3Q8HA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with cytidine derivative ebsi01028
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
151
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei.
pubmed doi rcsb
total genus 51
structure length 151
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3q8hA00
3P10A 1IV3A 3ERNA 3FPIA 3IKEA 1U3LA 1U43A 3F6MA 2PMPA 3KE1A 4C8EA 3F0EA 3F0DA 3MBMA 1IV4A 1GX1A 1YQNA 3JVHA 3RE3A 1JY8A 3FBAA 3IEQA 3Q8HA 4C81A 1T0AA 1H47A 3IEWA 1VHAA 3QHDA 3ESJA 4C82A 1JN1A 1KNJA 3F0GA 2UZHA 1U3PA 1U40A 3B6NA 3K14A 1KNKA 1IV2A 2AMTA 3K2XA 3P0ZA 1W57A 5B8FA 3GHZA 1VH8A 3T80A 4C8IA 3ELCA 1W55A 1IV1A 3EORA 3F0FA 4C8GA 3IKFA 1H48A 2GZLA
chains in the Genus database with same CATH superfamily
3DC2A 3M4SA 4G4WA 1Q82H 3JAKB 1YJ9F 2ZVZA 1S72F 1KD1H 3WJPA 3CG6A 3GYQA 1UFYA 3HKEA 2LBTA 3HKDA 4NUTA 3CCEF 5LOVB 3C9UA 2IAFA 1NQ3A 3HAXD 3HKEB 1CLIA 2RB9A 2EWCA 2UYPA 3HTNA 3MQWA 4IIJA 2CW4A 4X3LA 1QAHA 4I4TA 4X20B 3F0FA 3I3FA 4C8GA 5EZYA 3CCVF 5EYPA 3LDTA 4B5CA 3KE1A 3F6MA 5EYPB 4I55A 3D00A 3OONA 3AGKA 3MBMA 5G4UC 1SA0A 4U39A 2I6RA 3FBAA 1RQ2A 2AIFA 3FD6A 3PLAC 4WBNA 4M8IA 3C9TA 2V9YA 1XHOA 4R40B 4ZHQB 4LNUA 3F0GA 5LP6B 2K1SA 1RLGA 5GINC 3C8LA 5HWEA 5IJ0B 3UT5A 3VYTC 4BT4A 2OTMA 1JFFB 2VAWA 4G4YA 5IJ0A 3WGKA 3UT5B 2VGMA 1K8AH 4X1YB 3LWQC 3HKBA 1W41A 4F6RB 2HS0A 3JARA 4YJ2B 3M1XA 1UI9A 1VQ6F 3HKCB 3JARB 3OBWA 2DYYA 2QEXF 1Z5WA 2AIZP 2W8BC 3RE3A 4X3MA 5FNVB 3WXMB 4G4VA 4B45A 5KMGB 5LXTB 2FGYA 3FD5A 1XV2A 2NMUA 3R0PA 3VI6A 1W40A 3I55F 1W59A 1VQVA 1NMUB 4TV9B 3RA6A 1VK3A 1VQ5F 3VMFB 1VQLF 3LFOA 3MCAB 3NVKE 4TV8B 5GONA 3CCQF 3F0EA 5IYZA 3CC4F 4BT2A 1K9MH 2QA4F 3CC2F 4G4ZA 1COMA 3V7QA 4DXDA 3MDOA 1KNJA 1N8RH 1XBIA 5JCOC 4IIJB 5HY2A 5GIPC 4YJ3A 4TUYB 4I4TB 4X20A 2DT4A 3LMEA 4KWEA 2R751 1ODEA 3QUWA 2KG4A 2B33A 2H8CA 3C9RA 2L26A 3MCQA 4C8EA 3CPWF 3JASB 2JNBA 1QD9A 4I50A 2N48A 1YGYA 3LWRC 5IT9M 3IEQA 3J80M 1PXWA 2VAPA 3KJKA 3V3TA 3G4SF 2ALEA 1FNJA 3JALA 5HY0A 4ZHYB 5J2TA 3JATB 3ELCA 3HWUA 2Z1UA 3JALB 2CSLA 1VQ7F 4U3JB 3HKCA 2FC3A 5JQGA 4RQOA 4ZI7A 3WPWA 2YYEA 3L7QA 5LXTA 5CA0A 1FFXA 4BVSA 3E20B 2RHHA 3TD4A 3O85A 3B6NA 4C4WC 1GZ0A 3CXCF 3E1YA 3RA5A 3GHZA 2HP0B 1R1MA 4LCKA 5KX5B 5J2UA 3CMAF 4EI9A 3IKEA 2BO1A 1NJIH 1M1KH 1VQ8F 5GAPK 3CYQA 4XCQA 1Q81H 4EB6B 4ZHVA 2BTUA 3RYCB 3I56F 3VYUC 1YJNF 5EB1B 4BT7A 3VIUA 3PAFA 3KJJA 1PF5A 2Z1TA 4B46A 1W57A 5CB4A 5B8FA 1Q86H 3FFMA 2HS3A 3QTYA 2QI2A 1TUBB 1FSZA 3SIVA 1U3LA 4E6EA 4I50B 3F0DA 2HS4A 1QU9A 3GTZA 4NWOB 3ON1A 4BY9D 1DT9A 4X1IA 5EO3A 5AVMA 5ITZA 1SDSA 3C9SA 1OAPA 1W2BF 2AMTA 2CWJA 2HX0A 3N2KA 5HP7A 4O4HA 4YJ2A 5C8YA 3IKFA 2HVYD 1X25A 5JVDB 3J81M 3G6EF 5EZYB 3J7AR 5DCVA 2UYKA 4IHJB 2IQQA 4X1KA 5KMGA 5CA0B 4FFBA 1JD1A 3JAWA 2KGWA 1SA0B 1RA4A 4FFBB 3RYFA 1IPAA 4ZHQA 3RYHB 3WJRA 5MN4A 3WGMA 3S03A 4DRXB 3IMPA 4BW0B 3RYHA 5GIOC 5J2UB 4C8IA 3CCRF 3EORA 2LBXA 4O4IA 1VQOF 2GLZA 4X1YA 5G4VC 3WJQA 5LA6A 3P10A 5MN5A 3JAMM 3DDNA 3M84A 5LA6B 5CA1B 1YHQF 3K12A 3NMUC 1GO0A 1QVFF 1QVGF 3CYPB 5BMVA 2UYNA 2I6DA 2G9IA 1OFUA 5LOVA 2CHSA 3LWPC 2RHLA 3OBYA 4BT6A 2UYNB 3ZO8A 1RLUA 5LYJB 1KQSF 1VQMF 1IV2A 3V4DA 1XRGA 5LYJA 3NK7A 5IJ9A 1W5EA 1W55A 3K0TA 1IV1A 3CCMF 1TUBA 2RHOA 3RYIB 2OTJF 1H48A 4B62A 4ZOLA 3RYIA 1IV3A 3FPIA 4ZOLB 2CHTA 3N4ZA 3U0OA 1W5BA 3D01A 2BTQB 1SZQA 2PHNA 2Z1FA 4PWTA 5FJ4C 3CCSF 4C81A 4LNUB 1T0AA 1M90H 5LP6A 3ESJA 2KTVA 3HKDB 1W5FA 1X7OA 1JFFA 2ZODA 3CMEF 3OW2F 1W581 4O4LB 3P0ZA 1KC8H 2KTUA 3CCJF 4O4LA 1VQKF 2MQEA 5JQGB 4IHJA 3ZOPA 2OZBA 1VQ4F 3E22A 3JAWB 1Q7YH 1JJ2F 1X52A 5FNVA 3VOBA 4BVRA 3HJWC 3E22B 5EAZA 2HRUA 1FNKA 3TD5A 3CC7F 4HNAA 3CCLF 3VTIC 2ZOVA 4ERHA 2R6R1 1U3PA 2OTLF 4BVQA 2VGNA 4NQ3A 4O2AA 5FLXM 4G4XA 2HP3A 3V7EA 3LWOC 1KNKA 3K2XA 4O4IB 5KX5A 2ZAUA 2OHWA 2CZWA 4RHAA 3HKBB 1CK2A 1YIJF 1TVKA 2Q1YA 1U43A 2VXYA 3D54A 5BMVB 1Z5VA 2LCAA 1ZWZA 1YQNA 2IG8A 3N2GB 5HP8A 1YITF 3VOAA 3CD6F 5MN6A 5GANK 1VHAA 3I7TA 1FFXB 4TUYA 1K73H 1W5AA 3WGNA 3K14A 3S0YA 1W42A 3P4EA 1J7HA 2HP0A 2P6YA 2VAMA 2HQSC 1CN7A 3LYBA 3VO8A 4EI7A 2GVIA 2ZVYA 4TV8A 4X1IB 5ITZB 1GX1A 5GONB 3S0WA 3S0HA 2ZF8A 1JY8A 3JAKA 5IYZB 3QHDA 5EIBD 3S02A 1T0KB 5HY4A 5JH7B 3N2KB 5J2TB 1VQNF 5HY1A 3JATA 2Q1XA 3WGJA 5C8YB 2HRYA 5JH7A 3NVIB 1RQ7A 4YJ3B 3CCUF 4BT3A 3NK6A 5JVDA 3BYQA 4O2BA 2LBWA 2YXZA 4O2BB 1Q8RA 2QTPA 2Z1EA 4G88A 4EI8A 1IV4A 1VQPF 5HXUA 3JASA 4I55B 3CPQA 3S06A 4HNAB 3G71F 1ONIA 3VYSC 1E7KA 2UYJA 3N4YA 3CB2A 4BVTA 4O2AB 3TD3A 3JCMM 4WBNB 2UZHA 2WALA 2CVLA 5EIBC 4O4JB 5EWRA 1W3EX 4ZHWA 3SIUA 4O4JA 3T80A 5JCOA 2BTOA 1DBFA 1TVKB 4O4HB 2H8EA 5EB0A 5HXZA 1GO1A 3ZP4A 4F6RA 3ERNA 4U3JA 5CA1A 1H7MA 3WPXA 2PMPA 3N2GA 5LP6C 4EB6A 2Z01A 3RYCA 4ZI7B 3JVHA 3ZP7A 4X1KB 5A2QM 4ZK7A 1X7PA 2H6LA 4TZZA 3Q8HA 3IEWA 1H47A 3WGLA 4C82A 1JN1A 3KHNA 1U40A 1YI2F 3RYFB 5CB4B 2F9ZC 5IJ9B 1YJWF 2RHJA 1VH8A 3VCZA 3LWVC 4DRXA 3KIZA 3IR9A 2GZLA 4TV9A 4BT5A 1VQ9F
chains in the Genus database with same CATH topology
3P10A 1IV3A 3ERNA 3FPIA 3IKEA 1U3LA 1U43A 3F6MA 2PMPA 3KE1A 4C8EA 3F0EA 3F0DA 3MBMA 1IV4A 1GX1A 1YQNA 3JVHA 3RE3A 1JY8A 3FBAA 3IEQA 3Q8HA 4C81A 1T0AA 1H47A 3IEWA 1VHAA 3QHDA 3ESJA 4C82A 1JN1A 1KNJA 3F0GA 2UZHA 1U3PA 1U40A 3B6NA 3K14A 1KNKA 1IV2A 2AMTA 3K2XA 3P0ZA 1W57A 5B8FA 3GHZA 1VH8A 3T80A 4C8IA 3ELCA 1W55A 1IV1A 3EORA 3F0FA 4C8GA 3IKFA 1H48A 2GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P10 A;  1IV3 A;  3ERN A;  3FPI A;  3IKE A;  1U3L A;  1U43 A;  3F6M A;  2PMP A;  3KE1 A;  4C8E A;  3F0E A;  3F0D A;  3MBM A;  1IV4 A;  1GX1 A;  1YQN A;  3JVH A;  3RE3 A;  1JY8 A;  3FBA A;  3IEQ A;  3Q8H A;  4C81 A;  1T0A A;  1H47 A;  3IEW A;  1VHA A;  3QHD A;  3ESJ A;  4C82 A;  1JN1 A;  1KNJ A;  3F0G A;  2UZH A;  1U3P A;  1U40 A;  3B6N A;  3K14 A;  1KNK A;  1IV2 A;  2AMT A;  3K2X A;  3P0Z A;  1W57 A;  5B8F A;  3GHZ A;  1VH8 A;  3T80 A;  4C8I A;  3ELC A;  1W55 A;  1IV1 A;  3EOR A;  3F0F A;  4C8G A;  3IKF A;  1H48 A;  2GZL A; 
#chains in the Genus database with same CATH topology
 3DC2 A;  3M4S A;  4G4W A;  1Q82 H;  3JAK B;  1YJ9 F;  2ZVZ A;  1S72 F;  1KD1 H;  3WJP A;  3CG6 A;  3GYQ A;  1UFY A;  3HKE A;  2LBT A;  3HKD A;  4NUT A;  3CCE F;  5LOV B;  3C9U A;  2IAF A;  1NQ3 A;  3HAX D;  3HKE B;  1CLI A;  2RB9 A;  2EWC A;  2UYP A;  3HTN A;  3MQW A;  4IIJ A;  2CW4 A;  4X3L A;  1QAH A;  4I4T A;  4X20 B;  3F0F A;  3I3F A;  4C8G A;  5EZY A;  3CCV F;  5EYP A;  3LDT A;  4B5C A;  3KE1 A;  3F6M A;  5EYP B;  4I55 A;  3D00 A;  3OON A;  3AGK A;  3MBM A;  5G4U C;  1SA0 A;  4U39 A;  2I6R A;  3FBA A;  1RQ2 A;  2AIF A;  3FD6 A;  3PLA C;  4WBN A;  4M8I A;  3C9T A;  2V9Y A;  1XHO A;  4R40 B;  4ZHQ B;  4LNU A;  3F0G A;  5LP6 B;  2K1S A;  1RLG A;  5GIN C;  3C8L A;  5HWE A;  5IJ0 B;  3UT5 A;  3VYT C;  4BT4 A;  2OTM A;  1JFF B;  2VAW A;  4G4Y A;  5IJ0 A;  3WGK A;  3UT5 B;  2VGM A;  1K8A H;  4X1Y B;  3LWQ C;  3HKB A;  1W41 A;  4F6R B;  2HS0 A;  3JAR A;  4YJ2 B;  3M1X A;  1UI9 A;  1VQ6 F;  3HKC B;  3JAR B;  3OBW A;  2DYY A;  2QEX F;  1Z5W A;  2AIZ P;  2W8B C;  3RE3 A;  4X3M A;  5FNV B;  3WXM B;  4G4V A;  4B45 A;  5KMG B;  5LXT B;  2FGY A;  3FD5 A;  1XV2 A;  2NMU A;  3R0P A;  3VI6 A;  1W40 A;  3I55 F;  1W59 A;  1VQV A;  1NMU B;  4TV9 B;  3RA6 A;  1VK3 A;  1VQ5 F;  3VMF B;  1VQL F;  3LFO A;  3MCA B;  3NVK E;  4TV8 B;  5GON A;  3CCQ F;  3F0E A;  5IYZ A;  3CC4 F;  4BT2 A;  1K9M H;  2QA4 F;  3CC2 F;  4G4Z A;  1COM A;  3V7Q A;  4DXD A;  3MDO A;  1KNJ A;  1N8R H;  1XBI A;  5JCO C;  4IIJ B;  5HY2 A;  5GIP C;  4YJ3 A;  4TUY B;  4I4T B;  4X20 A;  2DT4 A;  3LME A;  4KWE A;  2R75 1;  1ODE A;  3QUW A;  2KG4 A;  2B33 A;  2H8C A;  3C9R A;  2L26 A;  3MCQ A;  4C8E A;  3CPW F;  3JAS B;  2JNB A;  1QD9 A;  4I50 A;  2N48 A;  1YGY A;  3LWR C;  5IT9 M;  3IEQ A;  3J80 M;  1PXW A;  2VAP A;  3KJK A;  3V3T A;  3G4S F;  2ALE A;  1FNJ A;  3JAL A;  5HY0 A;  4ZHY B;  5J2T A;  3JAT B;  3ELC A;  3HWU A;  2Z1U A;  3JAL B;  2CSL A;  1VQ7 F;  4U3J B;  3HKC A;  2FC3 A;  5JQG A;  4RQO A;  4ZI7 A;  3WPW A;  2YYE A;  3L7Q A;  5LXT A;  5CA0 A;  1FFX A;  4BVS A;  3E20 B;  2RHH A;  3TD4 A;  3O85 A;  3B6N A;  4C4W C;  1GZ0 A;  3CXC F;  3E1Y A;  3RA5 A;  3GHZ A;  2HP0 B;  1R1M A;  4LCK A;  5KX5 B;  5J2U A;  3CMA F;  4EI9 A;  3IKE A;  2BO1 A;  1NJI H;  1M1K H;  1VQ8 F;  5GAP K;  3CYQ A;  4XCQ A;  1Q81 H;  4EB6 B;  4ZHV A;  2BTU A;  3RYC B;  3I56 F;  3VYU C;  1YJN F;  5EB1 B;  4BT7 A;  3VIU A;  3PAF A;  3KJJ A;  1PF5 A;  2Z1T A;  4B46 A;  1W57 A;  5CB4 A;  5B8F A;  1Q86 H;  3FFM A;  2HS3 A;  3QTY A;  2QI2 A;  1TUB B;  1FSZ A;  3SIV A;  1U3L A;  4E6E A;  4I50 B;  3F0D A;  2HS4 A;  1QU9 A;  3GTZ A;  4NWO B;  3ON1 A;  4BY9 D;  1DT9 A;  4X1I A;  5EO3 A;  5AVM A;  5ITZ A;  1SDS A;  3C9S A;  1OAP A;  1W2B F;  2AMT A;  2CWJ A;  2HX0 A;  3N2K A;  5HP7 A;  4O4H A;  4YJ2 A;  5C8Y A;  3IKF A;  2HVY D;  1X25 A;  5JVD B;  3J81 M;  3G6E F;  5EZY B;  3J7A R;  5DCV A;  2UYK A;  4IHJ B;  2IQQ A;  4X1K A;  5KMG A;  5CA0 B;  4FFB A;  1JD1 A;  3JAW A;  2KGW A;  1SA0 B;  1RA4 A;  4FFB B;  3RYF A;  1IPA A;  4ZHQ A;  3RYH B;  3WJR A;  5MN4 A;  3WGM A;  3S03 A;  4DRX B;  3IMP A;  4BW0 B;  3RYH A;  5GIO C;  5J2U B;  4C8I A;  3CCR F;  3EOR A;  2LBX A;  4O4I A;  1VQO F;  2GLZ A;  4X1Y A;  5G4V C;  3WJQ A;  5LA6 A;  3P10 A;  5MN5 A;  3JAM M;  3DDN A;  3M84 A;  5LA6 B;  5CA1 B;  1YHQ F;  3K12 A;  3NMU C;  1GO0 A;  1QVF F;  1QVG F;  3CYP B;  5BMV A;  2UYN A;  2I6D A;  2G9I A;  1OFU A;  5LOV A;  2CHS A;  3LWP C;  2RHL A;  3OBY A;  4BT6 A;  2UYN B;  3ZO8 A;  1RLU A;  5LYJ B;  1KQS F;  1VQM F;  1IV2 A;  3V4D A;  1XRG A;  5LYJ A;  3NK7 A;  5IJ9 A;  1W5E A;  1W55 A;  3K0T A;  1IV1 A;  3CCM F;  1TUB A;  2RHO A;  3RYI B;  2OTJ F;  1H48 A;  4B62 A;  4ZOL A;  3RYI A;  1IV3 A;  3FPI A;  4ZOL B;  2CHT A;  3N4Z A;  3U0O A;  1W5B A;  3D01 A;  2BTQ B;  1SZQ A;  2PHN A;  2Z1F A;  4PWT A;  5FJ4 C;  3CCS F;  4C81 A;  4LNU B;  1T0A A;  1M90 H;  5LP6 A;  3ESJ A;  2KTV A;  3HKD B;  1W5F A;  1X7O A;  1JFF A;  2ZOD A;  3CME F;  3OW2 F;  1W58 1;  4O4L B;  3P0Z A;  1KC8 H;  2KTU A;  3CCJ F;  4O4L A;  1VQK F;  2MQE A;  5JQG B;  4IHJ A;  3ZOP A;  2OZB A;  1VQ4 F;  3E22 A;  3JAW B;  1Q7Y H;  1JJ2 F;  1X52 A;  5FNV A;  3VOB A;  4BVR A;  3HJW C;  3E22 B;  5EAZ A;  2HRU A;  1FNK A;  3TD5 A;  3CC7 F;  4HNA A;  3CCL F;  3VTI C;  2ZOV A;  4ERH A;  2R6R 1;  1U3P A;  2OTL F;  4BVQ A;  2VGN A;  4NQ3 A;  4O2A A;  5FLX M;  4G4X A;  2HP3 A;  3V7E A;  3LWO C;  1KNK A;  3K2X A;  4O4I B;  5KX5 A;  2ZAU A;  2OHW A;  2CZW A;  4RHA A;  3HKB B;  1CK2 A;  1YIJ F;  1TVK A;  2Q1Y A;  1U43 A;  2VXY A;  3D54 A;  5BMV B;  1Z5V A;  2LCA A;  1ZWZ A;  1YQN A;  2IG8 A;  3N2G B;  5HP8 A;  1YIT F;  3VOA A;  3CD6 F;  5MN6 A;  5GAN K;  1VHA A;  3I7T A;  1FFX B;  4TUY A;  1K73 H;  1W5A A;  3WGN A;  3K14 A;  3S0Y A;  1W42 A;  3P4E A;  1J7H A;  2HP0 A;  2P6Y A;  2VAM A;  2HQS C;  1CN7 A;  3LYB A;  3VO8 A;  4EI7 A;  2GVI A;  2ZVY A;  4TV8 A;  4X1I B;  5ITZ B;  1GX1 A;  5GON B;  3S0W A;  3S0H A;  2ZF8 A;  1JY8 A;  3JAK A;  5IYZ B;  3QHD A;  5EIB D;  3S02 A;  1T0K B;  5HY4 A;  5JH7 B;  3N2K B;  5J2T B;  1VQN F;  5HY1 A;  3JAT A;  2Q1X A;  3WGJ A;  5C8Y B;  2HRY A;  5JH7 A;  3NVI B;  1RQ7 A;  4YJ3 B;  3CCU F;  4BT3 A;  3NK6 A;  5JVD A;  3BYQ A;  4O2B A;  2LBW A;  2YXZ A;  4O2B B;  1Q8R A;  2QTP A;  2Z1E A;  4G88 A;  4EI8 A;  1IV4 A;  1VQP F;  5HXU A;  3JAS A;  4I55 B;  3CPQ A;  3S06 A;  4HNA B;  3G71 F;  1ONI A;  3VYS C;  1E7K A;  2UYJ A;  3N4Y A;  3CB2 A;  4BVT A;  4O2A B;  3TD3 A;  3JCM M;  4WBN B;  2UZH A;  2WAL A;  2CVL A;  5EIB C;  4O4J B;  5EWR A;  1W3E X;  4ZHW A;  3SIU A;  4O4J A;  3T80 A;  5JCO A;  2BTO A;  1DBF A;  1TVK B;  4O4H B;  2H8E A;  5EB0 A;  5HXZ A;  1GO1 A;  3ZP4 A;  4F6R A;  3ERN A;  4U3J A;  5CA1 A;  1H7M A;  3WPX A;  2PMP A;  3N2G A;  5LP6 C;  4EB6 A;  2Z01 A;  3RYC A;  4ZI7 B;  3JVH A;  3ZP7 A;  4X1K B;  5A2Q M;  4ZK7 A;  1X7P A;  2H6L A;  4TZZ A;  3Q8H A;  3IEW A;  1H47 A;  3WGL A;  4C82 A;  1JN1 A;  3KHN A;  1U40 A;  1YI2 F;  3RYF B;  5CB4 B;  2F9Z C;  5IJ9 B;  1YJW F;  2RHJ A;  1VH8 A;  3VCZ A;  3LWV C;  4DRX A;  3KIZ A;  3IR9 A;  2GZL A;  4TV9 A;  4BT5 A;  1VQ9 F; 
#chains in the Genus database with same CATH homology
 3P10 A;  1IV3 A;  3ERN A;  3FPI A;  3IKE A;  1U3L A;  1U43 A;  3F6M A;  2PMP A;  3KE1 A;  4C8E A;  3F0E A;  3F0D A;  3MBM A;  1IV4 A;  1GX1 A;  1YQN A;  3JVH A;  3RE3 A;  1JY8 A;  3FBA A;  3IEQ A;  3Q8H A;  4C81 A;  1T0A A;  1H47 A;  3IEW A;  1VHA A;  3QHD A;  3ESJ A;  4C82 A;  1JN1 A;  1KNJ A;  3F0G A;  2UZH A;  1U3P A;  1U40 A;  3B6N A;  3K14 A;  1KNK A;  1IV2 A;  2AMT A;  3K2X A;  3P0Z A;  1W57 A;  5B8F A;  3GHZ A;  1VH8 A;  3T80 A;  4C8I A;  3ELC A;  1W55 A;  1IV1 A;  3EOR A;  3F0F A;  4C8G A;  3IKF A;  1H48 A;  2GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...