  1VH8 A;  3RE3 A;  2RB9 A;  3RA5 A;  5HY4 A;  3S0H A;  3GYQ A;  4ZOL B;  5A2Q M;  5LXT A;  5JCO C;  5JQG A;  1NMU B;  2OHW A;  2JNB A;  3V7Q A;  2DT4 A;  2YYE A;  4X1K A;  4X1Y A;  3HKB B;  5EYP A;  2OZB A;  1XHO A;  4TUY A;  4DRX A;  1VK3 A;  1K73 H;  1IV4 A;  1R1M A;  3NVK E;  3N4Y A;  3UT5 A;  5BMV B;  3RYI A;  3OBY A;  3WGK A;  3D00 A;  5IJ0 B;  5KX5 B;  4BT4 A;  5HWE A;  1QU9 A;  3CD6 F;  1W42 A;  3B6N A;  4EI7 A;  2ZVY A;  1YQN A;  3VCZ A;  3VTI C;  3E22 A;  3OBW A;  2LBW A;  3S0W A;  4B45 A;  1TUB B;  1W5E A;  3JAW A;  4ZI7 B;  3CC2 F;  1Z5V A;  3F0E A;  1NQ3 A;  3C9S A;  4C8E A;  2KTU A;  1IPA A;  3O85 A;  2L26 A;  3U0O A;  5CB4 A;  5CA1 B;  1T0A A;  3F0D A;  1Q86 H;  3PLA C;  2LCA A;  2RHJ A;  3F0F A;  1SZQ A;  4EI9 A;  1U3L A;  4EB6 A;  3I56 F;  4B46 A;  1CN7 A;  1KC8 H;  1X7O A;  4ZHY B;  5IJ9 B;  5FJ4 C;  5G4V C;  1VQ5 F;  2G9I A;  2RHO A;  5JH7 B;  3M1X A;  5AVM A;  4G4V A;  3VI6 A;  1VQL F;  4BY9 D;  5EIB C;  5JVD A;  1KNJ A;  4ZHW A;  3K0T A;  5GAN K;  3G6E F;  3JAK A;  3JAS A;  1Q8R A;  5J2T A;  5HP8 A;  3N4Z A;  1X25 A;  3JAT B;  3CG6 A;  3RYH A;  1YIJ F;  4X1I A;  4C4W C;  4I4T B;  2ZOV A;  3KJK A;  2QTP A;  2LBX A;  5B8F A;  3LWQ C;  1GO1 A;  4X20 B;  5HY0 A;  2HRY A;  4C81 A;  5CA0 B;  4O4J B;  2K1S A;  5LOV A;  1H47 A;  2OTM A;  1JFF A;  4O4I A;  5GON A;  2HS4 A;  5IT9 M;  5EAZ A;  3LYB A;  4ZOL A;  2VAP A;  3C8L A;  3NVI B;  3CPW F;  4BVR A;  4U39 A;  3MQW A;  5LP6 B;  4FFB B;  3CC7 F;  5EB0 A;  2Q1X A;  2UYJ A;  3HKB A;  3K14 A;  1VQN F;  2B33 A;  4F6R B;  1CK2 A;  3IKE A;  3VYS C;  4O4H B;  5BMV A;  2V9Y A;  5IJ0 A;  3CCR F;  1S72 F;  5KX5 A;  1W55 A;  3WGM A;  3WJR A;  4BT6 A;  3LME A;  4LNU B;  2CHS A;  2QA4 F;  1TUB A;  4TV8 B;  5EZY B;  4ZI7 A;  3CCU F;  4B5C A;  4I50 B;  3WGJ A;  3VOA A;  4G4Y A;  3RYH B;  1W57 A;  2MQE A;  2HP3 A;  3ELC A;  5MN4 A;  3NMU C;  1W3E X;  5CA1 A;  5IYZ B;  2ZAU A;  2GLZ A;  3IMP A;  3C9U A;  3SIU A;  3Q8H A;  2LBT A;  3LFO A;  3T80 A;  1YJN F;  4ERH A;  3HTN A;  4O4I B;  1X7P A;  5IJ9 A;  1SDS A;  4IIJ B;  4HNA B;  2Z1F A;  3OON A;  1SA0 B;  1DT9 A;  5JH7 A;  3S03 A;  4WBN B;  4O2A B;  3VO8 A;  1KD1 H;  1VQ4 F;  3WJQ A;  4TZZ A;  4EI8 A;  1Z5W A;  1OAP A;  3S02 A;  2VXY A;  4U3J B;  3QUW A;  4I55 B;  3JAT A;  2Z1E A;  1VQP F;  2HP0 B;  2ZVZ A;  4I4T A;  2PHN A;  4YJ2 B;  1YGY A;  4X20 A;  2BO1 A;  1PF5 A;  1PXW A;  5CA0 A;  4O4J A;  2Z1T A;  3AGK A;  2GVI A;  3WGL A;  1VQ9 F;  3IEW A;  1K8A H;  5FLX M;  3OW2 F;  1DBF A;  3HKE B;  1KQS F;  3PAF A;  5HP7 A;  2DYY A;  3ERN A;  5C8Y B;  2HX0 A;  1W5A A;  1KNK A;  1IV2 A;  3QHD A;  5LP6 A;  4FFB A; 
#chains in the Genus database with same CATH homology
 1U3L A;  3FPI A;  3JVH A;  1U3P A;  4C8I A;  3IKE A;  2AMT A;  5B8F A;  1GX1 A;  3Q8H A;  3B6N A;  3GHZ A;  3P0Z A;  3IEQ A;  3T80 A;  1YQN A;  3K14 A;  1VHA A;  1VH8 A;  4C81 A;  1W55 A;  3RE3 A;  3IKF A;  1U43 A;  1H47 A;  1U40 A;  4C82 A;  1IV1 A;  3F6M A;  4C8G A;  1KNJ A;  3IEW A;  3F0G A;  3F0E A;  4C8E A;  3EOR A;  3ERN A;  2GZL A;  1H48 A;  3ESJ A;  3KE1 A;  3FBA A;  3MBM A;  1JY8 A;  3P10 A;  2PMP A;  1T0A A;  1W57 A;  1IV3 A;  3F0D A;  1KNK A;  1IV2 A;  2UZH A;  3ELC A;  1IV4 A;  3QHD A;  1JN1 A;  3K2X A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...