5IJ9B

Cryo em density of microtubule assembled from human tubb3-d417h mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNHLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
total genus 140
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij9B01
4TUYA 4X1YB 1TUBB 4FFBA 3JALB 1W59A 3E22B 5FNVA 5CA0A 3HKBA 4O4LA 4TUYB 3RB8A 4FFBB 4X1IA 1W5EA 5CA0B 3HKBB 2RHLA 3VOBA 4O4LB 3M89A 2XKBA 3JARA 5JQGB 4HNAB 4X1IB 2GVIA 4I50A 4YJ2A 5JVDA 3N2KA 3VO9A 4EB6A 5EIBC 5BMVA 3WGMA 4LNUA 5EZYA 4U39A 3JARB 4F6RA 3ZBPA 4I50B 4IIJA 3N2KB 5JVDB 4EB6B 1W581 3JAWA 5CA1A 5EZYB 4I4TB 4ZOLA 1W5FA 2BTOA 4X20A 3JAWB 5CA1B 5LP6A 5IJ9A 4O4HA 5CB4A 3WGNA 2RHOA 2Q1YA 4X20B 5LP6B 5IJ9B 4O4HB 2R751 2VXYA 4WBNA 5CB4B 5ITZA 2R6R1 4DXDA 5C8YA 4WBNB 5FNVB 5ITZB 3UT5A 1TVKA 5C8YB 2XKAA 3VOAA 4TV8A 5MN6A 4EI8A 4I55A 1FSZA 3UT5B 1RQ7A 2RHHA 2VAPA 3N2GA 5LOVA 1TVKB 3JAKA 3R4VA 4TV8B 4ZI7A 4YJ2B 4I55B 1W5AA 2RHJA 1SA0A 5BMVB 1W5BA 3N2GB 4LNUB 1Z5WA 5LOVB 1OFUA 5MN5A 4F6RB 3WGLA 3JAKB 2BTQA 2VAWA 4EI7A 4ZI7B 3V3TA 4IIJB 4YJ3A 5LA6A 5KMGA 1SA0B 3HKCA 4E6EA 4M8IA 4O4JA 2BTQB 4ZOLB 3ZBQA 5LYJA 2VAMA 4YJ3B 5J2UA 5KMGB 4O4JB 4ZHQA 4IHJA 5LYJB 5J2UB 1FFXA 4B46A 5MN4A 4O2AA 5JCOC 3RYFA 4ZHQB 5JH7A 4O2BA 4IHJB 3JASA 2Q1XA 4KWEA 1FFXB 5EIBD 5KX5A 4O2AB 3RYFB 5JH7B 4O2BB 4TV9A 5M7EA 5KX5B 3HKDA 4O4IA 5IYZA 4TV9B 4XCQA 4X1YA 4DRXA 5LXTA 3HKDB 4O4IB 5IJ0A 5IYZB 3M8KA 1JFFA 4DRXB 5LXTB 5IJ0B 3C8LA 1JFFB 3HKEA 5LA6B 3WGKA 3HKCB 3JATA 5JQGA 4HNAA 4B45A 1Z5VA 5GONB 3HKEB 3VPAA 3JATB 5J2TA 5LP6C 3RYHA 4X1KA 4U3JA 4I4TA 5J2TB 3VO8A 4EI9A 3WGJA 3JASB 3RYHB 3RYIA 4X1KB 4U3JB 3CB2A 3RYCA 5EYPA 5GONA 3ZIDA 1RQ2A 1RLUA 3RYIB 5JCOA 1TUBA 3RYCB 5EYPB 3JALA 3E22A
chains in the Genus database with same CATH superfamily
1SH7A 5KNDH 2Y9PB 4A82A 4COKA 4DV1B 1WMAA 1SOMA 3A70A 3DBVO 3SJ7A 5FBKA 1XAHA 1WD5A 2D7CA 9ABPA 2AOVA 1I7FA 3RS4A 3CP1A 2NP6A 4ZZ2A 2Q4PA 1TO2E 1UBSB 2CLFB 4G23A 1YJAA 4YMTA 1CERA 1C0PA 3K8YA 3OJFA 5BWOA 3AETB 4FIZA 2XD4A 3QZUA 4C14A 1XDUA 1ABBA 4QDJA 2CTQA 2BM8A 3FWNA 4B3RB 2TMKA 1PJTA 3HJBA 1YK1A 5F7JA 1K4YA 4ILKA 2R60A 3IVRA 6REQB 5BSTA 2ZYAA 3P2MA 1M6VB 1T2DA 3NFRA 2IHUA 5HIAA 3BT7A 3BMOB 5FHQA 5KTOA 3T3GA 4QOJA 1YE8A 4Z1MA 5LA6B 3ZDYB 5A05A 1TYDE 5LJIA 3C9UA 3UO2A 4J0JA 4CFYA 4MGEA 5E7QA 3MQ4A 5TLSA 3QKWA 4B6JA 1ZTEA 4UHFA 2G67A 3RYIB 5IKMA 2W6QA 3ZE6A 3NEJA 2BOCC 4HRXA 5DEDA 3PD0A 4PBSA 3P0EA 2I62A 3GMTA 5CW2A 2I5PO 1OU0A 4CU5A 3SF0A 2X8BA 4CMHA 5T4HA 2R11A 3F49S 1LLDA 2X4GA 1U1DA 5CR9A 3SAJA 4EYKA 3H6KA 1KBZA 3FF1A 1QR9A 1EFPA 3KEFA 2GAJA 4AJKA 2ZQMA 1VG9B 3VR0A 2OUKA 3IBTA 1I1OA 5SY4A 1M8GA 1JLRA 3LWPC 2CLSA 2G36A 1ZSVA 4EFEA 1LRJA 4Z54A 1I2ZA 4EMBA 3AB7A 4U63A 3DFIA 4JHLA 4MHTA 3EXHA 2WSSA 1XI2A 2VRZA 3C5HA 1M72A 3RUIA 3KZKA 3SIPA 5FWDA 4P83A 2F3QA 3AH8A 2ZRAA 1LEHA 1DKLA 2AFHB 3EH1A 4PI0A 1OYOA 4FUTA 2XQFA 2OL4A 4GL4A 4KVAA 2GM4A 4R9NA 3F73A 3LGAA 3RYHB 3O8OA 1E2GA 5ALRA 2NX2A 2H00A 3ZC3A 2D8MA 3P3NA 1VIBA 2DCMA 4WLOA 4DAEA 5A2QN 3KK0A 1IV4A 2O2IA 1U28C 3DFZA 4LF4O 3KOYA 3CZ5A 4C7XA 1FUYB 2YJ3A 4FZJA 4BB0A 3WBKA 1E77A 3ZYZA 3PSHA 4G8BA 3V7FA 4MLCA 3GELA 2PS9A 4FUQA 3L72H 1U2QA 4D82A 1OXKB 2PM8A 5JHHB 2E5WA 2OWEA 4WACA 1VIDA 3ZE8A 1YCFA 3IURA 4EMTA 1HKUA 1L8AA 1AI7A 4KYTA 5HP7A 4L6AA 3O4HA 2CF6A 4JQCA 1QK4A 4WVFA 3NVKI 1TUGA 4JI1B 5AH0A 4EJSB 3I9JA 5DBGA 2WHPB 3UM9A 3ZP4A 3C8MA 4CHGA 3IOEA 3MS2A 4N4AA 2CJWA 1PR9A 3TGUH 3LKBA 3WYGA 2TMGA 3KE8A 3V8VA 1LKZA 1UF9A 2IHTA 4P3OA 1DXQA 4V2UA 4OLJA 4IVQA 5EGSA 2DN9A 1IB6A 2QG6A 1AKYA 3V2UA 3T1HO 1JWBB 4ZHWA 4J03A 4YRDA 3I3OA 4DV7O 3D54A 1O96A 1D2DA 2GHTA 4IOLA 1TVEA 1NVGA 1LQTA 2NM0A 1DGQA 4J43A 5K0LA 3QEKA 1VQOV 3ITEA 2E1PA 4TLBA 2CMDA 4F04A 1BSVA 1QK3A 2I2AA 4IIXA 4Q1VA 1J8FA 1FVXA 2A5GA 4CG1A 1IN4A 4IHJF 3OMAB 3DWFA 1FNKA 1KDTA 3R5JA 4RTNA 5GAJA 4QGPA 1U11A 2Z30A 4NK4A 3VQVA 3DD5A 1QF7A 4P3KA 4G97A 2ZT7A 2I7XA 3KPJA 3SKVA 1QC5B 2J0VA 3DO8A 3PUVA 1XXLA 3E05A 2HX1A 4F46A 5E2BA 1BHJA 1AP5A 1TUBA 1NDHA 1H2EA 5LQUA 3LXUX 1SBNE 2CLLB 3TGPA 3W7AA 1GNQA 1QR2A 1AK2A 4OHWA 2XB2A 5CPFA 1OLSA 5PGMA 4BMCA 2IE8A 1V8DA 2WU0A 3KPWA 2ZK7A 3ZJZA 3S55A 2CXSA 1T34A 4MS4A 2R751 2V7QG 2R62A 3BERA 4TZZA 1E1QG 1YB5A 1AXRA 2KBFA 4EOGA 1W5BA 1LBHA 4D9NA 2HZBA 1KJYA 4PYIA 3IP9A 3UXYA 3OKCA 4JBXA 5LYJA 3C8ZA 5EUMA 3V1UA 1N1EA 1IN1A 3BA9A 1KDOA 1CIPA 2O3SA 4DXWA 4TWAA 2EIMB 2PGIA 4C4WC 1CF2O 4MVQA 5FLKA 4NSNA 2Q5CA 1QAOA 5HSGA 1GFZA 1HFWA 2IY9A 2GNOA 3SC6A 2A9FA 2ODWA 4LGMA 5E7IA 4B45A 4AG3A 2OY0A 4MVJA 3QLUC 3QJGA 2DT4A 1DQNA 2HPAA 2NO0A 3BXEA 3RSGA 3SJBA 3UATA 4B83A 2XB9A 1E8DA 2R44A 3HA2A 4LWSB 2Z8YM 3VSAA 3OKFA 5M3BA 1BS9A 2V7PA 3E0XA 5F21A 2V74B 2JANA 4AN0A 2IY8A 3UMJA 1RI3A 2HCRA 3SYAA 5K2MA 1NMQA 3TVDA 4W82A 3VC1A 5E6RA 4FK8A 4U6QA 4I55A 1Z22A 4C6TA 4HWPA 4EO9A 1E20A 1UJWB 1WNTA 3LS2A 1IHDA 3RKSA 1I4LD 1JPXA 2I6FA 4FHDA 3EH2A 3M4YA 4QE7A 3GXBA 2QL7A 2GCGA 4UFNA 2O8EB 1TQ8A 4R7TA 1XCGB 5C8DA 3IHKA 4MTLA 1EWRA 2VJBA 2JFPA 1QHHA 3OBYA 2KQXA 3H9BA 2Q29A 3EWSA 4AB1A 2W0XA 1XEQA 2OZPA 1NOIA 5REQA 1ULUA 3F9RA 2V6GA 3LYBA 3OC0A 1GCOA 4QOSA 2AS0A 2FKNA 2WSMA 3N75A 7REQA 1WXXA 3CUSA 3T3NA 1GA1A 1RJ9A 2TRSB 1OC2A 2VUTA 4JUAA 1ZEMA 4Q9HA 1RYBA 1W0KD 1LBQA 1TU0A 2WD9A 2WM8A 1F7YA 1KYWA 2FMHA 4MVJE 5A3SA 2HS3A 1GNTA 2Q3LA 1CR0A 1U4SA 4DK1A 1GADO 5TQ0A 2X4IA 3UJ7A 1S2LA 1LJ8A 2XOKG 1V5GA 3HM2A 4ZOBA 5G41A 1VQLV 1UMKA 4E2FA 4RZXA 4DIMA 1VCNA 3TO5A 3L40A 5DCUA 1GGVA 1ADBA 4JD5A 4ZVSA 4IDBA 2GN9A 3TYXA 2EZTA 3PPIA 5BW5A 3EZYA 1XQ6A 5JMOA 2IUFA 2IEGA 3LUFA 3ZOPA 3OICA 3EEIA 1XNGA 2RIPA 1WKVA 1DRVA 2LFSA 1QNLA 2UYQA 3E2EA 1ISPA 4WNIA 1XZ8A 4CKCB 2PL3A 4HDKB 3STVA 3PXBA 1C0IA 4LGCA 4RMNA 1MVLA 1T9CA 1WDTA 4MRNA 4OJQA 3CCVV 5CH5A 1TC2A 3JPYA 4K5QA 1RLTA 3C6MA 3ZX6A 4HZIA 1L7EA 4F86A 3CCBA 2CUNA 3ASZA 2YJZA 2I6TA 4H15A 1K63A 5GJCA 4PY2A 1RHKA 4DR4B 3AEQB 3DXXA 4AI8A 1U3TA 2C3MA 3I6ZA 4MULA 5JO0A 3OFND 4IX9A 1RU3A 4GOJA 1NJIW 1Q83A 2XTAA 2Q4RA 4N9WA 5L3FA 5BQOA 2HQSC 2P62A 4IDQA 4MYRA 1X7OA 3K16A 4IV0A 4BE9A 4OP1A 2PJRA 1QP4A 1N33O 3CLKA 2HS0A 4B7EA 4F3CA 1QYWA 4X6UA 3QKIA 1HFJA 1MW9X 1G3RA 4F5WA 3H4IA 2Y0PA 2YVKA 3CPWF 1M67A 2X40A 3WLLA 1V47A 4C21A 3IFSA 2DHQA 4DNQA 5BZBA 4ZEOA 4C0AC 2BLNA 5EKUA 4MICA 3VBBA 4MUAA 4UULA 4YB8A 1AO0A 3HPLC 2OV8A 2OUIA 4TRJA 1RXIA 4J76A 7ADHA 5BYAA 2QPOA 3PQ8A 3RI3A 3A58B 1ZBDA 5J4LA 2OTLF 1N2BA 3KV1A 1LJLA 1ISHA 3MQ2A 1THZA 3JAKA 2W6JD 3KYIB 1KEEA 2ZBGA 4H0NA 5BWLA 1RXUA 4NKGB 2P9HA 4ZBMA 1JFVA 5K3EA 1E0SA 3KKNA 1W7AA 1ZH8A 4MW7A 4YT8A 2P6NA 3ESXA 3LO5A 3CEJA 1NXOA 1KQGA 3OTQA 1D0SA 2ZP1A 3NEYA 2DQ4A 2X0LA 4DR5O 2IOYA 1MDBA 4Z7QB 2YI9A 1J00A 3ABLB 5H2FZ 3FD6A 2BFPA 1ZH0A 3PRJA 3KYDA 1W2WB 1AIPA 1SEPA 3MERA 5BV1A 3UENA 1N7JA 4P98A 4URVR 4BW5A 2OSVA 3E4DA 1TQDA 1XQVA 5AKJA 4EBFA 2WJPA 4RZ3A 2CD7A 1A9SA 3X43A 4BQSA 2IHNA 1TKCA 3WLJA 3P97A 2WOJA 4Q9LA 3QLEA 3JRNA 5C5DA 3JWEA 4G81A 3VDRA 1S7GA 2IHBA 2Y6UA 1E3SA 4B6FA 4BY9E 1HE8B 2IXGA 4RKYA 2WHQA 3W5CA 4CM3A 5IT0A 1PQWA 1K9MW 4MUKA 4IUCS 3O65A 2XWJI 3ZOKA 4C7UA 2IYNA 2BSAA 4TL6A 1XD8A 4JCOA 5ALZA 2HI0A 3DMPA 4FGUA 2WR8A 3KHKA 1E4OA 1X1CA 2XYVA 3WNDA 4FOOA 2XWQA 3ANYB 2C9OA 4EABA 3GJ8A 2ATCA 2A33A 1GA4A 1T5LA 1SO8A 3GN1A 3WLIA 1SQQH 1ZCBA 3I4FA 2GYYA 1OFHA 1WF3A 3FLBA 4UEQA 3RVPA 2IC5A 1AI5A 1XHZA 3L4SO 4PANA 4ISBA 1E79A 4AAYA 5I7AA 4HY3A 5FPQA 3OTOB 1LCIA 4O5OA 1G291 4AMUA 4S1VA 4IINA 4JI5O 1KFKB 5ISMA 3X3HA 4AECA 1NJ1A 4Z0PA 3VH1A 3N6VA 3Q7RA 4KACA 4IJUA 3MGAA 4FWBA 4GKBA 1N0IA 3K70B 4AG6A 3OUFA 3BJIC 1KARA 4UNQA 3NTVA 5HM6A 3HAXD 4OLBA 4IJKA 2H7CA 2HEPA 1JJFA 1HEYA 2NACA 4M0LA 4H60A 4V0SA 1EEXB 4UBOA 3AI3A 5JMTA 3MGGA 1Z15A 1JXMA 4CIDA 2BI8A 4IVRA 3NDBB 5IT9A 3LPMA 1CE8B 3O38A 5AI5A 4ZYLA 1C30B 3VXKA 3PT5A 5E4YA 5IJXA 1IV2A 3L9WA 3OE7D 1W59A 2N1BA 3HS3A 2GN8A 3KD3A 2B4KA 3AGKA 1FMLA 1Q1ZA 4PAQA 2HLPA 3L8MA 5HFLA 3V8PA 1H38A 2PY6A 1R0WA 4C3UA 4YASA 1XPOA 3RJTA 5CB4B 3ZCSA 3VHQA 4C4SA 4YBRA 4K9QA 2GNPA 3R7AA 1K08A 1Y8ZA 3BIJA 1FX0B 4AS2A 4AYWA 1KXZA 3V8MA 1WOMA 3GUHA 4YJ3F 4DY4A 3UJ6A 3A6EA 1WEKA 1L3BA 4ZQBA 3LUAA 1AGPA 4NAHA 2PPLA 1S01A 5EXTA 2P30A 1BDIA 3V2IA 2ATKC 5GADl 4MYHA 4LSMA 3CLHA 1V55C 4IGIA 5AKZA 1YVEI 5LNK6 1VKNA 2VTBA 4QJBA 2WJ4A 2BELA 4XWYA 5HKAA 4KXWA 1XNHA 2BP7A 3HNRA 1DQRA 1H6AA 5C8XA 3GWOA 2O6HA 5DGHA 4PFSA 4F6RA 2AE2A 4EHKA 1X7YA 3ELDA 2IU3A 2WUGA 1NLUA 4E13A 3CGGA 2AEJA 4EI2A 1N8RW 4WBNA 5K6AA 1NVVQ 2O07A 3D8BA 4KU4A 3UWSA 5AW9A 2QE7A 3E48A 1KU6A 5CVUA 5ECGC 1P4HA 1WXGA 2Z09A 1BS2A 3U3MA 2VAMA 2CBZA 1J0EA 3EW7A 1A4UA 1VHTA 3BRCA 3SLKA 4U2BA 3DBRB 4KLAA 4YP5A 4D0RA 3C8HA 4XIFA 1PJAA 3MUOA 2OZVA 5IEJA 2PUBA 1F0NA 1T1RA 3MCQA 2X9NA 1Z75A 2TMYA 2XZOA 2Q7DA 4BFVA 1YZUA 2C7VA 4B3IA 1K4KA 2QDOA 2OXFA 3PNSA 1S7CA 4DREA 4AT1A 4M6WA 4W4KA 3OUSA 5ALUA 1FRZA 3OMIB 1N34B 4MO9A 3GFRA 5CT9A 3NS7A 2ZYRA 2ZRCA 3H7AA 2QLBA 1EH5A 2WJWA 1N57A 1QB7A 3ZLJA 2K2QB 2J7PD 4ZA2A 1COWG 1QTIA 2YVQA 5ITZA 3CIOA 1QYVA 1MR3F 2QRJA 1MT0A 4Q1FA 5FL7A 3CYPB 3K4PA 4F3TA 5HS6A 4A8JB 4M1MA 2A88A 3QF4A 4US2R 4C81A 3K09A 1BQEA 3IKEA 4C20A 3VU8A 4FD2A 4PLWA 4NNOA 5CMUA 4GVLA 2H57A 3R3JA 4Q18A 4MYTA 5JZOA 4N5LA 2Q3BA 2AK2A 4XGRA 4ZIRB 5LZ2A 3TLGA 2Z8XA 4EM6A 1O5TA 1E69A 1BE6A 3IBFA 3L18A 3ZUPA 4P93A 1V8PA 5IAAA 4ZGBA 1LR1A 1WCWA 5LMUO 4G8DA 2AEFA 1W9MA 2NUBA 3J80N 1BRTA 4XVQA 1W30A 4MQEB 1NHWA 2L19A 3OD5A 3ZE7A 1FFSA 3KKQA 3M89A 1KE2A 4LTNA 3FE2A 3U0BA 4NLLA 1P7VA 2QWNB 4IJMA 4JXJA 4GICA 2YZNA 3DUFB 3KXKA 5I3ZA 3LFHA 3FDZB 3IDOA 2J87A 3Q3CA 5JCPA 1CUYA 1ZA1A 1EFAA 3QPAA 1Q0LA 4K6HA 3R8FA 2CUTA 3UHJA 3NVDA 1ZFNA 1IBMB 1TA0A 1W36D 3NV7A 4FE4A 4C82A 4QBTA 1Q7RA 5GONF 2ADPA 4RHFA 3ZWWA 3QQ5A 1R12A 1ZK4A 1GTJ1 1NOKA 3B12A 5BY2A 3NPMA 4EYEA 4BMVA 4I46A 2C96A 3PLAE 3Q5GA 3ICCA 3LP6A 4J1TA 4Z3DA 4UHJA 1G8YA 3KR1A 4ARIA 5EN4A 4BNTA 4Y2QA 3OEWA 5B3AA 3TR6A 5FBWB 1FLNA 2EIJB 4IXNA 1YI1A 5C8YA 5JCZA 3NLLA 4LZZA 3DL7A 5A71A 2VDWA 1AHNA 1U31A 2C5BA 5EINA 2CXOA 3VJKA 4Z7NB 2KSDA 1TGYA 2BOBC 3EC1A 4CQMA 2OMKA 3D3JA 3FAVB 4JLAA 4BFYA 1OCRB 1YHYA 3WNCA 1TJ5A 3GEGA 1Z33A 5IE9A 3IO5A 1II8A 3DPSA 3NNSA 3EGWA 3JVVA 5KTSA 1TKRA 2VQEO 3MRXA 4R1QA 1PW7A 4REMA 5DTRA 2YIBD 5DM0A 5CDFA 1YQWA 2UZ0A 2OT5A 1U5AA 4LXXA 3ROMA 2PRJA 1V0JA 3ESDA 3KCXA 3VPDA 1XFDA 5DN6D 2WB2A 1SKAA 1NP7A 2A84A 3IXLA 3DZHA 5EBWC 3TXSA 4IWXA 4TUYF 2CV0A 5H3HA 1NW4A 4G5SA 3G71F 4B47A 5H83A 5LB2A 4JP1A 2VK8A 5JI2E 3JRXA 2JBWA 2A9HA 1QG4A 3KSUA 2BBTA 4CIXA 2JHGA 5ALPA 3TKAA 1W85A 2QAJA 1PDWA 1QQ6A 3STZC 1MAVA 3COZA 5AP9A 1WPRA 4CMJA 1SN7A 3AFOA 3DDSA 3S0HA 4N3GA 4PZCA 1B4DA 3KHNA 3H4TA 4Z1MG 1IJBA 5JH7A 3OQNA 3VDQA 4WKPA 3QM1A 3KR2A 2FUEA 3GEPA 2ZI6A 1Q0QA 3W05A 3CYOA 1ISSA 1FP4B 4L9RA 3T4DA 4PQFA 3QRWA 3ZKWA 3TECE 2ZRDA 1E7WA 1P2UA 4PINA 4OX9Y 2FY8A 5H0IA 5IJWA 4BQEA 2X1HA 1GUZA 4HZUB 2RSLA 1N5JA 2P91A 2R8RA 4B7UA 1U8YA 4GP6A 3N59A 1Q82W 4S0ZA 3PJEA 4PO3X 1Z3IX 4PQYA 5HRUA 2F3PA 2V1UA 1FQKA 1W3EX 2OK7A 4L5AA 3AM1A 2BN4A 4I50B 4P0TA 5CDFE 1R9MA 3SSOA 1NUPA 2C2HA 4YAWA 2QYOA 1JFSA 3JAWB 4HN4B 3OM1A 4ZEVA 3R9WA 3HXMA 1VQ5F 4IDFA 5L3GA 4DMGA 2XWSA 3QITA 2W7TA 1DAFA 1ZN8A 3F71A 1YZGA 2R6DA 4UCOA 1XWIA 4E5UA 3GLGA 3K3PA 2EHDA 3A1EA 3WVNA 4BFWA 3ZWVA 1R74A 1W40A 1NXXA 5J40A 3JASA 1HE1C 3WA6A 1OR8A 1L7AA 2PGOA 3GMSA 1RBQA 1P6UA 3FH0A 5EL0A 1JEDA 1Y9ZA 1H1LB 1WXFA 1ROPA 4YCCA 5A4MS 3LLSA 2R7LA 3QV2A 1AS0A 1JHDA 4ER6A 4UTZA 1A98A 3IB3A 3Q6IA 5CK4A 2Z1EA 1VBFA 1JV2B 3IDAA 5KLVH 1YL6A 3HXOA 2UDPA 4W99A 1GPNA 4UUQA 3CNBA 4LI0A 2FPXA 1BZKA 4OXKA 3A1WA 3QEBZ 5KHHA 4ZO4A 1Z5ZA 2H51A 5LVAA 1RMTA 3D6HA 1NJFA 4MQ4A 2H2IA 3PDIA 3S2YA 3D31A 2VUSA 4KG7A 1SXJD 4QGBA 4C8EA 2DYSB 2VHEA 2FWBA 3U7FB 1GPKA 4JB0A 4DKXA 1XZHA 2ECQA 3PX2A 4K6MA 3CSUA 3A6KA 1GTVA 1JIKA 4HNQA 4PO1A 5DNUA 1ZY2A 3E84A 5ICEA 1DO8A 2V6MA 2XUQA 3PFGA 1RRCA 1C9NA 1KO5A 1M5TA 1XIVA 3BF8A 1QCCA 2VPZA 5ITVA 2ET6A 4G1CA 4XPIB 1XMQO 4HVAA 2H11A 5ESDA 3DE0X 3S27A 3H17A 4UNRA 3GA7A 3FZYA 1RCUA 3GLGE 4X9QA 2CDNA 3ZH2A 4ZICA 3ENQA 4FFPA 5JARA 4RQTA 2O2DA 4RIGA 5DBOA 1HQDA 3O2SB 3AFIA 3O8LA 2O3UA 4DUPA 4DUYO 2ZUEA 1VH8A 2GRUA 2D06A 1QV9A 5H68A 2G40A 3SNKA 1YQDA 1JDZA 3R23A 1JHYA 3ZTYA 5FRDA 5L3DA 1U3LA 2ZBPA 1K1EA 3DTYA 5FDFA 2PYDA 2VT2A 3SIWA 2A7WA 1PE0A 4BNJA 2NXJA 2B83A 3MOSA 3SOPA 4TYNA 2EILC 1R8QA 1NDUA 3QKSA 1DPFA 1R1DA 1T4DA 1IULA 2JCVA 1GLNA 4NQ3A 3QWHA 3DEIA 5K0CA 1YI0A 3LRPA 3BDIA 1QGZA 5LXTB 3EGVA 4MWOA 4ML3A 1PNKA 3ZBUA 3OY7A 1EI9A 3HYCA 2DYKA 4XI9A 1C9YA 4PAGA 1COZA 1N8SA 1O5IA 3LBNA 4LG1A 1BHBA 6YASA 3E1KA 3G0CA 1HLFA 1XMSA 3ECCA 3T54A 4GRDA 4L08A 1QFYA 1PUIA 3ADCA 1UBCA 5ALGA 4QELA 2X0DA 2XSZD 1W6UA 2Z6VA 2QHXA 1PJBA 5ILOA 3D43A 1YMQA 4DBVO 3IAAA 5B37A 4B8WA 4PTYA 1DJQA 1R0XA 3LKVA 3MILA 1FRFS 2ZYVX 1L7XA 4F45A 3H86A 4D0SA 1GNRA 3WJRA 2MYUA 2M1ZA 3B8EA 1PRYA 5B2ZA 1BHSA 4RPLA 4JAVC 4MVJG 3FCUB 3UMFA 1DOZA 3FPKA 3GOHA 4Q39A 1UBFA 4Y0AA 3W9SA 2N9UA 3AF0A 3STHA 2NXWA 1ABEA 3C8DA 3NV9A 4L0DA 2ZDHA 2P65A 2IZ5A 3R9KA 3CHYA 2XNDD 3R7SA 2FPSA 1BW9A 4MW6A 5BSHA 4GPTA 2AJBA 4AWBA 2NT4A 2WYVA 1KD1W 3LBAA 1IMOA 3TX6A 1X86B 5D84A 4UCQA 2IVFA 4Q9AA 4GZMA 3SOZA 1YFKA 3FB5C 2BDUA 3K0SA 2JI8A 5CA1A 3GCWA 5L6LB 1MT3A 1A2QA 2J9ZB 5CFLA 1J39A 5COBA 3ZV6A 3O85A 3PV0A 1RWXA 2QN2A 1Q1BA 3AIMA 3OO1A 1W4LA 3NHLA 2CVFA 1VA5A 1XZLA 2WD7A 3H8WA 4L9SA 1EKXA 2VH1A 1M5RA 4F5DA 2Q1SA 4DUGA 3CCJF 2NO6A 1S2IA 4HCJA 5DI9A 1JMKC 2OM2A 4GOMD 5FWNA 1BOOA 4ZTUB 5KSWB 4QJ3A 4XSVA 4PI2A 3FYUC 4ZXFA 3FOFC 4ZYTA 3N27A 4XQ9A 4BNKA 2YH2A 3G2KA 3WL4A 3W7WA 3W5UA 1TFUA 4C08A 5CAEA 5L53A 2KHZA 4TTVA 4ARVA 4II7A 5JJIA 3U60B 2PUVA 2YVLA 3L6OO 1XLUA 3CLRC 1TTQB 2YYSA 4QICA 5E95A 1WUKS 3PRHA 4KWTA 2SKEA 1A8HA 4B9AA 2WILA 2RH5A 4QATA 2IBMA 1JAXA 1D4AA 3T1TA 1N75A 2PAAA 1BT8A 4LN1A 3KYBA 1GZ5A 3KJHA 4FFDA 3E70C 3FBGA 4KO8A 4G1FA 4KHZA 4J7CA 5KSPA 1VLQA 2I2FA 2QLTA 2PS1A 3BFPA 4Q12A 1NUHA 3PX7A 2ZETA 2FSPA 3BWVA 4G4WA 1Q1GA 1E5XA 1UKVY 3WKAA 2QR2A 1CQIA 3NM4A 1W42A 2XW6A 4PR0A 3EMBA 3SPGA 2GN0A 4LDAA 4DQXA 3KL4A 5A6VA 4KX5A 4B87A 4MUMA 2AZDA 1ZCJA 2PZKA 3HXPA 1JMYA 4GLOA 4DV3O 1RXCA 5IHPA 3RU7A 1YQXA 1AVMA 4L5IA 3CLVA 1RYMA 1QHXA 2A92A 4GM1A 1PFVA 1NAHA 4HAXA 5JJNB 3FIJA 3GMDA 3Q2OA 5SZIA 4OHUA 3L49A 4NE7A 4KSBA 4AMBA 3AY7A 4ND1A 2MSWA 1M56B 2IYUA 3RIYA 3O3MB 5KSZA 3MMSA 4EVSA 4G89A 4JPRA 2P9TA 4AK9A 4K9NA 1K5DA 5EZYA 4MS3B 3C1UA 2PFSA 2ZQYA 4J2HA 5LP1A 5ALSA 3USZA 1GQOA 2YFKA 3PHCA 1R0KA 5HUHA 3J7AU 1XCMA 4NZNA 1PK7A 3FD5A 4XGQA 4ZKDA 1XU9A 3W90A 3Q41A 5CIQA 5BSKA 1YQQA 1HTWA 4DLYA 5BV0A 2GFIA 1O6CA 3E1GA 1P5JA 3EG9A 2GMWA 4G1EB 3ETEA 3RW0A 3ROXA 1GO3F 4ZRDA 1S4QA 1YGYA 4DEVA 3A6GA 5ENDA 3ADOA 2WZCA 3SJUA 1BWRA 1QDUA 3ZD7A 2JLVA 2X23A 3IA2A 1DWOA 1Y8QA 1VQ8F 3ZU2A 4E09A 5KYYB 3E35A 1C9JA 4HC4A 2Y8EA 5FBLB 1Y37A 4MMZB 2P1ZA 1WUJS 1QOQB 3UWPA 3CUVA 2IV3A 4JYZA 1MJGA 1EFKA 2R8BA 2XR1A 1N9ZA 4LP8A 2HG5C 1YS9A 4NBWA 3E1SA 1XB2A 3TD4A 5ABPA 3MWEB 5KAMA 2PS0A 3IJ5A 3TTSA 3TWOA 2X14A 1R4ZA 2J45A 4E7PA 4R81A 3QX3A 2BLLA 4OAOA 3TPFA 3NT2A 2VQ6A 4XM2A 2WF5A 5JYCA 2R6R1 3FUUA 4BIOA 2VA8A 3ESCA 4DR2B 3EGDB 5DM1A 1AR1B 4X44A 4YJ2B 3ROEA 2Q2QA 5GIOC 3C39A 2HLNA 1R6TA 2CZCA 4K8ZA 4I6JA 4LHZA 3VRHA 2W2QA 1UM9B 2BF4A 4O8CA 1G16A 1BDMA 4R41A 4M1WA 4MVJH 1DPGA 4LJYA 2NO9A 2EWWA 1UXIA 2Y1CA 1CQWA 2Z5GA 2QYHA 4F12A 3U4MA 2PYIA 1TCVA 3URMA 3JD4A 4X7MA 2W2TA 1Y1KE 4EG0A 4RPJA 1I3CA 1AGXA 2EZUA 4FLUA 2B0JA 2F8MA 5DGDA 1I0LA 1GPUA 2Q50A 1KKDA 3QHPA 3UWKA 5FI1B 4M3NA 3X2SA 1YHQF 3DDHA 2CXPA 5DHAA 4PC1A 1CUEA 3P3PA 3WG7C 1FVOA 3PXXA 2GD6A 4UCRA 5JATA 2Y3IA 4C0LA 2DJ5A 2XKJE 2UXBB 2QJFA 4F72A 5ALYA 2ZR0A 4FYJA 4XUDA 1WW3A 1P3Y1 2O8DB 1Z8NA 5CB0A 3SQLA 2GBLA 3MCAB 4L8WB 3DJFA 1YA8A 4IGFA 5L95A 3ABIA 2NZWA 1BJRE 1ACLA 3BL6A 2O14A 5IKXA 4LF8B 4FN4A 4MI9A 1XLTA 3CUYA 4JXZA 4J9YB 5JNSA 4I4CA 4XQEA 2JFBA 3SR4A 2AW5A 5CTAA 2BGTA 2H52A 5JD4A 3HK2A 1A50B 1MX3A 3DUWA 5CIWA 3RWMB 3W2TA 4OMUA 1FYWA 1P1CA 3KTAB 3LY9A 5FH9A 1E79G 2JH8A 2R5FA 1UMCB 1RJWA 5EXEA 1RI2A 4EAAA 2Q0QA 2EINB 4AU1A 1WSDA 1KVUA 3EFEA 4GYYA 4OJYA 5K1ZA 1EU1A 4DJ5X 3QKTA 3NYIA 3DEYX 4FLYA 2UUCB 4BVFA 2WMOB 1V3VA 3ZWMA 4HGZA 4BMOB 1OCOC 5A4IS 4CI9A 2DUJA 2FDCA 1M6YA 1Z2AA 4PPFA 2IH3C 3JS5A 1TJ3A 4YMUA 2DXIA 1YQTA 4ARZB 1U3FA 4FFVA 5HRAA 3ILXA 2UUBO 2DUMA 1YFZA 2E55A 3Q0TA 2JAHA 2DY0A 4RHXA 1KYZA 5HK8A 3ZK8A 2B35A 3K9HA 1D2GA 4RGYA 5LMNO 4WCFB 2FHSA 1Q95A 2NVUA 3F7MA 3AY6A 3LNMB 1A9PA 4L8JA 3E61A 3H2JA 2WJGA 3OLXA 2VYQA 1YR3A 3HR0A 1WBJB 2EG9A 3R3HA 1D8AA 1GFSA 1X9HA 4I4TA 3K30A 3CRCA 3MF4A 1VSBA 4EHIA 1M54A 2OOKA 2W93A 4DB4A 3VJRA 5IH7A 1XROA 1B42A 1OU4A 3QTTA 2AN5A 3ETJA 3VU1A 1KPIA 4DMUB 3KVRA 1TM5E 2OHWA 2ZJ6A 3QKRB 2QT9A 4BYGA 3CB4A 3UB2A 5BY1A 3CZ9A 2EHJA 4KQ6A 1B74A 3AESB 4ZQGA 3QMMA 4KIFA 5TISZ 4QU0A 5DHQA 4PIVA 3C9RA 5AK0A 2H1SA 3OJXA 1DUSA 3A9VA 2FKAA 3H4MA 4H0FA 3NXSA 2I3DA 1FSZA 4EG8A 1DCMA 1IX9A 3CT4A 3TXQA 4JI0O 1ZMTA 4B9EA 3WNVA 5B7GA 1E3EA 2ZJZA 4YPVA 4C0XA 4B4OA 2IELA 3DFKA 2X8WA 4KXLA 2R1VA 4OUDB 1QIJA 2BFCA 5A7FA 5BN5B 3S1LA 3UJNA 1LA2A 4CTJA 2ZE5A 3D1VA 3F46A 3LQFA 1LBSA 4MTOA 3WJPA 2JGDB 3GJXC 1UOEA 2WKPA 1JXOA 1QHNA 3IR5A 5JAOA 5L4NA 3TZQA 3ZLTA 3K3WA 1EE2A 3GDWA 3NGXA 2QE7G 1KZ1A 3JQPA 5AVOA 1Y5LA 3OEED 5FA5A 4JKOA 3PJRA 4IGAA 2PYLA 5C81A 3W7SA 1YSCA 4ZHVA 2QTAA 3R0JA 3DYBA 1Y6QA 2AEMA 3EG5A 4Y2HA 1GN4A 3MB8A 3HG7A 1NNI1 1V6SA 2JL1A 2V98A 1G6KA 4G88A 1E4VA 4RKWA 4LJ8A 1Z5PA 5GGYA 5KWJA 2XT6A 2Y69B 4JI6B 4WE3A 1TLLA 5HF9A 1OX5A 1O5OA 5F3WB 3V00A 1IG3A 4U2GA 2NUTA 2DPGA 4LH7A 2MIIA 1M1NA 5EZ6B 5IT9N 1GN6A 4J7ZA 2GXAA 1R6UA 2XAAA 3H3FA 4QQ8A 3TFQA 1JSCA 2IUTA 3PSAA 1YR8A 3FX7A 5GMOA 5E3IA 4Q4JA 1B93A 4L50A 4FW8A 2ECOA 2EFJA 3EXFB 2HEIA 3OFKA 1KS2A 2VK1A 2BMFA 3DGEA 2W11A 3CNHA 2P8SA 2ZZKA 1JDUA 2N74A 4ZVRA 2F4NA 4B1FA 3GB7C 2DLCX 3HDYA 2BMWA 4NYIR 1KRWA 2F90A 1TZBA 5J4YA 2A2ZA 3U1TA 3TETA 2HHHB 1GTZA 2FDRA 4B48A 4B6GA 2O19A 1GN8A 1MP0A 4I5SA 1GUAA 2WT8A 2B9VA 5DHFA 1PWHA 5JJBA 1E9EA 1XZJA 3BGWA 1CZUA 1GN9A 4MUYA 2QD2A 4DUZB 1SUIA 3QPBA 3O4JA 2V58A 3PF9A 4BVLA 3L6EA 2O05A 4DJAA 3WWZA 4GH5A 1E58A 4Q7QA 1ORTA 4MITA 4UD6A 3LBFA 3NIDB 3MWDB 2RHMA 2JRIA 3TSAA 4NBSA 4E1AA 3NOQA 4DMMA 2V7GA 4B40A 3AR5A 4NYKA 1KI1A 3S0WA 2OM6A 5DMXA 4RYLA 3IBCA 2ZI7A 1F4VA 3HN7A 3DMGA 4FM9A 3OSZA 4V2IA 2AHOA 2VT6A 3NZEA 1ISIA 1FBTA 4DNOA 3BVOA 5EUCA 2DFPA 2ZWIA 1N92A 1XCOA 1Y4SA 1R6AA 4RELA 1SQFA 1C1XB 1C4WA 4EG7A 2D5CA 4BLPA 1NVUQ 2WWFA 3VBEA 2Z4RA 3C3TA 3AR3A 3U39A 4L02A 4EUEA 2QUKA 4Q3LA 4GYJA 5I3CA 5EP1A 1XZDA 3EMKA 1JTVA 4NHEA 2J3DA 5GZ6A 2PMFA 1I1NA 3R6GA 4PD4F 3GHYA 3UANA 1SVKA 1GRCA 3A4TA 1NVMB 5MFPA 4NBKA 2UXCB 4B6PA 1K3FA 2HTEA 3SIXA 3HZOA 4N47A 4B3GA 2ZTUA 4XDJA 4CH3A 2QNRA 4B82A 1WZCA 2NSYA 2VXCA 4ZCRA 4FKBA 4IH9A 2E5LO 2WDPA 2TS1A 1K27A 3TEMA 5AKEA 4CIAA 1NW9B 4X91A 2GILA 2D5IA 4M2LA 5BNZA 4RFSB 4LF9B 1YDWA 1EWQA 2LP7A 1FVHA 4BRSA 5JRZA 3D1JA 4QDXA 2A3QA 4UBJA 1LVGA 5EQTA 1YZ3A 2IF0A 3RJMA 3ND6A 2ZB7A 2LFRA 2BDEA 1VRCA 4J10A 3DHWC 4M60A 9GPBA 4PNEA 3W4KA 3SC2A 1L9KA 1UANA 1C1YA 4IRMA 2GSMB 5KU1A 4EMUA 4FR5A 2OE2A 1DI0A 4GZRB 2GZSA 2SCUB 5DTMA 4EKNB 5IABA 5DI3A 4LOKA 4OO3A 1Y48E 4LE1A 1JVNA 1ESCA 1YRYE 1MC4A 2FPWA 4NR0A 3VDMA 3EX7C 3EOAI 4A0SA 5EQFA 1KSHA 5K0BA 3RFVA 3VDNB 3AKZA 3FNBA 3A2LA 4M1TA 5EOVA 4DGSA 2HQBA 3L70H 3MCUA 1EGMB 4JNCA 3L0DA 4FYIA 4MR9B 5E6UB 4AKSA 1F3LA 4PX2A 2BMDA 3JVDA 3IAYA 1Q7YW 2JD0A 5DLEA 1P1RA 3GP3A 1IEWA 3GNTA 3ZWDA 2F43A 4RCYA 3I76A 4EKGA 4C3VA 1FNMA 1K8YB 1IK6A 2CFSA 1K6XA 1G8JA 1SKYB 5A4KA 4FXPA 2AG0A 5K0TA 4AULA 4Q4AB 2FX2A 3IOYA 1H65A 5L7TA 3HEBA 1YEWA 5HKKD 1DF5A 1JVSA 1O6FA 3X1DA 4N3BA 3ROZA 4D5GA 3PI6A 4DNFA 3QWBA 4D9JA 5DYIA 3L6BA 1NUAA 3S1SA 3KJKA 1DWPA 4WJZA 4JGGA 4CS2A 1QO0D 3K57A 1P5RA 1OXBB 4HAVA 4X5OA 5LL6P 2H8CA 3PJGA 4DQUA 2AX3A 2DFTA 1LWNA 1SBHA 3C1OA 3HBAA 4PLVA 2R86A 3B52X 1A8IA 1XF9A 3WMEA 4UVIA 1G9TA 1Q1AA 4CT5A 2PUCA 4HNAB 5BR8O 3HYRA 1DTWA 3FOAA 4H1VA 3DEFA 5I9MA 1N5DA 3I9NA 4CMCA 1NJ5A 4X24A 4C4ZA 4G0OA 2RKOA 4HPXB 2IP1A 3LOQA 1GTG1 4IQFA 2ECFA 1TYEB 4NABA 1HR0O 4XYLA 3P0RA 3DOHA 4EGAA 1U0BB 1B1AA 3ZW7A 4PLGA 3U0OA 4RGQA 1VQ9F 3OJWA 4OQYA 4EYGA 5DX0A 2XXAB 2YWJA 3O83A 1SVNA 3HLYA 1WPGA 2UKDA 3QU4A 3AZOA 4BAZA 3L0YA 3AIIA 3TQSA 2N75A 2K1SA 3U7EB 1FUEA 2H5IA 1HE3A 5I7UA 2BMVA 5BQXA 3HCDA 3NP7A 3FOZA 1R6DA 4LCEA 3MEQA 4JX8A 4LFBO 2JBAA 1YCGA 4B8ZA 4MH0R 1O4WA 2HK8A 3SC4A 5BWCA 3C3WA 3SEQA 4HWKA 2CGOA 4G5YA 3WTCA 2CL5A 1B8OA 3R77A 1XVLA 3R5TA 1R6KA 2H65A 1V8OA 4FNOA 4XR9A 4LE2A 2WQ7A 4DSAA 4HMPA 1UADA 3RVJA 3UAOA 4KUMA 5CB4F 2QUBA 4KMSA 3WSVA 1ONBA 2XB4A 4JEHA 4NJEB 4LRQA 3IELA 5J59A 3B3GA 1Z6AA 1V55B 2EU8A 3Q7QA 1X87A 1CUBA 2GJ4A 2X2EA 2W5UA 4KK4A 1KYYA 5TX7A 2OFOA 2ZRQA 3Q72A 5HJ2A 4X7BA 4PHZA 2Z2XA 2XE4A 1ZOLA 4TX1A 3UUWA 4L28A 1NKTA 2HIMA 2JAXA 2XAUA 3RK1A 5CCXA 3OPYA 4JEUA 2M32A 2JHFA 1XTIA 1N9KA 2HWKA 3I01M 2QN3A 5EKTA 5CLLA 4FFWA 3HA3A 4L07A 3NBZC 5HGJA 5EZQA 4JVNA 5HRCA 2GPAA 2GAOA 2FN8A 1FP2A 3OTWA 5FPPA 5FADA 4JLUA 5DLYA 3PGXA 1ESMA 1TT7A 1A4XA 3HDHA 1AI6A 3KIPA 4RVHA 2XY4A 3H3JA 4J2OA 3TCXB 3L0IB 4UAGA 2DLNA 2P9FA 2YMLA 2HZ7A 3L8HA 4WNCA 1WE2A 2EV9A 3WLOA 4GO1A 1FCJA 5BSFA 3HXLA 1MZPA 1W1WA 1ZC4A 3DC6A 3BULA 2Y0IA 3NIWA 2P6RA 3A9SA 2OAP1 2Y0DA 4AN1A 3NRCA 4R1NA 3BGVA 3B70A 2YINC 4HLCA 4Z4GA 3CCCA 4FFKA 1ORWA 4X1KA 1N0NA 5AI0A 4F8YA 1UJMA 1MJNA 4ZWNA 2JDIG 3FOCA 3TAUA 4YYZA 4NWOB 1QNMA 4YHHB 2VTEA 5GP1A 3B38A 2QTZA 1GL3A 4EY6A 3WIDA 5DT2A 3R74A 2O2HA 1DAIA 4U39A 1DZIA 1QS0A 4V0OA 3WYNA 4DJEC 5LP6A 1E6KA 3WQSB 1CUJA 4MW8A 3I55V 1F8XA 4EIWA 2UVPA 2QW1A 1J6UA 4WZ6A 5AVXA 2VT3A 2Q46A 5F64A 2JVKA 4BO3A 2OHIA 4G07A 3I0NA 4QREA 3N28A 2ZW9A 3TQIA 4I5DA 3WSWA 3EZ2A 5F52A 4KFRA 2IUYA 3W5SA 4JDUA 2Q1XA 4NP6A 1CJVC 1EFRG 2A0YA 4NMMA 1AK9A 5A4FS 5B3SC 2GZLA 4TXJA 3EHBB 2JFQA 3ZP7A 3X1WA 3WJQA 3E18A 3A14A 2WE7A 2NXNA 3R8CA 4PZUA 3OVMA 5K9ZA 3UAVA 4G67A 3TKYA 3SZGA 4P5PA 2C1ZA 3PP8A 3QEOA 3SSMA 1IWPB 1L5RA 1T4GA 1VM6A 3LWDA 4LXQA 1ISRA 3AY0A 4C0BA 3QYJA 1K2VN 1H2SB 2KTVA 2X8JB 4LCUC 3NEAA 2WZQA 2J32A 4P3PA 1Z2GA 1B7GO 4YMLA 1J9GA 3DNMA 2W2LA 1SC9A 2GWHA 2OP1A 1XWFA 2D1QA 3W3AA 1H2BA 1PHPA 1ATIA 1UJ2A 3CN9A 5JXJA 1ZN9A 1JU4A 5J63A 3TIIA 3HR8A 4UJ3A 5DGTA 4NG5A 4JP2A 4CMEA 3WLFA 4R50A 3KCNA 1IWOA 3PTZA 4L78A 5ILQA 1XZMA 3IOMA 1XAIA 5JC8A 2O0HA 1MC8A 2PX5A 1UKZA 3WGTA 3K9CA 4M8LA 7ABPA 4FR0A 4RD3A 3H9JA 3C5VA 3NGMA 4ALNA 1ZRHA 5F3RA 2HRBA 2DRIA 2PL5A 3J81k 3ZY6A 4JLSA 5LHIA 1P1FA 1B00A 3MQFA 4N39A 2JS3A 1BIFA 2HIHA 3U4GA 4B62A 1M9NA 2B4AA 3GLFB 1FLDA 1BMFD 2IOFA 5U4XA 4BGDA 5K09A 2FG7C 1YAHA 1ZGZA 1LTHR 3IODA 5EXSA 3QXSA 3WRXA 2X3FA 1XHXA 1IUNA 3NT4A 3LE8A 5IK2D 3T7AA 5JWHA 1ML4A 2OXIA 3VSBA 3BYQA 4ZAVA 2EZ8A 4FEYA 2QJ1A 3RSQA 1RBMA 5FUBA 1G7RA 1KKLA 1IEQA 4PZLA 3AF5A 4R6WA 2ZTLA 4YMIA 3OMWA 3OR6C 4OHOA 1AGYA 3Q5EA 4A9AA 2PV7A 3ASUA 5CDHA 3IP3A 1RXWA 3E1YA 3ZRXA 1WP4A 3SYOA 5IM4F 1MIHA 4IO0A 3HB5X 3QBVA 1PXWA 3OIVA 1SQXH 4D7SA 2QTHA 4X9XA 5LQKA 1YUNA 2XUGA 3CWZA 1RLUA 3CVWA 4YDSA 3EVZA 3EFHA 4MKXA 3I1IA 3JQ9A 4S24A 4Z53A 4Z4CA 1JRLA 2P2ZA 1TKBA 4J94A 1OI4A 4N6NA 9ATCA 1HT2E 1DWUA 2A9PA 5DWDA 5ICMA 1IURA 2G04A 4I66A 2ZODA 3QVMA 1NF9A 2IXAA 2OYQA 1ZM4A 4JYAB 4J0QA 1JLHA 4ZZ0A 3MJHA 1O94A 2C3PA 1ZU5A 3HB4X 1L5NA 2VRCD 3QW4B 1R0BA 2O2XA 1RT9A 2JFVA 3G6WA 3OU2A 5JNWA 3F7VC 1E7KA 5EJAA 1NVDA 2P4HX 4REOA 4ZCLA 4NBUA 1YJ5A 1WCYA 3CUKA 3EA4A 2CHGA 5GJBA 2J3JA 3PA6A 4MB6A 5AKYA 1AOXA 1DELA 4A26A 1S9HA 3N70A 2IU4A 1PDOA 1E1RA 4PG8A 5TGDA 4U0JA 5A0VA 3LQQA 3L7CA 1E1CB 4A03A 2M9MA 1J0AA 4AY3A 1QRAA 2Q07A 4I7EA 4BWYA 4QECA 5EGNA 2JJ2A 1F8FA 1E9SA 4I2NA 4IYRA 3DCYA 2ZRHA 1TJNA 3FNFA 2VJPA 1ODKA 3EYAA 2AXEA 4LNUA 1Q74A 3EF0A 1Z63A 5I6DA 4I50F 4NIMA 2Y1GA 4MR8B 3EWNA 1DV1A 2CVOA 5CK5A 2RHOA 1QCDA 1KVRA 2P78A 1FSPA 4PYOA 4ZVNA 2PI4A 1N9GB 2ZIMA 4JUDX 1C1DA 4P1ZA 1QH0A 4NHOA 2XODA 2FZCA 1E94E 1Z07A 2QDKA 4AXXA 9MHTA 1IPEA 4RVSA 2YYEA 1Z35A 1R0SA 3F8WA 2QQ5A 4HGYA 3E3MA 1ONIA 2PJUA 2CC2A 3WWOA 1L3IA 3OFJA 4IXWA 4W8GA 1IN8A 3RT3C 1ZJ5A 2PU7A 3T3EA 2D3TA 2ZT9B 5BURA 3FW1A 2F9MA 3QI2A 3KQOA 1OXTA 2FI1A 2PA3A 3RWRD 3KUKA 1ZS9A 1SQ6A 5EPOA 5HNKA 1W4RA 3DV0A 1Y4DE 5BSUA 2J08A 3V1LA 2WA2A 1A9TA 2MSCB 1NC3A 1X0XA 1F17A 4L9WA 1WQ3A 2GBPA 3I9FA 5CVTA 1J5EO 3VR5D 1DIRA 3BWEA 5C5EA 5AJWA 5ALXA 1U0SY 2ZQ5A 3RD5A 3EY9A 3N53A 3TTVA 2XITA 3E27A 4NAUA 2HYDA 2IUSA 4IDEA 1J90A 1OD6A 3ZD9A 5CD9A 4CH5A 3MBMA 4ZOLF 3GI1A 3DMYA 1D7OA 2X0EA 5JV5A 4G2NA 2DTDA 3LDHA 3R2JA 3NORA 1U3WA 1BSMA 1OGJA 1JLLA 1SQSA 1LNSA 3QHDA 3FSGA 3QPWA 4K87A 5B1NA 5LGUA 1L5LA 1VPVA 1US8B 1ZITA 3ADBA 4MEJA 3T80A 3UKOA 2REOA 4JJAA 3LOPA 3IMEA 2VJDA 5GAPK 1IZYA 5I7VA 1B6QA 4D57A 1U2GC 2LXNA 4BXOA 4A6PA 3P4EA 1MCZA 1QP0A 2GZRA 1XNQB 4K81B 5DHRA 1SCNE 3O0DA 1G9SA 4BNDB 4B3SO 4BT2A 2ZJ4A 1WBBA 4KAFA 4HYEA 4X93A 5J23A 4HB0A 1AJPA 3RS5A 3C24A 1KERA 2FP4A 2HNBA 2EJTA 1AHPA 5K0GA 1FNNA 2WC1A 5CDUA 3DR3A 4Q93A 1QVVA 3CCQV 3D4LA 1JIJA 1IHYA 1NVPB 2AMJA 5I5EA 2QRGA 2YW2A 3JD3A 3RV3A 2I8AA 1BWQA 3UUEA 1QTRA 4Y30A 2GZHA 4IW3B 3DZBA 4DDMA 4PS0A 3QOWA 4IQ4A 2VDOB 4KFTA 3VBCA 3FPFA 2ZYTX 4S1WA 4UFOA 5C1BA 4LYJA 4KQGA 4HEHA 3ESAA 4JC5A 1J23A 3K0AB 3TOSA 1G4YB 3PQCA 1T0PA 4JCCA 1VQ6F 5LXTF 5JQGA 4UCTA 3CC7V 2G1UA 3L4BA 4D7TA 1RJDA 2CDYA 1ONNA 2VJLA 2ADOA 2X3UA 3X1XA 1LRKA 4W5NA 4N5DA 3VM6A 1JKMA 1C7ZA 3TD9A 5E79Z 2ATIA 4R9RA 1YBFA 5FEUA 1MMFB 4RS4A 4NU0A 1LV8A 3KB1A 3V1KA 4FINA 2QGZA 3NI2A 4MLDA 1T8PA 3B20A 3HJWC 1ZLZA 5AUQA 1FAFA 4G63A 3RVSA 1FXWA 3K9WA 4DR1B 3WHKA 1SUFA 1OIWA 4CM5A 4HXEB 3OY2A 2G9QA 1FYEA 1DX4A 4PF1A 5CFZA 1X7XA 1CN7A 2PMDA 1GH6A 3IERA 4O4JA 4L6IA 1XRGA 2W4MA 2OGZA 2BVNA 5JSZB 5K8LA 2Z1FA 1E2HA 1RHMA 5SY9A 1XZCA 4A6DA 4DT1A 1K5SA 3IEWA 3FMOB 1QVGF 5IYZB 4LEIA 2BH2A 5HTOA 4FYKA 1NNLA 2CNWA 4X64O 1XDWA 2V7TA 1GSOA 3A6DA 1Z6XA 1OZ0A 2XXBA 3E8XA 1SQ0A 4WLNA 2B20A 2PBFA 3OJ0A 2Z1NA 1KL7A 2VYVA 1W36C 1LBIA 1T6NA 3BIOA 1PR6A 3W1WA 3D2BA 1OXMA 1MW8X 2WSSG 5B66Z 1D2NA 3FYUB 3RC3A 4A73A 2B92A 4RTLA 3BJEA 2A79B 3DO5A 3RIXA 2GM3A 1P1BA 3OOHA 5LUBA 2FZGA 4R8SA 5TF0A 2ISSD 4MUXA 5M2QA 3WGYA 2DR0A 5C18A 4ZHQB 1DADA 3RRMA 3FDFA 4LXTA 2CVPA 4TV9A 1CR2A 4ZDJA 3E86A 1RLMA 1C8KA 5I7EA 1X7WA 2OCAA 5EJ5A 3H1AA 1CUSA 5COAA 1XNRO 2DQ0A 4DV4O 1UBKS 5L3BA 4YFYA 4CGZA 1WG8A 1BMQA 1Q17A 3JAMA 1OAAA 3HVUA 3LSTA 2ZWOA 3FRHA 2CMHA 4G26A 1V16A 2PNFA 5GONA 2R6GA 4G5XA 1MO5A 4PLZA 1Q7CA 2XT9A 2DUNA 2J1LA 5EP4A 4UZFA 2WF9A 1RP1A 2ZDGA 1ZI8A 4YXWD 4G4VA 3RREA 3ABSB 2QRNA 1DJOA 4LSWA 4EEKA 1PBNA 4Y1FA 3P0HA 4DA7A 4U00A 1UBNA 2OZKA 5KVQA 4GYKA 4L87A 3MMZA 4EA8A 5CHEA 4LK3A 3EIEA 3ZVKA 1BS1A 2Y2UA 3TTYA 2OB2A 2Q7OE 4A2WA 5G0UA 1CD5A 3UFXA 1BXGB 1GA6A 3RU3A 1PJ2A 2JLCA 1OFUX 2JATA 4XQCA 3PB3A 4FX5A 2Z2JA 2H85A 1DTSA 2J4CA 4H7KA 1Q7BA 3ANLA 2CAZC 1YOVB 3ICOA 1PJRA 3K73O 1SZQA 5YASA 3FDIA 4KVZA 2EZ9A 5BW6B 2ZI3A 4QQNA 4NB5A 3RG8A 1INLA 2D0OB 2XVZA 2QZPA 1GUDA 3DLIA 1TEZA 1Q92A 3T4UA 3T5CA 1SK8A 3KWMA 1UC5B 5JPCA 2OT3B 2C2XA 2PT5A 3U9LA 5D5HA 3KKEA 1MEJA 1X6VA 3BA6A 1WPBA 1O95A 4UMFA 1KYOF 3KJNA 1ZXBA 3F78A 4HI0E 3I04M 3GPBA 3VQYA 3A9TA 2LO1A 3P2YA 5HF5A 2A9RA 4ND7A 1QK5A 1ZWIC 2PBLA 4Y9UA 1J20A 2YICA 4P4SA 5KAPA 3ENNA 1K7EB 2KG4A 4RZ2A 4OK6A 2ZJ8A 2VCYA 1E4EB 4P86A 2DWEC 5KI6A 3CXRA 4N8EA 1AK1A 5IC5A 1EAYA 4M1QA 1IY2A 2YXPX 1A9ZA 4TLLB 4YAKA 1P31A 1M0EA 3DVLA 1DRUA 4Z3OA 3AFHA 1G41A 3WWDA 3A36A 3AI1A 3EQ2A 1KDZA 3THWB 1ZW1A 1XTUA 4HRYA 2B7BA 2W6ZA 4OK5A 3HCNA 5E7MA 1SB9A 3DCJA 4NARA 3I1YA 1ESNA 3IEXA 4N7RA 3LWRC 1WSWA 4KK3A 2I76A 1T9DA 4UHHA 1YR2A 4GCZA 3B09A 3TMAA 3RVQA 3BMCB 4B46A 3UMCA 2E21A 4CMAA 3ZHQA 4RL4A 4YQFA 4MRSA 3R44A 3C5WP 4F93B 4N6OA 3ORYA 2ID8A 2BO1A 4M9ZA 1Y82A 3C3AA 1N2CA 1SXJC 1QIDA 3AL2A 4LMAA 4N23A 1SCKA 1M2GA 2BFBB 4YJFB 3R9XA 2WU4A 2F43G 1FQOA 2AOXA 3JXEA 1HMPA 3IVXA 4NYJR 3V48A 1PGJA 1HEIA 4WTOA 1SKBA 4MRPA 1PGNA 1JQ0A 3UA4A 3CYFA 5ALOA 2GN4A 5CDGA 3I72A 1CDDA 4D99A 2QM8A 4RQUA 5I4BA 1S1CA 2B33A 4HTFB 3T0GA 1VXRA 4U8GA 1S02A 3IMKA 4I4LA 5L3QA 4YAGA 1FMJA 3NHFA 2XUAA 4HSGA 4XLZA 2QZSA 2BZ0A 3O26A 2IHZA 1H2GA 1PKEA 4YNBA 2QTPA 4S1OA 1FDIA 2YQ4A 3JVIA 1ZNWA 5T8KC 2QTRA 1AKVA 1T8YA 4NENA 5LFAA 4URHA 2O59A 2GPYA 3E2IA 3I6BA 3M6LA 5CT8A 1F4PA 1KZYC 1YWGO 2W2KB 4KFCA 3EIQA 1N1DA 3UJDA 2H8PC 1FUUA 3EZ6A 3O7MA 4QFMA 3RAPR 2DOSA 1Z4PX 3RFCA 4RY0A 1N2CE 3UAWA 1DEXA 5IAOA 3RARA 2P7IA 3KALA 1Z36A 1E2JA 2DQ3A 4EEZA 1X2BA 5BSWA 2Q6TA 1MGPA 2XBMA 2CFCA 4Y2UA 3VSEA 2ZATA 1WHTB 4MVWA 2BR4A 1WJZA 5AW0A 1ZSYA 4YLYA 2C9ZA 2I1LA 3NHUA 2ONJA 4LHEA 1GQSA 1L8LA 3P0ZA 1TVKB 4E4RA 3QA9A 2IZ0A 4M46A 1G18A 4MYDA 4BEVA 3A0BZ 2BZ1A 2CFRA 4HHEA 4IWYA 2QRHA 4V1CA 5A2GA 2WSLA 3EHDA 4ZEXA 3GA0A 1NN0A 3AF4A 4HQKA 3CKLA 4PNHA 1H8EA 1TQ6A 2A1IA 2WJ3A 1I2BA 3RIHA 1XCPA 4R68A 4NECA 2EBFX 2C84A 1ZQ9A 3ZHBA 2HCTA 2QA4F 3EB9A 4C9BA 1EA5A 3ISTA 4CM1A 3NTLA 3QLTA 4N76A 1ZGGA 3ONWA 1QE0A 2EJUA 3ED1A 3OZCA 4EDHA 4O6VA 3Q7EA 2HP0A 2NV2B 2Y4TA 1HPLA 4NDAA 3NOXA 3QE3A 3AR2A 3HP4A 3QVXA 2A78A 1KQFA 2CGEA 4LUCA 3MT8A 5KO2A 2Y9MB 2HM7A 3DTVD 4QASA 1UK6A 2CBXA 5MGNA 2UUOA 5TS2A 1K7SN 2G5TA 4FEGA 4DR3O 4NTXA 4ZQFA 2QNIA 5LA6F 2UYGA 3RVZA 4GKJO 1KMNA 1SNYA 4OB7A 3N0WA 3LNCA 3IBSA 5KNDD 3T94A 4A0FA 5IANA 2OCLA 3MD9A 3GRYA 4H3VA 1IRXA 1E7MA 1XMOO 3R5KA 4NONA 4H7DA 4FGKA 4LXYA 2FZ5A 3KLOA 4H44B 1S5JA 3U16A 3SIVA 2EVWX 1H2NA 1ZONA 1RAAA 1FL9A 2E3JA 2PSFA 1HNNA 3FB7C 1Q5PA 1N2IA 1Z7EA 2FH5B 3RJZA 4OLFA 1FU7A 2OD9A 1LPAB 1T6ZA 2XZTA 1Q21A 3IE2A 1AZLA 1B26A 3MT9A 1WVMA 2LV8A 4G4SP 4JQZA 3SXJA 3P71T 2HVKC 4INAA 1IWBB 3NUGA 2BAGA 3X1MA 4D6TH 3M6VA 5JFOA 5KU7A 2OR3A 1ZC3A 1SRYA 3VSCA 3DEHA 3ZJ5A 5B36A 3V4SA 2HO4A 2FQWA 1K92A 3I5YA 3HKCA 1ZD4A 2G9ZA 2EAUA 2AOTB 2OV4A 1BYUA 2FB9A 1XBIA 5IKPA 1N7HA 1YDGA 1ZZGA 3RASA 1HYQA 4AVYA 3EDQA 4LX0A 4FS8A 1XVAA 4H3KB 4AQYO 4CBVA 1ZGHA 2VDNB 4BL5A 4Q47A 2ZJ5A 3AVOA 4Z8YA 2O3RA 1ZK1A 3AXTA 4L8YA 3WOVA 5CEFA 3THYA 2XOEA 4GWKA 3WIOA 4W7SA 3P52A 4EA9A 1ONOA 5L40A 3ZHSA 1ZXLA 5AJXA 4L73A 3SI7A 5IDJA 4EPXA 4F6LA 2C98A 2EJCA 1T2EA 2RHDA 3PC3A 3UJ8A 3J81A 2H59A 4KWCA 5HKOA 1XG5A 3U7IA 1P7GA 1T36A 4RV5A 3VH2A 1R1BA 5JXIA 4TT8A 4IOJA 3GAAA 3GBSA 3EQ9A 2PH1A 4OSOA 3FCOA 5LDGA 3A3PA 2RGGA 5A03A 3ASVA 4KXUA 1PFKA 3MHHC 1KPHA 2FN7A 3WGKA 3A1FA 1MX1A 3CVJA 2V5VA 1QYXA 4D0NA 4EB8A 1A1VA 4PPYA 1F6DA 2ONKA 3NJRA 3VAZA 4QQFA 4NZPA 1Z12A 3COYA 4FNGA 1OCCC 1X3SA 4ESOA 4Y2XA 1SZDA 1BVUA 3TW6A 4JI4B 1YC5A 4W7IA 4IKOA 1LZLA 1Q3EA 3AUJB 2WIKA 3R3YA 4UFZA 5BQFA 4GMXA 4EFBA 1RSOA 3ZDXB 3Q9SA 3V5NA 1M83A 3JWPA 3IKMB 2QTFA 3A04A 1BGYH 2F64A 1H1TA 1Z34A 1N32O 4TLCA 2W0SA 1NVWQ 4L4XA 3CE9A 3D0OA 3FMGA 2R8XA 4M0CA 4LY6A 1UP6A 1S96A 4FGSA 3E5RA 3ZU6A 2V4ZA 2KMLA 5IAJA 3PQEA 4JP3A 1RAIA 1C5KA 1XMXA 2HAEA 1Z6QA 1J1IA 1F2UB 5CVDA 4QRHA 1JR4A 4ARSA 2ZVJA 4U9HS 4X62O 3UA3A 2AG5A 1H2LA 1PWZA 3HDJA 1NMSA 1EIZA 3SNHA 3AEKB 3THSA 3SR2C 2VPIA 2XE6A 3A37A 3CNNA 3IDSA 2VC2B 4TS1A 1QORA 2HPVA 1E3DA 3L8CA 1JWLA 2W37A 5IF3A 2MSKA 1TA8A 2WWHA 2PLAA 5BMVA 2JLSA 3GB9A 3OM9A 4KFSA 3SKYA 3BPSA 4QJIA 3IJRA 3M0EA 5TXGA 5HCNA 1AZWA 4ZT2A 1YJ8A 3BJRA 1X2EA 3ZQ6A 4BDTA 3QVWA 1W4CA 2FPLA 3WJ1A 1UKBA 1RQ7A 4BP9A 3E9QA 4DCTA 2I87A 2CXTA 4TZTA 1RHJA 4EY4A 4E6EA 1ZUQA 2PX3A 2WF6A 4RH1A 1OV4A 4NOKA 3ZX5A 3H8JA 1FFXB 1L4BA 4BT3A 1MABA 4X97A 1EM6A 4B0PA 1GQYA 1T1EA 3K0CC 1HETA 1OZHA 2PZEA 3IGFA 3GEBA 3EGOA 4ENVA 5JS2A 3CBGA 1FUKA 1C9EA 3V2HA 4XYGA 5B30A 1ZLYA 3A4NA 3DT6A 3HO8A 4GD3Q 4RY2A 2P40A 4J07A 2DETA 4YCNA 1M93A 1KP2A 4FZVA 2BJVA 4ZK2A 1BYIA 2D0PB 4X90A 4BKUA 4ROTA 3NHSA 1BDBA 4HL6A 2HV8A 2QP4A 1KK1A 3RUCA 2KBEA 1YQGA 4JZKA 5G3ZA 2BRUA 4TKLA 1OB2A 2C4WA 3SN6A 1OWLA 4RZUA 1IATA 4DA6A 3HU2A 3CPJB 3KB6A 3HBNA 2CFTA 2WLHA 1M8JA 2H2AA 1QZTA 1Z17A 1RQGA 1BU8A 1E1RG 1EWTA 4D9FA 3LHDA 4HD8A 3GCDA 1R4AA 4R8VA 4YRQA 2EJVA 3T3HA 2IZ1A 5G1OA 2JJ2G 5LJLA 1QVWA 5FL7G 3CIFA 2FR1A 2ZVZA 2GAAA 3B9PA 2CSUA 2FSVA 821PA 1EGQA 4DR7B 4Y1EA 2RCVA 4F8JA 2YS8A 3NB0A 3DMTC 1K7YA 1NW5A 1G7SA 4PRKA 4R16A 2Q4OA 1JHAA 3GT7A 4M87A 5LCXA 1WBDA 4JI2B 2DJVA 2YNMA 3D3KA 3TBKA 3OUZA 3PZRA 4HDNB 2GERA 2E4VA 3QP9A 3OAAA 2E1RA 4HYTA 4ITVA 5K2OA 3DGFC 4DV2B 3QWIA 4HJRA 4TXLA 1HSOA 2DU8A 4E5NA 4FLTA 3COJA 2I22A 3MLAA 2WPNA 1YCIA 4Y6PA 3GV0A 3AG4C 5AM5A 5HZGA 4O4IB 5FUQA 1T2VA 5ESWA 2VXBA 2HREA 4AD8A 2UUAO 3UXMA 4NS4A 4X41A 2PT6A 3NO4A 5KOHB 4EA7A 2YFYA 4D8UA 2WTBA 3IB6A 2BUCA 4H7EA 5JNLA 1L5VA 2JCSA 4NEGA 1CF9A 3OCUA 4QUGA 4RSHA 1Y1RA 3COSA 4BUZA 3Q12A 3W3AH 4K6KA 2DQZA 3PHJA 3PXAA 1GZ3A 4HDMB 4LVOA 1ETHA 2AMTA 5L3VA 1EYZA 5T5QA 2KJQA 1PNOA 4I14A 3PQ3A 5HW0A 2B2NA 2C2AA 3B5JA 2IX9A 4BKOA 3RW9A 1JB9A 3WZMA 1QFMA 1N0WA 1XRPA 1X38A 1SU6A 3ZZMA 2ODTX 1LPSA 1XHFA 4JR0A 3KE1A 2NTJA 3CE6A 4R2JA 5IBPA 2VNSA 3BIXA 1EFCA 5THQA 4W9NC 4Q6WA 1IXRC 2H08A 3WY9A 1L5HB 4QGHA 2G83A 2OFPA 4ZREA 3IQFA 1EDDA 3K0HA 2VAXA 3V8EA 5TVKA 2AMVA 3PGLA 3LQ1A 1UQUA 1UJ6A 1CKEA 1NBEA 4LZLA 5M29A 2Q6IA 1G5PA 1EHYA 3JTEA 3RH0A 3DHNA 2RGBA 4F85A 1AU9A 3AWIA 3AG7A 3NWEA 1JOYA 3G0GA 5TVGA 1MZFA 3M6FA 1RZRD 1KAGA 4D80A 3KVNA 3NUZA 4GPBA 3LKDA 1SF9A 4RQEA 4R51A 1Q2UA 2WMNB 1DQSA 1F4NA 2XXJA 4WZAB 1EG2A 3EPKA 1R5OA 2H2GA 4YAIA 1W29A 2R5WA 4KGXA 3CLSD 4JROA 3PFIA 2GRJA 2NYRA 1UFVA 3EOZA 2JS5A 2QENA 1PAUA 1LK0A 1VLLA 1V6AA 1TX4B 3A6HA 2F4VB 1IBSA 4XLLA 2W6NA 3JQBA 3D8CA 1ST3A 4PV7A 3C6YA 4KREA 4OBWA 4W9RA 4QSHA 1VCMA 3HNPA 2O8CB 3K1AB 4XB1A 3GVIA 2FWJA 4AF7A 4XVCA 3AB3A 2JI7A 4BBPA 1LUWA 4PXAA 1CQJB 1W0JA 3AHEA 5EY5B 1T1JA 2C83A 2I4NA 2BSKA 4R7CA 1WDWB 5LZ4A 3IC5A 1A8PA 3FLMA 3JCUZ 1ACMA 1GYPA 2B2CA 2YC4C 3PBKA 4EI8A 2FYUH 3IE0A 4KNWA 4K86A 3S70A 1L0LH 1PL8A 1IXSB 1BCRA 3ADDA 3B6JA 3PFNA 2WA4A 2F1KA 2F3SA 3OQBA 5IARA 4HAUA 1J7KA 3IA7A 4GBGA 2CFIA 2ZSJA 2WJ6A 4O2BB 4A2PA 1NQVA 5HZMA 4OXQA 2XA9A 2XDYA 2XCOA 2PZAA 2Y66A 2D1YA 1T24A 3RSHA 5EBMC 3FFTA 3FJYA 1UFIA 2WAYA 2ODBA 4LPKA 3GAFA 4TMWA 2CTRA 3L7QA 4PYRA 5FEMA 4F4UA 4NKRA 4ZYZA 3JZIA 4UZSA 2WLKA 3EIHA 4MUGA 4ZVUA 5L4SA 4GUDA 2F59A 1YNOA 4C4RA 4DAOA 4GLJA 3GVHA 4NR1A 4UTPA 4D6XA 3QO7A 2PE5A 1EFVB 1GEGA 1SCJA 2BEUB 3RIEA 1VQOF 5ESXA 1NQUA 3S3TA 2QG4A 3L7IA 3AX6A 3QYPA 4JZYA 1QBGA 1TT5A 2WNSA 3RROA 1DRWA 4GGMX 4W5QA 1DRJA 2IODA 1ZM9A 2J59A 2BFDA 2P75A 4BMPB 1W9HA 3V7WA 2CMKA 1JEJA 2JAPA 4IHJA 2YX1A 3B1JA 1JDNA 3OGCC 2YHBA 2VDPB 3DJYA 1C0KA 4BO9A 2P3QA 2ZYHA 2WWYA 1GRVA 2IYVA 2N42A 3PWKA 4X85A 3CLUD 3AOEA 2OA0A 2QAGC 4X88A 2XOKD 2Z6AA 4RA9B 1CU1A 2V45A 1ZEJA 1YZBA 1F7VA 1XRNA 4CR6A 5CH8A 4PA3A 2CHFA 2F1OA 2JC3A 2XZPA 1OGYA 2VSFA 1ND6A 4O8ZA 2RH8A 2CNOA 4DV5B 3T5BA 4FDAA 2OBNA 4BNGA 3QJ5A 3WRYA 5FB3A 4I3FA 4AM8A 2CUGA 4NESA 3WLAA 3FTEA 4LYDA 1YDMA 4CF3A 4HQOA 1V26A 4A16A 5TMBA 4PSDA 1BU5A 3VKWA 3FR7A 1O97D 3IR6A 5KYNA 3LXMA 5THKA 3ZDBA 3S1AA 1DQYA 4MI3A 2Z1DA 5F2VO 4TS4A 5A04A 2EFGA 2V3CC 1BMDA 3PRKE 1XZQA 2Q3DA 2HWXA 3QX9A 4A0RA 2Z43A 3K1YA 1ZUNB 2ZRIA 3UTDA 2ZTVA 3JD2A 1UDWA 2H17A 5A1TA 3IBGA 2GUZB 4Z2WA 4UPEA 2ZVDA 2GEJA 4JV5B 1PJ3A 2L6LA 3DV9A 3SG0A 3HSKA 5D3MB 1DV2A 1QIFA 2YIJA 4RIHA 1MSDA 2EW1A 4X1IB 3B60A 1U90A 4JYMA 3TPZA 3HBLA 2DUUA 3G5AA 4F3KA 1OAPA 5F78A 1NI4B 2H16A 1QV7A 3SYTA 2BR3A 1VJTA 4TTIA 1C3OB 2PAFA 4TYPA 1NBHA 4JLJA 1THMA 5LC1A 2OG2A 1XMPA 2OCDA 3ELYA 2BTQA 4TMYA 2Y1WA 1T6YA 3GZTB 5FUMA 3N86A 1E6UA 1N0HA 2VAVA 2WUVA 3HB7A 4CHTA 3P2KA 5IMBA 2I2XB 4FOPA 3U4QB 1KGDA 1J2UA 5F1OA 4OHPA 2FSUA 4XTCS 1SR8A 1CUFA 3HVHA 4EP1A 1S3JA 1UXOA 3NK7A 1V1MB 3JAMN 2YIAA 5DCLA 3I9KA 2VP9A 3UW1A 1VPEA 3FUWA 1TMKA 4CKWA 5D3KA 2RHCA 4G0QA 2F62A 3ND7A 3D8HA 3EQ6A 1OSNA 2J9RA 3G82C 3R40A 2CWDA 4MGKR 5DLPA 2A57A 1YZFA 4R5MA 1EBFA 2QPTA 1AP6A 3LWBA 4AQDA 3LBIA 2IHVA 3FYIB 3QY9A 1O08A 1BFUA 2V7EA 1PGPA 3N0XA 1VQLF 1K7FB 5E1OA 5H16A 1AV6A 1YONA 5C34B 1KF0A 3JQ7B 2BV3A 4QBIA 2G38A 4FZ1A 3VR2D 4P80A 2NQ8A 2FWMX 3ZCXA 4HH3C 1CCWA 4HX5A 3NR7A 1PFWA 3HHEA 3MFYA 2YCBA 3U3KA 1G20B 3DBHB 4ZD6A 4G24A 2JGAA 4H27A 3IR9A 1RKBA 3REOA 1NT2B 3VHXB 4LF6B 2LBXA 3M8KA 1KSGA 4XD7A 1R1MA 2Q0HA 4GBJA 4Z5XA 3RA6A 4Q1BA 3IC7A 5F7OA 1M6EX 4RF3A 5ALMA 1JW9B 4ON9A 3OCWA 3KVOA 4F9GA 3CCVF 3NVMB 5LUAA 5D3ZA 1OHHA 5L3EA 5GW7A 4P9PA 4MCIA 4MKIA 5CLHA 2HNAA 2CBGA 1YDEA 1UOOA 1KU9A 3VKHA 1Z5NA 2WU1A 3DNFA 2CF5A 5KCZA 1L1FA 4FZ3A 2ZR2A 2B1JA 4ZVKA 1YTFD 4W9MC 1UK8A 1CUIA 1O97C 1T8SA 3HYSA 1XRLA 3QUCA 3GFTA 5TQVA 5T64A 1ZKMA 1F4MA 2UYNA 3QBDA 3D6JA 1T3GA 1U7UA 4EPVA 2OLKA 1H8HA 3ICPA 4UOZA 1M8PA 4JJ6A 1KQNA 1X70A 2WNHA 4H13B 3VR6A 6NULA 1E4YA 3LUCA 4X84A 3K12A 3TLYA 4OAQA 3RPEA 4PZYA 1N1GA 1Q84A 2L42A 4LZNA 4DVJA 2ILTA 1AKRA 3WO0A 1RVV1 4DQDA 4LYAA 4IZOA 1SB8A 3NCTA 4FGZA 1KJZA 3K4QA 5A06A 1LX7A 4R05A 3B6ZA 4QD3A 4O0LA 4MWCA 5EQJB 1U9IC 1N6PA 2G5CA 3DDNA 1MOSA 4CG2A 3A25A 4HQLA 2VQ3A 1MAWA 3SBXA 5F2NA 2NGRA 4LIPD 1N4AA 2VDQB 5IKOA 5KZMB 3Q9LA 2IOFK 5IP5A 2VQSA 3DMDA 3F7OA 2UVQA 2Z8YA 4A0HA 3ERNA 4YUZA 2Y77A 4KLZA 3HGQA 4A92A 1OYYA 4R0VA 2QVLA 1KOFA 2M1XA 2O3QA 3U2QA 4AKIA 1GCGA 5F9FA 2X76A 5A6SA 1UMBA 1H94A 5KQMA 3BFKA 4LFCO 1UPTA 3LX5A 5TB5A 5EMJA 3K7EA 4CMKA 2FPPA 4GOXA 1P6QA 2BPOA 3LECA 2ZR8A 1U8EA 3DL4A 1ORRA 4MQFA 3KT0A 5KJFA 1VI6A 2OYSA 4HFRA 3WLSA 4G41A 5G0WA 3FB8C 1Z6TA 4GW3A 2C2KA 1XEXB 4KPFC 5JEEA 3WL3A 2XBLA 4E3WA 5KNLA 3OOWA 3GD7A 4M9XA 4CLEA 4J3FA 1WPXA 1NKDA 1ID8A 3PKIA 1UQRA 3VJMA 1ISJA 5T67A 1YV9A 5DWQA 1KMMA 1R18A 4N82A 4JDPA 2VGNA 2O5RA 1JKXA 2FKXA 1QMGA 3LBYA 2YXLA 1C7IA 3TSYA 2Q5QA 4L22A 4P32A 1NURA 4AZWA 4E46A 1ZGCA 1GQ2A 4BV3A 4NX2A 1NJ2A 1KI6B 3OJLA 1T5IA 3FWHA 3FKQA 3E6AA 3LV8A 1GN3A 3MAJA 4M0DA 1DX6A 3P94A 3EEOA 5KYKA 1QG6A 3ET5A 3LL4A 4OK3A 1AKQA 2GN2A 3VVBA 4ENWA 1ZUHA 2COKA 1YACA 4QBKA 4MUJA 2C57A 1OWOA 2BF7A 2CH7A 1FLVA 2WWXA 3RUDA 5C8ZA 2QEXV 1AR4A 2CW4A 1YFLA 5IYZF 2BSQA 1PUJA 1DGSA 1W8DA 3GJ0A 4GQAA 3F2IA 1W36B 3D6TB 2E3CA 5TPWB 3VPAA 1QF6A 2VDUE 4PG6A 3UW3A 1PX0A 2Q4DA 4TM7A 3FPGA 1WSBA 1H22A 3OX1A 4MCJA 3DM9B 1MJ5A 4CTOA 4DZZA 2B8EA 3O2NA 5ADHA 4YJHA 3WR5A 2PQ2A 3WDMA 1YQNA 1WW2A 1UC4B 2QJRA 2W4IA 1N5RA 3RVLA 2VJQA 5G4VC 3D36C 1WB5A 4G9EA 1WCIA 1DT5A 1OYWA 2MJLA 2DM6A 3K6SA 2O7QA 4WFAV 1QE3A 2D2EA 1CQPA 1Z47A 5I9TA 4BIUA 5A5EA 2QN8A 1WA8B 4KRXA 3E9ZA 2Z57A 1QX3A 4LWOA 1CQZA 1XT6A 1M1YB 2WMYA 2YYYA 1KYVA 2UXDB 3IP6A 1L4MA 1QE5A 2WV7A 1DB3A 1F0KA 3MCWA 2WSBA 3L4EA 4NPAA 1GCUA 1VL2A 4ZHQF 4MAAA 1UBTS 3H11B 4OI2A 2GFHA 2XUKA 4BO1A 2AFIB 2R87A 4IVNA 3IKTA 4IIUA 3CPQA 1H4SA 1G5IA 4MDFA 3RS3A 4LY0A 3F6YA 1ND5A 3PR1A 4TVOA 3IDZA 3GLTA 1RQPA 2H54A 3WK4A 2XASA 3KBBA 2C9BA 2JEOA 3RSCA 4ZCMA 4YO8A 1Z6ZA 1JHOA 6LDHA 4TYQA 3U5ZB 2JA1A 4KO1S 1YXBA 1AF4A 3R7WA 1KOJA 2ZSAA 3CH6A 2CYBA 4KTVE 4PAWA 2PXXA 1Q3HA 2FMLA 2ICAA 3JWGA 2OECA 4BZZA 1YU9A 1B8UA 2PMCA 2ZRBA 1K0UA 2DMRA 1L5QA 2XT0A 1MC5A 2YV4A 3IVMA 4E2XA 4JHXA 4YJ3A 3ONVA 8GPBA 3TM4A 2WDZA 3Q3IA 3HP1A 2P79A 1NVKA 3KEOA 1N36O 1PT8A 1W75A 1XP8A 1UFYA 2HWYA 3WK5A 1BA3A 3ZD6A 2GGSA 2VVTA 3K9NA 1PLKA 2GPNA 2M6SA 5A5DA 3BA8A 3CXCF 4X66O 4UHDA 1LDYA 4MWGA 4KR9A 3C3SA 2EILB 4D4MA 4YYEA 3V1YA 4Q3OA 3U3RA 1V7PC 4R6XA 2I3GA 1CUHA 1BKSB 2Z58A 4Y2TA 1EBOA 1WNFA 3VX4A 4KYIB 1G8GA 3ZS8C 1YZVA 3R3SA 1NR1A 1PUXA 2PWBA 1MENA 4IIYA 2HJHA 1K88A 3FTQA 3ZU3A 4K9OA 2C59A 1LDMA 1T4BA 4IR7A 1HT0A 5COQA 1NMZA 2X9QA 1UJBA 3WIBA 1JEYA 3DXZA 3CNQS 4QE9A 4HF7A 5EMNA 4DBLC 2Q62A 4N12A 3RDPA 3I6YA 3I42A 3GRFA 1ZDMA 1NQWA 1FTNA 4K0KB 1NGSA 1YIAA 2BZSA 1CRPA 5KKNB 1SBQA 3OT5A 1YQ9A 4MGYR 4R5HA 4B3DA 2ZXFA 1ORDA 3C90A 2UVDA 2OO7A 2YV3A 3ZG6A 4TTAA 4HUTA 4PDMA 2XDQA 1CRZA 2XQIA 3ZLUA 1AC5A 3H0EA 1JLKA 3CC8A 4Z7OB 1FS6A 2G0TA 2O0LA 3QVKA 3J81N 5B2FA 1EZ1A 2GZ1A 1V1RA 4FIPC 1VCOA 3L7BA 3N6RA 3OQPA 3VYRB 2Q3EA 1MABG 1ARZA 2VHUA 2ZS9A 5BN4A 3MTEA 1NSFA 3C3DA 1K7CA 1J9EA 3RVDA 1SKQA 4C6SA 1WEHA 1OF1A 5JZSA 1VPTA 3BDAA 1NOJA 4YV7A 2Y99A 1X7ZB 3OZSA 3LO8A 3D7MA 1EJ6A 1WY7A 2IPNA 3WV5A 4DDKA 1DC8A 3UYKA 2BCEA 1S89A 3CVXA 3A9RA 4B3RO 4CH4A 1Y7HA 2O2GA 1C3VA 1RI1A 4EF6A 4FCWA 5FOTA 1V54C 1CP2A 4RAQA 2DPLA 2XVAA 2EFEB 4JF3A 2V6BA 4YRRA 3FYSA 3VZQA 4G0NA 3WLTA 3T5PA 3OFVA 1LSUA 5D00A 3G80A 4K03A 3AW8A 1K73H 4ZYYA 4HPJB 4Q3EA 4CM8A 4X20B 1VC2A 3R3XA 1SELA 3AZQA 2FN3A 1QH1A 1I3LA 2PGAA 5FNVB 5I7OA 1ZJYA 2O7RA 2OTMA 3GVXA 1M2VB 4EHFA 2PSDA 3KZCA 4EI7A 1A7KA 5B58C 2VL7A 3D5EA 2H4HA 3R09A 3J7AC 4CYMA 4UCUA 1HZZA 1MIOB 2PXHA 1SWWA 2PLWA 2BJWA 1SOAA 1EB8A 1VQNV 2LNDA 3F7YC 5MFZA 2GTHA 2P0EA 3C1AA 5BP7A 5FOWA 4PSVA 4L7QA 4PLYA 5EYPA 1TUEB 3KJGA 2BEWA 2FR8A 3WKEA 2PO7A 5FWXA 3FY4A 3EEQA 4CTNA 2GOYA 1P73A 2RHRA 4E1VA 3PIDA 2HNKA 4OY3A 2ZUSA 3NM5A 2VCHA 3OW2U 1V2HE 2HQ1A 3DDWA 2O8VA 4L1KA 4UBNA 4RM2A 2BKLA 3WI7A 4II3A 4OQLA 1XXHA 3EIWA 1M10A 4MDYA 1NTKH 1HW7A 1M8KA 3T1OA 2FLVA 1ZHOA 3RU2A 2ZI9A 4ZK7A 2FPKA 1U9ZA 3A1UA 3FCXA 5LGNA 5CBHA 1VE6A 4GEGA 3BJZA 3WB9A 5KX5B 3QXHA 3IPXA 4ZMBA 1RLGA 1L5YA 1A8QA 1H85A 3VV2A 4DJJA 3WFJA 5K45A 1U0HC 4NFLA 1EDZA 3DB2A 1ZOIA 1JPVA 2D2FA