2DYYA

Crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
125
Chain Sequence
MKEVIFTENAPKPIGPYSQAIKAGNFLFIAGQIPIDPKTGEIVKGDIKDQTRQVLENIKAILEAAGYSLNDVIKVTVYLKDNDFAKMNEVYAEYFGESKPARVAVEVSRLPKDVLIEIEAIAYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0076 protein PH0854
publication title Crystal structure of putative translation initiation inhibitor PH0854 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 30
structure length 125
sequence length 126
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2dyyA00
2CW4A 2CSLA 2CWJA 3K0TA 2UYNB 3LMEA 2CHSA 2OTMA 3ZOPA 2UYPA 4ZK7A 1NQ3A 3I7TA 2CVLA 3D01A 3GTZA 2UYKA 1J7HA 3K12A 5HP7A 3QUWA 3LYBA 1XHOA 3ZP7A 2CHTA 3KJKA 3MQWA 3L7QA 2EWCA 1PF5A 2B33A 3I3FA 1JD1A 3R0PA 1QD9A 3M1XA 1UI9A 2UYJA 2UYNA 3VCZA 2IG8A 1XRGA 1ONIA 3ZO8A 5HP8A 1FNKA 1COMA 1QAHA 1QU9A 1UFYA 1ODEA 1X25A 3M4SA 1FNJA 2DYYA 3V4DA 1DBFA 3KJJA 4NWOB 3ZP4A
chains in the Genus database with same CATH superfamily
2CWJA 3N2GA 4YJ2A 5EIBC 1IPAA 3O85A 4NUTA 3VO8A 2CVLA 2UYKA 2OTLF 2HRYA 1U3PA 5GONA 2ALEA 3VYTC 2YYEA 2H6LA 4PWTA 3LFOA 1U40A 4TV8A 3JATB 2B33A 3Q8HA 1VH8A 3D54A 2L26A 4HNAA 5EB1B 1UI9A 5LXTA 4O4HA 3WJQA 3NMUC 2KTUA 5CA1A 2N48A 1FNKA 5IT9M 5C8YA 1W42A 1X25A 5FJ4C 4NWOB 2QTPA 3F0FA 3OW2F 3IKFA 5HWEA 1J7HA 3S06A 4O4JB 4O2BA 1YHQF 2AIFA 3KIZA 3CCLF 1W3EX 1W2BF 1T0KB 1YJWF 1X7PA 1TUBB 5FLXM 4ZI7B 2ZF8A 3AGKA 5IYZA 3LWVC 1KC8H 3JASB 5AVMA 2K1SA 2I6RA 3IKEA 4EI8A 3S0WA 2Z1FA 3LMEA 4DRXB 1VQNF 3CYPB 3KHNA 3V7QA 2HP0B 3VIUA 3RYCA 5HP7A 1NJIH 4G4YA 2QEXF 5LOVA 5EZYA 4X20A 4ZHQB 3IEWA 3PAFA 3WGKA 3S0HA 3HJWC 3GHZA 2GLZA 2UYJA 5MN5A 2W8BC 4BT4A 3ZO8A 3CMAF 5FNVB 1RQ2A 3D00A 3G6EF 3GYQA 5HY4A 2HP0A 3NVIB 2LCAA 3TD3A 4G4WA 5IJ9B 4YJ3A 2OTMA 3F0DA 4ZHQA 1QVGF 3ESJA 4TUYA 1OFUA 4IIJB 4WBNB 4XCQA 2Q1YA 2HRUA 4O4IB 5J2TB 4ZHYB 4BT2A 5LP6B 1VQMF 5JVDA 3CXCF 3LDTA 3VMFB 1W5FA 3IR9A 3M1XA 3VTIC 4I55A 4BVTA 2IQQA 5JQGB 3CCJF 1YITF 4TV9B 3ELCA 5HP8A 4TZZA 2GVIA 2H8CA 3C9RA 4WBNA 4ZOLB 4F6RA 3K2XA 2CW4A 1VQLF 2ZVYA 4BW0B 4LCKA 4ZK7A 1RQ7A 3RYHB 4C4WC 2FGYA 5CA0A 3M84A 3G4SF 1YIJF 2Z1TA 3SIVA 1Q8RA 4YJ2B 3L7QA 4TV9A 3DDNA 1JD1A 4C8EA 3R0PA 1YJ9F 3CCMF 1PXWA 1VHAA 5GONB 2P6YA 4ZOLA 1ONIA 5HXUA 4TV8B 2OHWA 4G4VA 3JAWA 1T0AA 4X1KA 5HY0A 3K14A 4HNAB 3KJJA 5LXTB 4O4HB 3VYSC 3ON1A 2Z1EA 4O4LA 2HS4A 2BTUA 2HP3A 5CA1B 3CPQA 4C81A 2ZAUA 4B45A 3GTZA 5C8YB 2GZLA 3P10A 3C9UA 2VAWA 1M1KH 5JCOC 5LP6C 2RHHA 3I56F 1CK2A 2Z01A 1RLGA 2H8EA 2RHJA 2HQSC 4DXDA 2HS3A 3CCQF 4O2BB 1N8RH 3N2KA 3HKEA 2RHLA 3WGJA 3OBYA 1YGYA 1S72F 5IYZB 1K8AH 4X3MA 3CCRF 3BYQA 1E7KA 2HVYD 1H7MA 4U3JA 3WXMB 5IJ0A 1TVKA 2BTOA 3I7TA 1W5EA 3I55F 1VQ5F 4X3LA 4G88A 4I50B 1OAPA 3WGMA 3HKDA 1KQSF 3C9TA 1X7OA 4IHJA 2HX0A 5A2QM 3RYCB 2IAFA 1SA0A 1RLUA 5KMGA 3WGNA 5LOVB 3G71F 5EZYB 4X20B 3E1YA 2LBXA 3N4ZA 3J7AR 5EAZA 3V4DA 3WGLA 3MQWA 3MCQA 4BVRA 3ZP4A 3LWOC 1SDSA 1X52A 4I50A 3RYIA 1IV3A 4ERHA 5KX5A 3CCUF 3E20B 5G4VC 3LYBA 3I3FA 4YJ3B 2YXZA 4TUYB 3OBWA 2F9ZC 3RYFA 4B62A 4EI9A 3V3TA 5JVDB 3CC2F 1JJ2F 2DT4A 4I55B 3LWRC 1KNKA 1VQKF 1GO1A 4FFBA 5EYPA 5HY2A 3WPXA 3D01A 3T80A 2LBWA 2CZWA 1K73H 1Q7YH 3JCMM 4RHAA 1JY8A 2ZOVA 1XHOA 3DC2A 4F6RB 1VQ9F 1XBIA 2JNBA 4R40B 1Q81H 4O2AA 5EB0A 4BVSA 3J81M 1QD9A 4C8GA 2HS0A 5JH7A 4NQ3A 5CA0B 2UYNA 5MN6A 2KG4A 1YI2F 3MDOA 3JARA 4X1IA 3VI6A 1CN7A 1UFYA 2WALA 3M4SA 3HTNA 5EO3A 2VAMA 3HKCA 1Q82H 3TD5A 1FSZA 1W5AA 3E22B 2OZBA 3CPWF 4B46A 1FFXA 1H48A 1NQ3A 5MN4A 3JAWB 3F0EA 3KE1A 4M8IA 4X1KB 1W5BA 4C82A 3KJKA 4O4LB 1PF5A 3JVHA 3CCVF 1IV1A 3JAKA 4G4XA 1W41A 1YQNA 1XV2A 3E22A 3WPWA 2BTQB 2R751 1ODEA 2VXYA 1VQOF 4I4TA 3N2KB 3U0OA 1KD1H 3HKEB 3C8LA 5EWRA 4LNUA 5ITZA 5LA6A 3SIUA 1SZQA 3ZP7A 2Z1UA 5LYJA 1W55A 1R1MA 5BMVA 3RE3A 4U3JB 2R6R1 1W40A 3PLAC 5IJ0B 1Z5VA 1TVKB 1GZ0A 4ZHWA 5CB4B 1ZWZA 3RA5A 4U39A 3HKDB 3S02A 3RA6A 1QAHA 3CYQA 3HWUA 4IHJB 5GANK 4BT5A 4KWEA 2CSLA 3FD5A 1SA0B 3K0TA 3VOAA 3LWQC 2OTJF 5KMGB 2CHSA 3HKBB 1VQPF 5CB4A 3WJPA 2CHTA 3VYUC 1IV2A 3RYIB 3C9SA 1Z5WA 4BT6A 4BVQA 3CCEF 5KX5B 1GX1A 3FBAA 2IG8A 1XRGA 4ZHVA 1VQ7F 4EI7A 4BT7A 2VGNA 2BO1A 3HKBA 3NK6A 1W581 2LBTA 3CG6A 2RHOA 3NK7A 3RYFB 2QA4F 1W59A 1H47A 3JATA 3V7EA 3HAXD 5HY1A 4BT3A 5J2UB 1IV4A 1JN1A 1U43A 2I6DA 2NMUA 3IEQA 4FFBB 1KNJA 5EYPB 1GO0A 5EIBD 3F6MA 1DT9A 3CB2A 1VQ6F 1COMA 4O2AB 4O4JA 3CCSF 5JH7B 5B8FA 2AMTA 3UT5B 5J2UA 2UYNB 3F0GA 3OONA 1TUBA 4ZI7A 2UYPA 3JARB 4X1IB 3S03A 3CC4F 2VGMA 3JASA 3JAMM 3HKCB 4EB6B 2EWCA 1VQ4F 4B5CA 1VK3A 3P4EA 1FFXB 3IMPA 3VCZA 4DRXA 5GINC 3UT5A 1RA4A 3EORA 1QU9A 2KTVA 1FNJA 2DYYA 2PMPA 3JAKB 2MQEA 3FPIA 5G4UC 1M90H 3JALB 4EB6A 4C8IA 3WJRA 4RQOA 2VAPA 3K12A 1YJNF 1Q86H 3P0ZA 3TD4A 5GIPC 5GAPK 4I4TB 5FNVA 1W57A 1K9MH 3CD6F 3ERNA 3FFMA 4LNUB 2UZHA 5LA6B 5ITZB 1U3LA 3CC7F 5DCVA 3MBMA 5LYJB 3VOBA 3JALA 3QTYA 5IJ9A 5BMVB 5HXZA 4IIJA 3N4YA 1CLIA 1DBFA 4O4IA 3FD6A 5J2TA 1JFFB 5JCOA 2V9YA 5LP6A 1NMUB 4E6EA 2PHNA 3ZOPA 5GIOC 4X1YB 2KGWA 3J80M 5JQGA 2FC3A 2QI2A 2ZODA 3N2GB 3QUWA 3NVKE 2Q1XA 3S0YA 3QHDA 4G4ZA 1VQ8F 4BY9D 2RB9A 1VQVA 3MCAB 3CMEF 1QVFF 1JFFA 2AIZP 3LWPC 2G9IA 3B6NA 4X1YA 3RYHA 2ZVZA
chains in the Genus database with same CATH topology
2CW4A 2CSLA 2CWJA 3K0TA 2UYNB 3LMEA 2CHSA 2OTMA 3ZOPA 2UYPA 4ZK7A 1NQ3A 3I7TA 2CVLA 3D01A 3GTZA 2UYKA 1J7HA 3K12A 5HP7A 3QUWA 3LYBA 1XHOA 3ZP7A 2CHTA 3KJKA 3MQWA 3L7QA 2EWCA 1PF5A 2B33A 3I3FA 1JD1A 3R0PA 1QD9A 3M1XA 1UI9A 2UYJA 2UYNA 3VCZA 2IG8A 1XRGA 1ONIA 3ZO8A 5HP8A 1FNKA 1COMA 1QAHA 1QU9A 1UFYA 1ODEA 1X25A 3M4SA 1FNJA 2DYYA 3V4DA 1DBFA 3KJJA 4NWOB 3ZP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW4 A;  2CSL A;  2CWJ A;  3K0T A;  2UYN B;  3LME A;  2CHS A;  2OTM A;  3ZOP A;  2UYP A;  4ZK7 A;  1NQ3 A;  3I7T A;  2CVL A;  3D01 A;  3GTZ A;  2UYK A;  1J7H A;  3K12 A;  5HP7 A;  3QUW A;  3LYB A;  1XHO A;  3ZP7 A;  2CHT A;  3KJK A;  3MQW A;  3L7Q A;  2EWC A;  1PF5 A;  2B33 A;  3I3F A;  1JD1 A;  3R0P A;  1QD9 A;  3M1X A;  1UI9 A;  2UYJ A;  2UYN A;  3VCZ A;  2IG8 A;  1XRG A;  1ONI A;  3ZO8 A;  5HP8 A;  1FNK A;  1COM A;  1QAH A;  1QU9 A;  1UFY A;  1ODE A;  1X25 A;  3M4S A;  1FNJ A;  2DYY A;  3V4D A;  1DBF A;  3KJJ A;  4NWO B;  3ZP4 A; 
#chains in the Genus database with same CATH topology
 2CWJ A;  3N2G A;  4YJ2 A;  5EIB C;  1IPA A;  3O85 A;  4NUT A;  3VO8 A;  2CVL A;  2UYK A;  2OTL F;  2HRY A;  1U3P A;  5GON A;  2ALE A;  3VYT C;  2YYE A;  2H6L A;  4PWT A;  3LFO A;  1U40 A;  4TV8 A;  3JAT B;  2B33 A;  3Q8H A;  1VH8 A;  3D54 A;  2L26 A;  4HNA A;  5EB1 B;  1UI9 A;  5LXT A;  4O4H A;  3WJQ A;  3NMU C;  2KTU A;  5CA1 A;  2N48 A;  1FNK A;  5IT9 M;  5C8Y A;  1W42 A;  1X25 A;  5FJ4 C;  4NWO B;  2QTP A;  3F0F A;  3OW2 F;  3IKF A;  5HWE A;  1J7H A;  3S06 A;  4O4J B;  4O2B A;  1YHQ F;  2AIF A;  3KIZ A;  3CCL F;  1W3E X;  1W2B F;  1T0K B;  1YJW F;  1X7P A;  1TUB B;  5FLX M;  4ZI7 B;  2ZF8 A;  3AGK A;  5IYZ A;  3LWV C;  1KC8 H;  3JAS B;  5AVM A;  2K1S A;  2I6R A;  3IKE A;  4EI8 A;  3S0W A;  2Z1F A;  3LME A;  4DRX B;  1VQN F;  3CYP B;  3KHN A;  3V7Q A;  2HP0 B;  3VIU A;  3RYC A;  5HP7 A;  1NJI H;  4G4Y A;  2QEX F;  5LOV A;  5EZY A;  4X20 A;  4ZHQ B;  3IEW A;  3PAF A;  3WGK A;  3S0H A;  3HJW C;  3GHZ A;  2GLZ A;  2UYJ A;  5MN5 A;  2W8B C;  4BT4 A;  3ZO8 A;  3CMA F;  5FNV B;  1RQ2 A;  3D00 A;  3G6E F;  3GYQ A;  5HY4 A;  2HP0 A;  3NVI B;  2LCA A;  3TD3 A;  4G4W A;  5IJ9 B;  4YJ3 A;  2OTM A;  3F0D A;  4ZHQ A;  1QVG F;  3ESJ A;  4TUY A;  1OFU A;  4IIJ B;  4WBN B;  4XCQ A;  2Q1Y A;  2HRU A;  4O4I B;  5J2T B;  4ZHY B;  4BT2 A;  5LP6 B;  1VQM F;  5JVD A;  3CXC F;  3LDT A;  3VMF B;  1W5F A;  3IR9 A;  3M1X A;  3VTI C;  4I55 A;  4BVT A;  2IQQ A;  5JQG B;  3CCJ F;  1YIT F;  4TV9 B;  3ELC A;  5HP8 A;  4TZZ A;  2GVI A;  2H8C A;  3C9R A;  4WBN A;  4ZOL B;  4F6R A;  3K2X A;  2CW4 A;  1VQL F;  2ZVY A;  4BW0 B;  4LCK A;  4ZK7 A;  1RQ7 A;  3RYH B;  4C4W C;  2FGY A;  5CA0 A;  3M84 A;  3G4S F;  1YIJ F;  2Z1T A;  3SIV A;  1Q8R A;  4YJ2 B;  3L7Q A;  4TV9 A;  3DDN A;  1JD1 A;  4C8E A;  3R0P A;  1YJ9 F;  3CCM F;  1PXW A;  1VHA A;  5GON B;  2P6Y A;  4ZOL A;  1ONI A;  5HXU A;  4TV8 B;  2OHW A;  4G4V A;  3JAW A;  1T0A A;  4X1K A;  5HY0 A;  3K14 A;  4HNA B;  3KJJ A;  5LXT B;  4O4H B;  3VYS C;  3ON1 A;  2Z1E A;  4O4L A;  2HS4 A;  2BTU A;  2HP3 A;  5CA1 B;  3CPQ A;  4C81 A;  2ZAU A;  4B45 A;  3GTZ A;  5C8Y B;  2GZL A;  3P10 A;  3C9U A;  2VAW A;  1M1K H;  5JCO C;  5LP6 C;  2RHH A;  3I56 F;  1CK2 A;  2Z01 A;  1RLG A;  2H8E A;  2RHJ A;  2HQS C;  4DXD A;  2HS3 A;  3CCQ F;  4O2B B;  1N8R H;  3N2K A;  3HKE A;  2RHL A;  3WGJ A;  3OBY A;  1YGY A;  1S72 F;  5IYZ B;  1K8A H;  4X3M A;  3CCR F;  3BYQ A;  1E7K A;  2HVY D;  1H7M A;  4U3J A;  3WXM B;  5IJ0 A;  1TVK A;  2BTO A;  3I7T A;  1W5E A;  3I55 F;  1VQ5 F;  4X3L A;  4G88 A;  4I50 B;  1OAP A;  3WGM A;  3HKD A;  1KQS F;  3C9T A;  1X7O A;  4IHJ A;  2HX0 A;  5A2Q M;  3RYC B;  2IAF A;  1SA0 A;  1RLU A;  5KMG A;  3WGN A;  5LOV B;  3G71 F;  5EZY B;  4X20 B;  3E1Y A;  2LBX A;  3N4Z A;  3J7A R;  5EAZ A;  3V4D A;  3WGL A;  3MQW A;  3MCQ A;  4BVR A;  3ZP4 A;  3LWO C;  1SDS A;  1X52 A;  4I50 A;  3RYI A;  1IV3 A;  4ERH A;  5KX5 A;  3CCU F;  3E20 B;  5G4V C;  3LYB A;  3I3F A;  4YJ3 B;  2YXZ A;  4TUY B;  3OBW A;  2F9Z C;  3RYF A;  4B62 A;  4EI9 A;  3V3T A;  5JVD B;  3CC2 F;  1JJ2 F;  2DT4 A;  4I55 B;  3LWR C;  1KNK A;  1VQK F;  1GO1 A;  4FFB A;  5EYP A;  5HY2 A;  3WPX A;  3D01 A;  3T80 A;  2LBW A;  2CZW A;  1K73 H;  1Q7Y H;  3JCM M;  4RHA A;  1JY8 A;  2ZOV A;  1XHO A;  3DC2 A;  4F6R B;  1VQ9 F;  1XBI A;  2JNB A;  4R40 B;  1Q81 H;  4O2A A;  5EB0 A;  4BVS A;  3J81 M;  1QD9 A;  4C8G A;  2HS0 A;  5JH7 A;  4NQ3 A;  5CA0 B;  2UYN A;  5MN6 A;  2KG4 A;  1YI2 F;  3MDO A;  3JAR A;  4X1I A;  3VI6 A;  1CN7 A;  1UFY A;  2WAL A;  3M4S A;  3HTN A;  5EO3 A;  2VAM A;  3HKC A;  1Q82 H;  3TD5 A;  1FSZ A;  1W5A A;  3E22 B;  2OZB A;  3CPW F;  4B46 A;  1FFX A;  1H48 A;  1NQ3 A;  5MN4 A;  3JAW B;  3F0E A;  3KE1 A;  4M8I A;  4X1K B;  1W5B A;  4C82 A;  3KJK A;  4O4L B;  1PF5 A;  3JVH A;  3CCV F;  1IV1 A;  3JAK A;  4G4X A;  1W41 A;  1YQN A;  1XV2 A;  3E22 A;  3WPW A;  2BTQ B;  2R75 1;  1ODE A;  2VXY A;  1VQO F;  4I4T A;  3N2K B;  3U0O A;  1KD1 H;  3HKE B;  3C8L A;  5EWR A;  4LNU A;  5ITZ A;  5LA6 A;  3SIU A;  1SZQ A;  3ZP7 A;  2Z1U A;  5LYJ A;  1W55 A;  1R1M A;  5BMV A;  3RE3 A;  4U3J B;  2R6R 1;  1W40 A;  3PLA C;  5IJ0 B;  1Z5V A;  1TVK B;  1GZ0 A;  4ZHW A;  5CB4 B;  1ZWZ A;  3RA5 A;  4U39 A;  3HKD B;  3S02 A;  3RA6 A;  1QAH A;  3CYQ A;  3HWU A;  4IHJ B;  5GAN K;  4BT5 A;  4KWE A;  2CSL A;  3FD5 A;  1SA0 B;  3K0T A;  3VOA A;  3LWQ C;  2OTJ F;  5KMG B;  2CHS A;  3HKB B;  1VQP F;  5CB4 A;  3WJP A;  2CHT A;  3VYU C;  1IV2 A;  3RYI B;  3C9S A;  1Z5W A;  4BT6 A;  4BVQ A;  3CCE F;  5KX5 B;  1GX1 A;  3FBA A;  2IG8 A;  1XRG A;  4ZHV A;  1VQ7 F;  4EI7 A;  4BT7 A;  2VGN A;  2BO1 A;  3HKB A;  3NK6 A;  1W58 1;  2LBT A;  3CG6 A;  2RHO A;  3NK7 A;  3RYF B;  2QA4 F;  1W59 A;  1H47 A;  3JAT A;  3V7E A;  3HAX D;  5HY1 A;  4BT3 A;  5J2U B;  1IV4 A;  1JN1 A;  1U43 A;  2I6D A;  2NMU A;  3IEQ A;  4FFB B;  1KNJ A;  5EYP B;  1GO0 A;  5EIB D;  3F6M A;  1DT9 A;  3CB2 A;  1VQ6 F;  1COM A;  4O2A B;  4O4J A;  3CCS F;  5JH7 B;  5B8F A;  2AMT A;  3UT5 B;  5J2U A;  2UYN B;  3F0G A;  3OON A;  1TUB A;  4ZI7 A;  2UYP A;  3JAR B;  4X1I B;  3S03 A;  3CC4 F;  2VGM A;  3JAS A;  3JAM M;  3HKC B;  4EB6 B;  2EWC A;  1VQ4 F;  4B5C A;  1VK3 A;  3P4E A;  1FFX B;  3IMP A;  3VCZ A;  4DRX A;  5GIN C;  3UT5 A;  1RA4 A;  3EOR A;  1QU9 A;  2KTV A;  1FNJ A;  2DYY A;  2PMP A;  3JAK B;  2MQE A;  3FPI A;  5G4U C;  1M90 H;  3JAL B;  4EB6 A;  4C8I A;  3WJR A;  4RQO A;  2VAP A;  3K12 A;  1YJN F;  1Q86 H;  3P0Z A;  3TD4 A;  5GIP C;  5GAP K;  4I4T B;  5FNV A;  1W57 A;  1K9M H;  3CD6 F;  3ERN A;  3FFM A;  4LNU B;  2UZH A;  5LA6 B;  5ITZ B;  1U3L A;  3CC7 F;  5DCV A;  3MBM A;  5LYJ B;  3VOB A;  3JAL A;  3QTY A;  5IJ9 A;  5BMV B;  5HXZ A;  4IIJ A;  3N4Y A;  1CLI A;  1DBF A;  4O4I A;  3FD6 A;  5J2T A;  1JFF B;  5JCO A;  2V9Y A;  5LP6 A;  1NMU B;  4E6E A;  2PHN A;  3ZOP A;  5GIO C;  4X1Y B;  2KGW A;  3J80 M;  5JQG A;  2FC3 A;  2QI2 A;  2ZOD A;  3N2G B;  3QUW A;  3NVK E;  2Q1X A;  3S0Y A;  3QHD A;  4G4Z A;  1VQ8 F;  4BY9 D;  2RB9 A;  1VQV A;  3MCA B;  3CME F;  1QVF F;  1JFF A;  2AIZ P;  3LWP C;  2G9I A;  3B6N A;  4X1Y A;  3RYH A;  2ZVZ A; 
#chains in the Genus database with same CATH homology
 2CW4 A;  2CSL A;  2CWJ A;  3K0T A;  2UYN B;  3LME A;  2CHS A;  2OTM A;  3ZOP A;  2UYP A;  4ZK7 A;  1NQ3 A;  3I7T A;  2CVL A;  3D01 A;  3GTZ A;  2UYK A;  1J7H A;  3K12 A;  5HP7 A;  3QUW A;  3LYB A;  1XHO A;  3ZP7 A;  2CHT A;  3KJK A;  3MQW A;  3L7Q A;  2EWC A;  1PF5 A;  2B33 A;  3I3F A;  1JD1 A;  3R0P A;  1QD9 A;  3M1X A;  1UI9 A;  2UYJ A;  2UYN A;  3VCZ A;  2IG8 A;  1XRG A;  1ONI A;  3ZO8 A;  5HP8 A;  1FNK A;  1COM A;  1QAH A;  1QU9 A;  1UFY A;  1ODE A;  1X25 A;  3M4S A;  1FNJ A;  2DYY A;  3V4D A;  1DBF A;  3KJJ A;  4NWO B;  3ZP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...