2DYYA

Crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
125
Chain Sequence
MKEVIFTENAPKPIGPYSQAIKAGNFLFIAGQIPIDPKTGEIVKGDIKDQTRQVLENIKAILEAAGYSLNDVIKVTVYLKDNDFAKMNEVYAEYFGESKPARVAVEVSRLPKDVLIEIEAIAYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0076 protein PH0854
publication title Crystal structure of putative translation initiation inhibitor PH0854 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 30
structure length 125
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2dyyA00
2CVLA 1ONIA 2CHTA 1QAHA 3I3FA 2CW4A 3K12A 2EWCA 3ZO8A 3L7QA 1NQ3A 2UYNA 2CHSA 1X25A 1XRGA 1JD1A 1FNJA 3LMEA 1QD9A 3M1XA 1FNKA 2CWJA 2DYYA 1QU9A 4ZK7A 5HP7A 3K0TA 3QUWA 3ZP7A 3GTZA 1J7HA 3VCZA 2OTMA 1UFYA 3MQWA 3LYBA 2UYKA 2UYNB 2IG8A 3ZP4A 3I7TA 3KJKA 3R0PA 3D01A 3ZOPA 3M4SA 3KJJA 2B33A 1ODEA 1UI9A 1PF5A 2UYPA 4NWOB 5HP8A 2UYJA 1DBFA 3V4DA 1XHOA 2CSLA 1COMA
chains in the Genus database with same CATH superfamily
5MN4A 3K2XA 2EWCA 5LA6B 1OFUA 2W8BC 4X1IA 2QA4F 3CB2A 3WJRA 1PXWA 4R40B 4TV8B 3JVHA 1Q8RA 4X1YA 5LOVA 4I4TB 1IV1A 3F6MA 3I55F 5C8YB 2AIZP 3WGMA 5LP6B 2WALA 3S02A 3CCRF 3M4SA 3NVIB 4EI9A 3OONA 1QVFF 4TV9A 1TUBA 4EB6B 1YGYA 2ZOVA 1W581 3TD3A 4O2AB 1R1MA 1X7PA 4DRXB 5LXTB 1VQOF 2AMTA 1KC8H 3CC7F 3HKEA 3CCUF 2G9IA 5CA0A 2FGYA 1YITF 1GO1A 3IR9A 2KTVA 3JAKA 5FJ4C 5HP7A 3ZP7A 2YYEA 1W40A 4FFBB 4O4HA 3VCZA 2ZVYA 3VO8A 3FD6A 2BO1A 2IG8A 3FFMA 3KJKA 2H6LA 3WXMB 2B33A 5HWEA 1IPAA 2KTUA 5EWRA 5A2QM 3MCAB 3RA5A 5BMVB 3JALA 2HX0A 2CVLA 2LBXA 5GONA 3C8LA 4BT3A 4G4ZA 5EZYA 4EI7A 3RYCB 3S0YA 3CYPB 4DXDA 3KIZA 2ZVZA 2HRUA 1NMUB 1E7KA 3BYQA 4BVSA 2CWJA 3S06A 3MCQA 3T80A 4ZHWA 1CLIA 5EB0A 3J7AR 3G6EF 3FD5A 2I6RA 3D01A 1VQLF 1XBIA 3CD6F 5KMGA 2VAPA 3C9TA 5HP8A 5IJ0B 5KX5A 1U40A 1YHQF 1COMA 3ELCA 1N8RH 2CZWA 3RA6A 3ZO8A 3HKBA 2UYNA 2RHOA 1VQPF 3CC2F 3K14A 3JCMM 1FNJA 3LMEA 5JVDA 1VQVA 1TVKB 3J80M 4O4IA 3WGJA 3N2GB 3C9UA 4G4WA 5IYZB 2HS0A 3OBYA 4ZOLB 2Z1UA 4C81A 4RQOA 3NK6A 3JASB 3VI6A 3V3TA 1KD1H 1VQ7F 5JQGB 5MN6A 5HXUA 4TV8A 3QHDA 3O85A 3PAFA 1GX1A 4I4TA 2VGNA 2R751 5J2UB 5C8YA 3WGNA 4TZZA 1H7MA 4KWEA 4IHJA 4YJ2B 3F0EA 1W59A 2Z1FA 2I6DA 1YI2F 4O2AA 3LWRC 1RLGA 4DRXA 3V7EA 3DDNA 1W3EX 3I7TA 1Z5WA 4X20B 4LCKA 1JFFA 2HS3A 5IT9M 4O4JB 3CMEF 4C82A 4HNAB 1U43A 3VYTC 4LNUB 4EI8A 3NMUC 4ZI7B 3HJWC 4X1KB 5HY0A 1FFXA 4I55A 3U0OA 3JAWB 3CCMF 3K0TA 3RYIB 2KGWA 2AIFA 2OTMA 3RYCA 2Q1YA 4BVRA 2ZODA 5HY1A 3LDTA 3R0PA 1KQSF 2QEXF 5G4VC 1SA0A 2NMUA 4IIJA 1PF5A 2H8CA 3WGLA 3SIUA 4NWOB 1W5FA 2UYJA 5GIOC 4X3LA 3VIUA 3P0ZA 3S0HA 3CCLF 1OAPA 4WBNA 5MN5A 3NK7A 1FSZA 1NQ3A 2CHSA 3WPXA 2RHJA 2OZBA 5IJ0A 2VAMA 3SIVA 3QUWA 4TUYA 3GTZA 3RYHB 3JATB 3UT5B 4C8IA 3QTYA 3CCSF 2V9YA 3CMAF 3FBAA 4B5CA 3N2KB 2ALEA 4XCQA 3N2GA 1VQ8F 1ODEA 5J2TB 2OTJF 5CA1B 4BY9D 5IYZA 5EIBC 3V4DA 5HXZA 2DT4A 3RE3A 2RHHA 1YIJF 5CB4B 3JAMM 1ONIA 2IQQA 4F6RB 2F9ZC 1ZWZA 5AVMA 1X25A 4U3JA 5EO3A 1S72F 1VQKF 2LCAA 5LP6C 1U3PA 3VMFB 2UZHA 3P10A 4BT7A 4YJ3B 1NJIH 3I56F 2MQEA 3MQWA 1VQMF 1VH8A 2HQSC 2IAFA 3ZP4A 3B6NA 5FLXM 1W5EA 3WPWA 1YJ9F 1CN7A 5ITZA 1VHAA 1KNJA 4M8IA 3MBMA 4ZHQA 1VQNF 5LOVB 1W2BF 1VK3A 3MDOA 3WGKA 2CW4A 3RYFA 1CK2A 2VXYA 3Q8HA 4O4JA 2DYYA 1QU9A 1TUBB 2HP0B 1K9MH 4HNAA 1VQ4F 5EB1B 4LNUA 3HWUA 5LA6A 1W5BA 4B46A 3HTNA 4X1KA 1T0AA 3C9RA 3KJJA 2RHLA 3HKEB 2GZLA 5CA0B 3JARB 1UI9A 3C9SA 3WJQA 3RYIA 3JAKB 3F0GA 4BVTA 2BTUA 2GLZA 2QTPA 5LP6A 3D00A 3TD5A 1X52A 5EAZA 3N4YA 1QD9A 4EB6A 1RA4A 2LBWA 3CC4F 3KHNA 4NUTA 5LYJB 2UYKA 5FNVB 5LXTA 3HKDB 3CPQA 3LWOC 3VYSC 1T0KB 1JY8A 2OHWA 3NVKE 4C4WC 1M1KH 3WJPA 3RYHA 3JATA 2ZAUA 4NQ3A 4FFBA 2HS4A 1X7OA 3K12A 2QI2A 2Z01A 4G4XA 3AGKA 3LFOA 2JNBA 1RQ2A 3V7QA 4BT5A 1FNKA 1W57A 3F0FA 3VOBA 1J7HA 5BMVA 1YJWF 1W55A 4F6RA 3CCJF 3PLAC 2UYNB 4O4LB 5JH7B 3E22B 5GAPK 1Q81H 1VQ9F 5JVDB 4RHAA 3LWQC 4I50B 4O4IB 3GHZA 5GINC 1DT9A 3LWVC 3IEQA 2PHNA 3I3FA 1Z5VA 1Q7YH 4E6EA 3S0WA 1YQNA 4BT2A 3ESJA 5IJ9B 1W41A 2H8EA 3P4EA 2Z1EA 3FPIA 4BVQA 4IHJB 4C8EA 3TD4A 1JJ2F 3VTIC 1RQ7A 3CPWF 1TVKA 4BT4A 2HP0A 3CCQF 3DC2A 2BTOA 4ZOLA 3JASA 1GZ0A 5HY2A 3GYQA 5B8FA 3F0DA 2OTLF 1U3LA 2Z1TA 3JARA 1JD1A 5JQGA 1JFFB 1SZQA 5EYPB 1XV2A 3HKCB 3IKFA 2N48A 4O2BB 5DCVA 5J2UA 2VGMA 2HP3A 3LYBA 1RLUA 4YJ2A 1SDSA 4X1IB 1IV3A 2HRYA 1FFXB 3S03A 4I55B 2FC3A 2GVIA 4ERHA 4BT6A 1GO0A 5LYJA 2CHTA 4X1YB 5FNVA 4ZHVA 3L7QA 3HKDA 5EIBD 4BW0B 3EORA 3N4ZA 1Q86H 3CG6A 4X20A 1SA0B 3OBWA 4IIJB 1H47A 3M1XA 4U39A 4TV9B 4ZHYB 1K8AH 3CXCF 1VQ6F 3J81M 1QVGF 4WBNB 4C8GA 3E20B 4G4YA 4ZI7A 3G4SF 1W42A 1Q82H 1JN1A 2RB9A 3JAWA 5GANK 2UYPA 3CCEF 1DBFA 1M90H 1W5AA 4TUYB 5JCOC 1QAHA 4O4HB 4G4VA 4O4LA 5JH7A 4G88A 3G71F 3E22A 2KG4A 3LWPC 4I50A 2K1SA 3M84A 2L26A 1KNKA 4B45A 3ON1A 3CCVF 3E1YA 3JALB 5GONB 2P6YA 5GIPC 2YXZA 5EZYB 5G4UC 3ZOPA 4X3MA 4U3JB 2VAWA 5IJ9A 1XHOA 3IEWA 2CSLA 3VYUC 3UT5A 1IV4A 2LBTA 1VQ5F 2PMPA 3HAXD 4B62A 3N2KA 3VOAA 3OW2F 1YJNF 2R6R1 2HVYD 5ITZB 1XRGA 5J2TA 5KMGB 5CA1A 4ZK7A 2BTQB 3IKEA 1IV2A 5KX5B 4ZHQB 5CB4A 1UFYA 5HY4A 1H48A 3RYFB 4PWTA 2Q1XA 3HKBB 1K73H 2ZF8A 3IMPA 5EYPA 3HKCA 5JCOA 3D54A 3KE1A 3CYQA 4O2BA 3ERNA 4YJ3A
chains in the Genus database with same CATH topology
2CVLA 1ONIA 2CHTA 1QAHA 3I3FA 2CW4A 3K12A 2EWCA 3ZO8A 3L7QA 1NQ3A 2UYNA 2CHSA 1X25A 1XRGA 1JD1A 1FNJA 3LMEA 1QD9A 3M1XA 1FNKA 2CWJA 2DYYA 1QU9A 4ZK7A 5HP7A 3K0TA 3QUWA 3ZP7A 3GTZA 1J7HA 3VCZA 2OTMA 1UFYA 3MQWA 3LYBA 2UYKA 2UYNB 2IG8A 3ZP4A 3I7TA 3KJKA 3R0PA 3D01A 3ZOPA 3M4SA 3KJJA 2B33A 1ODEA 1UI9A 1PF5A 2UYPA 4NWOB 5HP8A 2UYJA 1DBFA 3V4DA 1XHOA 2CSLA 1COMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVL A;  1ONI A;  2CHT A;  1QAH A;  3I3F A;  2CW4 A;  3K12 A;  2EWC A;  3ZO8 A;  3L7Q A;  1NQ3 A;  2UYN A;  2CHS A;  1X25 A;  1XRG A;  1JD1 A;  1FNJ A;  3LME A;  1QD9 A;  3M1X A;  1FNK A;  2CWJ A;  2DYY A;  1QU9 A;  4ZK7 A;  5HP7 A;  3K0T A;  3QUW A;  3ZP7 A;  3GTZ A;  1J7H A;  3VCZ A;  2OTM A;  1UFY A;  3MQW A;  3LYB A;  2UYK A;  2UYN B;  2IG8 A;  3ZP4 A;  3I7T A;  3KJK A;  3R0P A;  3D01 A;  3ZOP A;  3M4S A;  3KJJ A;  2B33 A;  1ODE A;  1UI9 A;  1PF5 A;  2UYP A;  4NWO B;  5HP8 A;  2UYJ A;  1DBF A;  3V4D A;  1XHO A;  2CSL A;  1COM A; 
#chains in the Genus database with same CATH topology
 5MN4 A;  3K2X A;  2EWC A;  5LA6 B;  1OFU A;  2W8B C;  4X1I A;  2QA4 F;  3CB2 A;  3WJR A;  1PXW A;  4R40 B;  4TV8 B;  3JVH A;  1Q8R A;  4X1Y A;  5LOV A;  4I4T B;  1IV1 A;  3F6M A;  3I55 F;  5C8Y B;  2AIZ P;  3WGM A;  5LP6 B;  2WAL A;  3S02 A;  3CCR F;  3M4S A;  3NVI B;  4EI9 A;  3OON A;  1QVF F;  4TV9 A;  1TUB A;  4EB6 B;  1YGY A;  2ZOV A;  1W58 1;  3TD3 A;  4O2A B;  1R1M A;  1X7P A;  4DRX B;  5LXT B;  1VQO F;  2AMT A;  1KC8 H;  3CC7 F;  3HKE A;  3CCU F;  2G9I A;  5CA0 A;  2FGY A;  1YIT F;  1GO1 A;  3IR9 A;  2KTV A;  3JAK A;  5FJ4 C;  5HP7 A;  3ZP7 A;  2YYE A;  1W40 A;  4FFB B;  4O4H A;  3VCZ A;  2ZVY A;  3VO8 A;  3FD6 A;  2BO1 A;  2IG8 A;  3FFM A;  3KJK A;  2H6L A;  3WXM B;  2B33 A;  5HWE A;  1IPA A;  2KTU A;  5EWR A;  5A2Q M;  3MCA B;  3RA5 A;  5BMV B;  3JAL A;  2HX0 A;  2CVL A;  2LBX A;  5GON A;  3C8L A;  4BT3 A;  4G4Z A;  5EZY A;  4EI7 A;  3RYC B;  3S0Y A;  3CYP B;  4DXD A;  3KIZ A;  2ZVZ A;  2HRU A;  1NMU B;  1E7K A;  3BYQ A;  4BVS A;  2CWJ A;  3S06 A;  3MCQ A;  3T80 A;  4ZHW A;  1CLI A;  5EB0 A;  3J7A R;  3G6E F;  3FD5 A;  2I6R A;  3D01 A;  1VQL F;  1XBI A;  3CD6 F;  5KMG A;  2VAP A;  3C9T A;  5HP8 A;  5IJ0 B;  5KX5 A;  1U40 A;  1YHQ F;  1COM A;  3ELC A;  1N8R H;  2CZW A;  3RA6 A;  3ZO8 A;  3HKB A;  2UYN A;  2RHO A;  1VQP F;  3CC2 F;  3K14 A;  3JCM M;  1FNJ A;  3LME A;  5JVD A;  1VQV A;  1TVK B;  3J80 M;  4O4I A;  3WGJ A;  3N2G B;  3C9U A;  4G4W A;  5IYZ B;  2HS0 A;  3OBY A;  4ZOL B;  2Z1U A;  4C81 A;  4RQO A;  3NK6 A;  3JAS B;  3VI6 A;  3V3T A;  1KD1 H;  1VQ7 F;  5JQG B;  5MN6 A;  5HXU A;  4TV8 A;  3QHD A;  3O85 A;  3PAF A;  1GX1 A;  4I4T A;  2VGN A;  2R75 1;  5J2U B;  5C8Y A;  3WGN A;  4TZZ A;  1H7M A;  4KWE A;  4IHJ A;  4YJ2 B;  3F0E A;  1W59 A;  2Z1F A;  2I6D A;  1YI2 F;  4O2A A;  3LWR C;  1RLG A;  4DRX A;  3V7E A;  3DDN A;  1W3E X;  3I7T A;  1Z5W A;  4X20 B;  4LCK A;  1JFF A;  2HS3 A;  5IT9 M;  4O4J B;  3CME F;  4C82 A;  4HNA B;  1U43 A;  3VYT C;  4LNU B;  4EI8 A;  3NMU C;  4ZI7 B;  3HJW C;  4X1K B;  5HY0 A;  1FFX A;  4I55 A;  3U0O A;  3JAW B;  3CCM F;  3K0T A;  3RYI B;  2KGW A;  2AIF A;  2OTM A;  3RYC A;  2Q1Y A;  4BVR A;  2ZOD A;  5HY1 A;  3LDT A;  3R0P A;  1KQS F;  2QEX F;  5G4V C;  1SA0 A;  2NMU A;  4IIJ A;  1PF5 A;  2H8C A;  3WGL A;  3SIU A;  4NWO B;  1W5F A;  2UYJ A;  5GIO C;  4X3L A;  3VIU A;  3P0Z A;  3S0H A;  3CCL F;  1OAP A;  4WBN A;  5MN5 A;  3NK7 A;  1FSZ A;  1NQ3 A;  2CHS A;  3WPX A;  2RHJ A;  2OZB A;  5IJ0 A;  2VAM A;  3SIV A;  3QUW A;  4TUY A;  3GTZ A;  3RYH B;  3JAT B;  3UT5 B;  4C8I A;  3QTY A;  3CCS F;  2V9Y A;  3CMA F;  3FBA A;  4B5C A;  3N2K B;  2ALE A;  4XCQ A;  3N2G A;  1VQ8 F;  1ODE A;  5J2T B;  2OTJ F;  5CA1 B;  4BY9 D;  5IYZ A;  5EIB C;  3V4D A;  5HXZ A;  2DT4 A;  3RE3 A;  2RHH A;  1YIJ F;  5CB4 B;  3JAM M;  1ONI A;  2IQQ A;  4F6R B;  2F9Z C;  1ZWZ A;  5AVM A;  1X25 A;  4U3J A;  5EO3 A;  1S72 F;  1VQK F;  2LCA A;  5LP6 C;  1U3P A;  3VMF B;  2UZH A;  3P10 A;  4BT7 A;  4YJ3 B;  1NJI H;  3I56 F;  2MQE A;  3MQW A;  1VQM F;  1VH8 A;  2HQS C;  2IAF A;  3ZP4 A;  3B6N A;  5FLX M;  1W5E A;  3WPW A;  1YJ9 F;  1CN7 A;  5ITZ A;  1VHA A;  1KNJ A;  4M8I A;  3MBM A;  4ZHQ A;  1VQN F;  5LOV B;  1W2B F;  1VK3 A;  3MDO A;  3WGK A;  2CW4 A;  3RYF A;  1CK2 A;  2VXY A;  3Q8H A;  4O4J A;  2DYY A;  1QU9 A;  1TUB B;  2HP0 B;  1K9M H;  4HNA A;  1VQ4 F;  5EB1 B;  4LNU A;  3HWU A;  5LA6 A;  1W5B A;  4B46 A;  3HTN A;  4X1K A;  1T0A A;  3C9R A;  3KJJ A;  2RHL A;  3HKE B;  2GZL A;  5CA0 B;  3JAR B;  1UI9 A;  3C9S A;  3WJQ A;  3RYI A;  3JAK B;  3F0G A;  4BVT A;  2BTU A;  2GLZ A;  2QTP A;  5LP6 A;  3D00 A;  3TD5 A;  1X52 A;  5EAZ A;  3N4Y A;  1QD9 A;  4EB6 A;  1RA4 A;  2LBW A;  3CC4 F;  3KHN A;  4NUT A;  5LYJ B;  2UYK A;  5FNV B;  5LXT A;  3HKD B;  3CPQ A;  3LWO C;  3VYS C;  1T0K B;  1JY8 A;  2OHW A;  3NVK E;  4C4W C;  1M1K H;  3WJP A;  3RYH A;  3JAT A;  2ZAU A;  4NQ3 A;  4FFB A;  2HS4 A;  1X7O A;  3K12 A;  2QI2 A;  2Z01 A;  4G4X A;  3AGK A;  3LFO A;  2JNB A;  1RQ2 A;  3V7Q A;  4BT5 A;  1FNK A;  1W57 A;  3F0F A;  3VOB A;  1J7H A;  5BMV A;  1YJW F;  1W55 A;  4F6R A;  3CCJ F;  3PLA C;  2UYN B;  4O4L B;  5JH7 B;  3E22 B;  5GAP K;  1Q81 H;  1VQ9 F;  5JVD B;  4RHA A;  3LWQ C;  4I50 B;  4O4I B;  3GHZ A;  5GIN C;  1DT9 A;  3LWV C;  3IEQ A;  2PHN A;  3I3F A;  1Z5V A;  1Q7Y H;  4E6E A;  3S0W A;  1YQN A;  4BT2 A;  3ESJ A;  5IJ9 B;  1W41 A;  2H8E A;  3P4E A;  2Z1E A;  3FPI A;  4BVQ A;  4IHJ B;  4C8E A;  3TD4 A;  1JJ2 F;  3VTI C;  1RQ7 A;  3CPW F;  1TVK A;  4BT4 A;  2HP0 A;  3CCQ F;  3DC2 A;  2BTO A;  4ZOL A;  3JAS A;  1GZ0 A;  5HY2 A;  3GYQ A;  5B8F A;  3F0D A;  2OTL F;  1U3L A;  2Z1T A;  3JAR A;  1JD1 A;  5JQG A;  1JFF B;  1SZQ A;  5EYP B;  1XV2 A;  3HKC B;  3IKF A;  2N48 A;  4O2B B;  5DCV A;  5J2U A;  2VGM A;  2HP3 A;  3LYB A;  1RLU A;  4YJ2 A;  1SDS A;  4X1I B;  1IV3 A;  2HRY A;  1FFX B;  3S03 A;  4I55 B;  2FC3 A;  2GVI A;  4ERH A;  4BT6 A;  1GO0 A;  5LYJ A;  2CHT A;  4X1Y B;  5FNV A;  4ZHV A;  3L7Q A;  3HKD A;  5EIB D;  4BW0 B;  3EOR A;  3N4Z A;  1Q86 H;  3CG6 A;  4X20 A;  1SA0 B;  3OBW A;  4IIJ B;  1H47 A;  3M1X A;  4U39 A;  4TV9 B;  4ZHY B;  1K8A H;  3CXC F;  1VQ6 F;  3J81 M;  1QVG F;  4WBN B;  4C8G A;  3E20 B;  4G4Y A;  4ZI7 A;  3G4S F;  1W42 A;  1Q82 H;  1JN1 A;  2RB9 A;  3JAW A;  5GAN K;  2UYP A;  3CCE F;  1DBF A;  1M90 H;  1W5A A;  4TUY B;  5JCO C;  1QAH A;  4O4H B;  4G4V A;  4O4L A;  5JH7 A;  4G88 A;  3G71 F;  3E22 A;  2KG4 A;  3LWP C;  4I50 A;  2K1S A;  3M84 A;  2L26 A;  1KNK A;  4B45 A;  3ON1 A;  3CCV F;  3E1Y A;  3JAL B;  5GON B;  2P6Y A;  5GIP C;  2YXZ A;  5EZY B;  5G4U C;  3ZOP A;  4X3M A;  4U3J B;  2VAW A;  5IJ9 A;  1XHO A;  3IEW A;  2CSL A;  3VYU C;  3UT5 A;  1IV4 A;  2LBT A;  1VQ5 F;  2PMP A;  3HAX D;  4B62 A;  3N2K A;  3VOA A;  3OW2 F;  1YJN F;  2R6R 1;  2HVY D;  5ITZ B;  1XRG A;  5J2T A;  5KMG B;  5CA1 A;  4ZK7 A;  2BTQ B;  3IKE A;  1IV2 A;  5KX5 B;  4ZHQ B;  5CB4 A;  1UFY A;  5HY4 A;  1H48 A;  3RYF B;  4PWT A;  2Q1X A;  3HKB B;  1K73 H;  2ZF8 A;  3IMP A;  5EYP A;  3HKC A;  5JCO A;  3D54 A;  3KE1 A;  3CYQ A;  4O2B A;  3ERN A;  4YJ3 A; 
#chains in the Genus database with same CATH homology
 2CVL A;  1ONI A;  2CHT A;  1QAH A;  3I3F A;  2CW4 A;  3K12 A;  2EWC A;  3ZO8 A;  3L7Q A;  1NQ3 A;  2UYN A;  2CHS A;  1X25 A;  1XRG A;  1JD1 A;  1FNJ A;  3LME A;  1QD9 A;  3M1X A;  1FNK A;  2CWJ A;  2DYY A;  1QU9 A;  4ZK7 A;  5HP7 A;  3K0T A;  3QUW A;  3ZP7 A;  3GTZ A;  1J7H A;  3VCZ A;  2OTM A;  1UFY A;  3MQW A;  3LYB A;  2UYK A;  2UYN B;  2IG8 A;  3ZP4 A;  3I7T A;  3KJK A;  3R0P A;  3D01 A;  3ZOP A;  3M4S A;  3KJJ A;  2B33 A;  1ODE A;  1UI9 A;  1PF5 A;  2UYP A;  4NWO B;  5HP8 A;  2UYJ A;  1DBF A;  3V4D A;  1XHO A;  2CSL A;  1COM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...