5IJ9B

Cryo em density of microtubule assembled from human tubb3-d417h mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNHLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 140
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij9B01
4X1YB 5EYPA 5LA6A 4O4JB 4TUYB 4M8IA 3JAKA 4XCQA 1JFFA 2BTQA 5LP6A 5LXTA 5JH7A 4IHJB 4ZHQA 2RHHA 3ZIDA 3JASA 5GONB 4WBNB 3RYIB 5MN4A 5J2UA 3R4VA 4FFBA 3WGKA 3N2KB 1W5AA 5CB4B 2Q1XA 5KX5A 3WGNA 5MN5A 3RYHA 4TV9B 4B46A 5ITZB 4O2AA 4EB6B 3WGLA 4ZOLA 5CA1A 3JALB 4YJ2B 5IYZA 5FNVA 4I4TB 5IYZB 5JCOC 4X1YA 2R751 4TUYA 4ZI7B 3JATB 5CA0B 4O2BB 3HKBB 5JCOA 5M7EA 2XKAA 2RHJA 5LOVB 4IHJA 4TV8B 2RHLA 5IJ9A 4E6EA 5GONA 4WBNA 5C8YB 1FSZA 3N2KA 4X1KB 5CB4A 5KMGB 4TV9A 3VOAA 2BTOA 3RYFB 3M89A 1TVKB 4O4IB 5ITZA 1RQ7A 4EB6A 3N2GB 2VXYA 3VOBA 5J2TB 3JARB 4HNAA 4X20B 3JALA 4YJ2A 4I4TA 3ZBPA 1TUBA 4I55B 4ZI7A 3JATA 5CA0A 3HKDB 3HKCB 4B45A 1W581 5LOVA 4TV8A 1Z5VA 4I50B 4YJ3B 1W59A 4EI8A 4LNUB 4O4JA 5EIBD 3WGMA 3M8KA 3RB8A 4IIJB 3CB2A 4X1KA 2VAPA 3ZBQA 4O4LB 5KMGA 3E22B 3RYFA 1TVKA 4O4IA 5IJ0B 3RYIA 5JQGB 3RYCB 5J2TA 3JARA 1W5EA 4O4HB 4X20A 5LP6B 2VAWA 5JH7B 1FFXB 3WGJA 3VO8A 4I55A 5BMVB 4U39A 3HKDA 4FFBB 1RQ2A 4KWEA 4U3JB 5KX5B 4YJ3A 3C8LA 5JVDB 4O2AB 4O2BA 1SA0B 3HKBA 2R6R1 1W5FA 3JAWB 4O4LA 4ZOLB 4F6RB 3E22A 5EIBC 3UT5B 2VAMA 5IJ0A 3V3TA 3HKEB 3VPAA 2GVIA 5LP6C 5EZYB 5C8YA 2Q1YA 4X1IB 5JQGA 3RYCA 2XKBA 4O4HA 5LYJB 3VO9A 1Z5WA 1FFXA 4DRXB 5EYPB 5LA6B 5BMVA 5IJ9B 3N2GA 3JAKB 1JFFB 4U3JA 1W5BA 2BTQB 5LXTB 4DXDA 1OFUA 2RHOA 4ZHQB 5JVDA 3JASB 1SA0A 5J2UB 3HKCA 3JAWA 4F6RA 3UT5A 3RYHB 4HNAB 1RLUA 4I50A 3HKEA 4LNUA 5MN6A 1TUBB 4EI9A 5EZYA 4IIJA 4X1IA 4EI7A 5CA1B 5LYJA 4DRXA 5FNVB
chains in the Genus database with same CATH superfamily
2QTSA 4AC9A 3CSXA 4ZHQA 1ONBA 3UUEA 2ZBUA 2O3UA 5L3QB 3CXHF 2KG7A 2PQ2A 3QEMB 1NXWA 2YCBA 4MA5A 5JG7A 5ALEA 3VRHA 1RSOA 1BXKA 2DT4A 2OQ2A 3UV3A 3GJ5A 3RKRA 1NQOA 4P4TA 1BVHA 5KHJA 3I42A 1QC5B 3ABOB 3KVYA 1I3OA 3TBHA 2RGAA 1NI4A 3SZUA 3SDLA 3TKYA 3DL0A 3CZ5A 4UU7A 4G9BA 3NYRA 3OTGA 2IYLD 2GHIA 1F6DA 1YZNA 1B6QA 3ILHA 1SK8A 5A4FS 3UAXA 1TM2A 2G5PA 5EJAA 2F1KA 5EG5A 5CJJA 1JFFB 1ZJWA 2O19A 4DKJA 1BCSB 4PV7A 2GN2A 1TQ6A 3JAWA 3LBIA 4RK1A 5CFRA 4F04A 1TCCA 4KPUA 2OESA 2A4KA 4LV5B 2I2WA 1OX4A 2C9CA 4RY2A 1W34A 4BAYA 2H07A 2IW5A 2BEUB 5EMHA 1NN0A 3C9SA 2BBTA 3TQQA 3LLVA 3DZIA 4C0AC 1HNZO 3NTLA 4EYQA 4IOKA 2QTVB 1JNXX 3HLKA 1YD7A 4MLCA 2YJZA 1M2WA 4LXQA 2ACKA 3NV7A 1RQ7A 4CL8A 1BHO1 2GB4A 5L3GA 1B3RA 3CUEF 1P2DA 2Q9CA 3DMRA 1W48A 1UXHA 3LX5A 1UJMA 3CLRD 1CUHA 3WDLA 4Z53A 4FE4A 2HW8A 2BOVA 1U28C 3OLXA 4N5MA 4ZV7A 1N2EA 5A3SA 1XG5A 3QA9A 3AHEA 1VFNA 2A84A 4R7ZA 2IZ5A 4QNHB 1VQ6F 4J7AA 3CRAA 4GVPA 3KR2A 4NBWA 4Z0HO 1O58A 1O97D 4OUDB 3PUIA 1YZHA 1M72A 3FNBA 5CP8A 2A8YA 1DBIA 5AXAA 3R76A 5LGUA 1XTSA 2J6HA 4D4GA 3PHGA 4Z86A 1P0IA 4I6EA 4YMHA 3K0FA 2H3EA 4OHBA 1XJCA 3L18A 1L5YA 4EW2A 2Y9MB 3BRWD 1G291 2WJ3A 4KAXA 4R0NA 2FPGA 4LTDA 1BCCH 3H42B 1QB7A 1JPJA 4DDWA 1JJAA 1GGJA 3H2YA 4XVRA 3CB2A 5KHOC 1DIOB 3GQBA 4QRIA 2UYPA 3H2JA 1V1JA 5K1PA 3OJLA 4I9GA 4DCJA 4CN8A 2HMVA 3RSFA 1YQ9A 1XRJA 1XRMA 2AZ4A 4Q9HA 3TJMA 2ODTX 3EIWA 2D2CB 3AUTA 2A9FA 3S44A 1X9GA 5I4IA 4BIUA 2ZR0A 3EN0A 3F6YA 1SEPA 2XNJA 1QQ6A 8LDHA 5G02A 3W8RA 1VI5A 1SCQA 2PXCA 2CKDA 1D2RA 5CBFA 3CMAF 1SCKA 3P52A 4K2AA 4WZBA 3ZJTA 2FB5A 3KJFA 4JGBA 3G7NA 3EEYA 3CCVF 4J2OA 1EUYA 2DKOA 1PDOA 1QLWA 4PYKA 1I5RA 2PUDA 1PHPA 5FNVA 4Q7JB 3KVOA 5BUQA 4JNKA 1O8BA 2WUGA 2NU9A 3U3ZA 5HQ3B 3OR7C 1JXOA 1T1JA 1XKXA 2HA4A 5ES3A 1UAAA 3CJHB 1ZM2A 3K0BA 1DUSA 2P0YA 2FAXA 4FWBA 4EJSA 2CUGA 4R31A 3OT1B 4XH9B 3VO1A 1VQLV 4Y2PA 2PUHA 3LBFA 5E1BA 3D43A 5DOVA 2J33A 2RBGA 4UAJA 3HNPA 4MZDA 5FBZA 3I55F 2H17A 1H2RS 2J7KA 3R3VA 4CGYA 3H1AA 3BJRA 3CW8X 1Q0LA 5J2TF 3EULA 4NICA 3IV9A 5ER6A 1KZ9A 3UHFA 1SRYA 3CR8A 1Y1LA 4N6GA 2IP1A 1RZUA 5JCPA 3N8DA 1ADJA 1SERA 2GTPA 3VSCA 4LIPD 4FINA 5CIYA 3T4ZA 2ZB8A 3ASZA 3NUZA 1T3LA 4P5PA 3P3PA 3VC1A 1L4KA 4BJ5A 2HWYA 4B2IA 5LNK6 1AR5A 3GLTA 1JBEA 3VAAA 1CR6A 1AKRA 2O0HA 4BLTA 2CNWD 4MW5A 5DECA 2QM8A 1I8TA 3OX3A 3DAHA 3ITNA 4V0SA 3FIUA 2UZ4A 4LQDA 1FYVA 5EUMA 1Z4KA 3HXLA 1JSZA 3PIDA 2FYUH 2BBOA 5FHQA 2BE3A 3B51X 3HCAA 2AGVA 3SXPA 2DG2A 4MVOA 4U6SA 4UHKA 2FSUA 4CLDA 4ESEA 3W8FA 4R2XA 3TKAA 2CJPA 2P62A 2EG9A 4E2WA 4KE7A 5FPKA 1NYLA 2FR0A 4KQJA 4AWAA 1OROA 1IQUA 3UGKA 3CM0A 4QU0A 3D7SA 1YJ9V 1IN4A 2PX3A 2MU1A 3D1VA 2PD3A 4LGMA 4J11A 3PFWO 2YMQA 1NVGA 1VSUA 4A0FA 3P0ZA 4P1ZA 1G38A 2QXYA 4BFTA 2P2ZA 3E5HA 4H4CA 1BCRB 4ZTUB 2QK4A 1ZR4A 1ZOLA 3NYIA 3DLIA 3ZCTA 2XNDD 4MJLA 2W83A 5EN4A 1SIOA 2P11A 3WLIA 4D9HA 1AMOA 1Y1KE 3X1XA 1NW7A 3CW9A 2QU8A 3HZHA 4GKVA 4ECAA 1IV2A 3GMTA 4AM8A 4XQCA 1REQB 4DCNA 2EL7A 1MZVA 3DYIA 3THXA 3PAFA 4GPZA 5BYJA 1YA8A 4NPAA 2OCAA 3EYWA 3BCCH 4P4SA 4OHMA 3DAOA 1GN6A 4HAWA 4U7DA 3VOSA 1JYEA 3OKPA 4IAOA 1L6RA 2DQKA 5IZ4A 2C61A 6CHYA 1MG5A 2GYWA 3ZS9A 1I6MA 2OBLA 1GTVA 3T1VA 4IVQA 1BQEA 3EE6A 2YYAA 4BZPA 3SF8A 3ETNA 4ZYUA 1Z3IX 4FFNA 4PE5B 4CGZA 2DFNA 2IZ0A 5CM8B 4A5OA 1NL3A 2WWXA 5DN6A 1TX4B 4ZAFA 1JEYA 1NVUQ 5B7GA 1WV1A 3K8QA 5B58T 1IZZA 3A4YA 2PPLA 1AA6A 1JX6A 3CNLA 4AJEA 3LT0A 1CJTC 1T2CA 4PXYA 4RC9A 3NJ8A 2HIHA 1YAJA 3VR3A 1NW4A 1N1DA 1W88A 1WKBA 3UJ9A 1H48A 4I9FA 4L57A 3FOZA 3ZQUA 1SKMA 5CXUA 2BGLA 2GLTA 5KNDD 3AVQA 3INYA 1MAVA 5DOZA 4CC5A 5K3SA 4TX1A 1BJKA 5ER9A 5TQ0A 2BTQA 1RLGA 3WRVA 3GL9A 5J2UA 3CD6F 6AT1A 3A3NA 4P38A 3MJHA 4WZZA 1CEZA 1T9GS 4IHJA 1RM1C 1GTMA 1UKCA 2GSWA 3CWQA 1DL5A 3ABIA 4HH0A 2QF7A 1N1MA 1MB2A 2PZSA 3OU2A 5IAKA 3ASOC 3ZP7A 3HP7A 2VF5X 1D7OA 1JJFA 2PGXA 3U7IA 4NDZA 4X54A 1G6HA 1NU1H 3CYPB 4POOA 3EFFK 1L3BA 3ASNB 2PYDA 3ZXSA 3J81N 2UZ3A 1IC6A 2W93A 1O6GA 2AB0A 1YASA 5EE0A 2W4IA 1LB1B 2VNSA 3VR1A 2ECFA 5D5HA 4FPPA 3TL2A 4XD7A 4RTOA 1YR8A 2XTNA 3P4UA 2EG5A 2P22C 1YJQA 1PNOA 4I4IA 2VOJA 3UK1A 5I47A 1P81A 2BGUA 4OLHA 1UP7A 3JQAA 2R9AA 1E3TA 3LDAA 4MMZB 4DJAA 4MWSA 1O94A 2A0WA 4L5JA 4DJDC 4KVFA 3U3KA 3K8OE 2F93B 2P69A 3S0HA 1BE1A 2VQEB 3R0JA 1OBOA 2P2CA 2L0XA 4ASUA 2XT9A 2WSYB 5DPMA 5A2QM 4X24A 1QX3A 4RYLA 4R5HA 1RDFA 5CT8A 2I2AA 4Q00A 1RRPA 3F2IA 4L7VA 5DYIA 3PQ7A 3TNJA 4ND2A 3D1LA 2PX4A 1J0BA 1KQFA 3KHSA 1VE6A 2RGXA 1NULA 2DWOA 3THWB 5HCUA 2NXNA 1EBUA 1UF9A 5ALXA 1AOXA 1NTOA 4HN9A 3BZUA 3DE0X 3KOWA 1MOFA 3LW8A 2DPHA 1IG3A 4IDPA 2LJ2A 1EVIA 4TROA 3FFTA 4HSGA 1Y6ZA 9MHTA 1M1YE 4HMQA 4TYQA 4Y0NA 4A7PA 3WWEA 4EHIA 3RUCA 2BYTA 3DOOA 5JAPA 1W0KD 1XLTA 5KJ6A 4Z7OB 4TSFG 1DB3A 4BU1A 3ISTA 2B99A 3KJGA 1EK1A 4OPMA 4JXXA 1QO0D 4FZ1A 2FCRA 4OXRA 2J87A 3OF3A 4D3DA 3KZMA 4Q7EA 2BEVA 4ZAVA 1CRQA 5F1KA 3ENKA 4MUNA 1NSFA 1KUQA 1UBSB 3DZ8A 2CWJA 4MROA 2KG4A 3F74A 1NKDA 3D81A 4EG6A 2I03A 3NWJA 3EGEA 4U3JB 3FCSB 3MQWA 2PLNA 1QBGA 3Q3JB 3MHHC 4Z4FA 3E22A 4CCSA 4AO7A 5AVXA 1B6TA 4MQEB 1XZFA 3IUPA 1LX7A 4IRMA 3UOGA 3IA2A 2WM3A 1FFTB 1DKOA 1E1QG 4EI9A 5J4HA 3BMQA 2I22A 2MINA 4X64B 1GA4A 4K26A 2EYUA 4G1VA 3FDZA 3CZQA 2BWJA 5HTOA 1UFYA 4UU1A 2H2FA 4QGSA 3ACDA 4GMGA 4MRNA 5KOHA 4TV8B 1Z3CA 3OJEA 3E7XA 1NTZH 3P5SA 1VIVA 4HNSA 2NYUA 3E2EA 4LYDA 4DR3O 1S9DA 4BX0A 4PPQA 4JASA 5BUCA 1W19A 4J1NA 2H7YA 2OMEA 3I34X 3D0QA 2IM9A 2HLNA 4E4EA 3IVAA 1AX9A 4MJXA 3BQMB 3I56V 3NATA 8ATCA 4EQ6A 3LNCA 3UW1A 3MLEA 1GQOA 4JC0A 1V25A 4O2BF 4PG5A 2V59A 3V4PB 2IZOA 1YFLA 1WIWA 4UFPA 3GRPA 1RMTA 6PFKA 1YZUA 4IJ5A 3KZXA 3D0RA 4OVKA 4MQFB 2ZYIA 1RQXA 1PQUA 4JI8B 1UODA 1WUJS 1U3FA 4IUCS 3MC1A 1G5HA 3C15C 3OPXA 1F9AA 3WL6A 2JCXA 3CG4A 2NZYA 3EIEA 4MEAA 1VQ9F 1ZLYA 3O31A 1DKMA 1MMMA 3NOVA 4TXHA 3LBNA 2ONJA 4CKXA 3NVMB 1CXZA 5K4HA 3W5BA 1TAHA 5B7QA 2XRFA 1X1AA 2VKQA 4QUEA 1ZJ5A 1JV2B 1XQWA 4NENA 3LSYA 2WSMA 1E1QA 4OGWA 2EQBA 4FKZA 3RIMA 3NGXA 4CIXA 1KO8A 1NM5C 3N4YA 3WG7B 1N5DA 3AX6A 1EXNA 3RVSA 4HGZA 3T1HO 3K0GA 3HO1A 1DO8A 3DJFA 1IVSA 2RCYA 1G7RA 3HFGA 1PJ3A 5EKDA 1QHHB 3CJRA 3JQ6A 3A6ZA 2KYRA 1HA3A 5F3DA 5C1IA 2UV8A 1J5PA 2GNAA 1PWHA 5EMKA 3K20A 2EFYA 1ZD1A 1IUNA 3LH5A 3ZJ4A 5C18A 2FGJA 1E99A 5HDQA 1YRHA 5IS2A 1Z2DA 3ANLA 3AERA 1N2SA 4UJ5A 5ANRB 4WOJA 3ID6C 1E3DA 2JAUA 1IQ0A 3VKWA 2BE9A 4LVNA 2HUPA 4ARCA 5HRUA 3MOSA 4MRAA 2ZRGA 1NHWA 3G85A 2W6ID 3KWJA 1F0NA 4AKEA 3HKCB 1RHRA 4G4ZA 1TYBE 3GCZA 3OE7A 1J4AA 3Q5DA 4RQAA 1GN9A 3FVWA 4UD2A 3S70A 3L2OB 2O2DA 3USES 4IINA 2NTNA 1K08A 3OKCA 2WNSA 4N18A 3DXRB 1NVPB 1GZ4A 1QR9A 1QH0A 5F2NA 3STXA 4B47A 2HA0A 1DRUA 2Q6KA 1PFVA 4MQMA 4PLHA 1WMDA 1KMHB 1IULA 5D3MB 2ZIGA 1LBIA 1KF0A 1XLVA 2M6YA 1AHPA 4IF4A 2OV4A 2YX1A 3DDCA 3GLIB 4PI2A 1XNQB 1AN9A 3QK7A 2OSBA 1QIEA 3BTUA 4FB4A 4GE0A 4TZTA 2C0PA 4PD4F 1XEXA 3TW6A 3ROXA 2JJ1G 1N0WA 2I4TA 1BEEA 1Y3CE 2O3JA 3OHMA 4U63A 4LPKA 6NULA 2WVJA 3MDOA 5DLQC 1AI5A 3ASUA 3HM2A 1YVRA 3GFTA 5EP2A 2XDQB 3FF4A 2BFEA 3TZBA 3W7UA 1XSEA 3CX4A 3NC1C 4M0EA 421PA 1Y7IA 3HKBA 4ZVOA 4C82A 2YCLA 5DNWA 2AN3A 5B58C 5JROA 4HEQA 3TOZA 4LRQA 4E07A 2FW1A 4MKXA 3M5WA 3TSZA 3BMOB 5D7BA 5CDFE 2C98A 3PA8A 3W8NA 1PXWA 3HBMA 4OXXA 1VE5A 4L4YA 2MHCA 4M76B 1FNSA 1PL0A 4WCVA 1EWRA 2BCCH 1OA0A 4N54A 5CBPA 1ZD3A 4MV1A 2X6RA 1B8OA 4RFSA 2V8BA 4U2BA 4GKAA 1VPLA 3T9DA 2JVJA 1CX9B 1RJFA 1PUJA 1SZJG 2FZEA 1N6LA 5HMMA 2O7SA 4RJIA 5BWMA 2C8JA 4F7WA 1E1KA 1QORA 4KXQA 2WHYA 2A9OA 4CTOA 4CV3A 2Q73A 1RZVA 1IVNA 3A36A 2FSVA 2FSFA 5M5BA 4AZ0A 4AMGA 1JLLA 3SE0A 3SFZA 1EX6A 1QWOA 4IDFA 1MF7A 4PDVA 3ZBTA 5FFFA 5T6MA 4B35A 2AS0A 3ZK8A 3KQQA 5ICEA 1DG9A 1O96A 4MW2A 3W9SA 1CUGA 4LF7B 5EHZA 1GSOA 4QOHA 4PGFA 1CZNA 1R8QA 3PCRB 3OFNA 2BF4A 1L7OA 2UXNA 4CH3A 1XCLA 4Q1BA 1ELOA 3DOHA 1AJNA 3SPGA 2Y69C 4DIMA 4R81A 2O1EA 3CH6A 4D9GA 3GZNB 3CONA 4GZ5A 3KELA 2VK2A 5KQRA 1I24A 4BQFA 3C7AA 1YEWA 1U7XA 2VTEA 4RYDA 1Z6GA 4JI3B 4EFLA 1G3MA 1RR6A 1TGOA 4MQ6A 3HY3A 1VXRA 1Z82A 2GO1A 1T6BY 1NLZA 4F92B 2KKWA 5EK0A 2EFJA 4DZTA 2AOTA 3TUIC 2I6FA 1IY8A 1OFVA 2AIZP 3HZZA 4NBVA 4RVDA 1NVMB 3K09A 5KYWA 2I99A 2X8WA 4C2BA 1IFXA 1XWFA 2RAFA 3ZTTA 3DF9A 3AG1B 3EEFA 1ZIYA 3EG9B 2MSEB 1M2VA 2RC6A 2QD2A 3L1JA 4MVJM 2NX2A 1DTWB 2Z01A 3E84A 1VLZA 1Y9ZA 4HADA 3KT8A 4XSVA 2P6PA 4OJKA 3VPXA 3TD2A 3R9XB 1ZJ4A 4F1KA 3RQSA 3P0RA 3MT7A 2IU3A 5B1YA 3EGOA 1TB4A 3ZCQA 1NJ5A 2NPOA 2JLZA 4TSKA 1J8QA 1Q17A 4LNHA 5IWAO 4EMUA 1NH2D 4JTCB 5AVQA 4CNQA 2Q5ZA 2ARKA 2LDBA 3VPSA 1RTTA 4DR4O 5A0FA 5A2QA 2Q7EA 4G0NA 4W1SA 2Q2NA 4XDLA 3NPMA 4O2AF 2XE7A 2YZGA 4OQDA 3D6HA 3DLPX 1WTAA 1QPBA 1X7YB 1DZIA 1CNEA 4QAJA 3PITA 5JISA 1VJRA 1IWPB 3T1QA 4HNVA 3ZH9B 2PZ8A 1GGKA 2YOHA 4B08A 3IALA 1ECFA 4WZ6A 2WIFA 5LZ7A 1VYUA 4NYIQ 3GC6A 4D3SA 1R2QA 3DOUA 3PC6A 1YZQA 1R5JA 2XGSA 4QDUA 1H8HA 2D13A 5TB5A 1XL1A 1ORVA 3RYHB 3DZJA 2EX0A 2VHJA 3P9CA 2Y0BA 5EPUA 2ATXA 4M1EA 4V1CB 3LX8A 5ECGC 3L7CA 1BMFA 3HPRA 4EATA 1VJ0A 3TX2A 3K57A 4M1YA 5FIUA 4ZZIA 1KBOA 5B37A 1KH2A 4RVUA 3HTXA 3EUFA 3CRNA 2PMFA 3IFSA 4PSDA 3C39A 1PRYA 4RPKA 4KN9S 5EKTA 4CH6A 5KTYA 1YL7A 4OP2A 4LDNA 1IOVA 5LU8A 1OSNA 3J7AR 1E9SA 5LUBA 1CW2B 2C8LA 2HMUA 5KPJA 3LCJA 4G0XA 3UQ8A 2B5OA 1W4RA 4CM4B 1W1UA 3BQ9A 4HXGA 3L4BA 1YCDA 2A0KA 1IEXA 3CUUA 4Q0MA 1YDWA 3JYPA 1VPWA 3OX4A 1MH1A 2IL1A 2VPQA 4J6EA 5IVPA 2PRIA 3OETA 3ZN2A 4DV3B 2BH2A 2PAAA 5CVUA 2RH9B 4GKBA 3SYRA 2QLTA 4X41A 3O0DA 4K3AA 5DN6D 4FONA 4QECA 4QPNA 2BFBB 3SS9X 5EJEA 4NMMA 2A7XA 3BA6A 4IMIB 4JYCA 1UBLS 5FEMA 4GOXA 5ELLA 2QUKA 1E6LA 3ZCVA 5GONA 1QU7A 5C8YB 1VQKF 2TECE 5CH5A 2AMJA 1J9ZA 3P8ZA 4QDKA 4Q7KA 4I7EA 2H8EA 3EQ6A 4HVLA 1KVQA 4HT3B 4QUJA 3VR3D 3FXAA 2D7DA 5TLSA 3OZIA 4TYWA 2ZJFA 1H8EA 3QU7A 4RTKA 4DCCA 2ZB7A 3NNSA 2CYBA 2FPIA 3HPLC 2FZKA 3KT6A 4M1QA 3L72H 3LUPA 2B9EA 3ZWKA 2P6YA 4GSLA 3KV1A 2PNFA 4E5KA 2SHKA 4F3YA 1J8YF 4C7JA 4YT4A 3QE3A 1E2LA 1XMQO 3E61A 4ZIRB 1ZOPA 4LWPA 3FUUA 4F5YA 3WLFA 4YO8A 4ERXA 1V8OA 4IOJA 2GVNA 1J5EB 5FULA 4AQDA 3SYKA 1I4LD 4HPXB 4CF3A 3ADPA 3BG5A 4C0BA 1VG8A 4O6VA 4DIFA 3H2SA 1HE3A 2QN7A 1F2VA 3V8MA 2LZ0A 4AMBA 2CLSA 2Q8QA 1NJIH 5GM1A 1M93A 4OA8A 2WJJA 1XMOB 1XZGA 1V11A 5AQ1A 2BEWA 2DERA 1GQFA 5BSKA 3D3KA 3BWXA 1S2IA 4Y6OA 1QLEB 2ZVJA 4H1VA 2X6AA 2GZAA 3IUNA 4X9QA 2R44A 1KR5A 2FXIA 4OHYA 3AGPA 3VPGA 3Q9NA 1VPTA 2VJLA 2VVTA 1B3QA 1GKIA 4DQ0A 4HLUC 4KR7A 3CRZA 4X63A 2Z56A 4M89A 1NR1A 1XCMA 1O94D 2P9GA 3MYYA 2NMUA 2LP7A 4TMTA 2FWPA 5DGDA 1BU8A 3NMUF 3GJSA 1XTBA 4URXR 1Z7WA 4ASUD 2IIVA 4PRYA 4V2IA 2JLXA 1JWAB 1ZUNB 2AQKA 1MH9A 2Z58A 1NI5A 1WP7A 1USVA 2DW4A 5GV7A 4Y2UA 2HQ1A 1E66A 3WPWA 3EGXB 1PLKA 3SJAA 1YFZA 4Q6WA 5HS6A 4R9VA 1Q22A 5JCOA 1EG7A 1V0JA 4KO2S 3DO6A 3TXYA 4UOZA 2QX9A 5JBQA 4FBGA 3APQA 3NBUA 1W59A 3N70A 3G2IA 4FLWA 3DMFA 2PZEA 1K6JA 3U31A 4HDCA 4LFCB 3IO5A 5JJBA 3DMNA 5FDFA 1P80A 1TKAA 4DG5A 2WBLC 3T7JA 2ZSFA 4C21A 1F4MA 4Z2WA 2WPDG 5EIEA 2H1WA 4GMXA 4LQCA 3ZV7A 2LW1A 1DIRA 1GDTA 4NQZA 5KREA 2ZDIC 2WJYA 4TOIA 4DR1B 3DEAA 3FBAA 2DTEA 3ZX6A 5CNMA 4B75A 1U0GA 5DHSA 2FUKA 3KXKA 4LF8O 4GDMA 2VYQA 1OLUB 4LYGA 5E1MA 5DE3A 2ZT5A 3WLNA 2GPJA 2E49A 4D6YA 3VOAA 3C1OA 4HLNA 3I83A 1F6BA 3WSVA 2JCSA 5SY9A 1HEIA 1W581 1JECA 4YCDA 2J5BA 5HIKA 2R6CA 1IBKB 1G21E 1Z4QA 2QT0A 4RLFA 4LKRA 2FQ1A 1G3RA 1C0KA 1J97A 2WTMA 4D4HA 4DUZB 1N8KA 2C2HA 2Y68A 1WBBA 3SPXA 1QVGU 2JFZA 4EG7A 2FZ5A 4E4RA 3M70A 3DDSA 4QFBA 1ZH6A 3NXSA 2ZRJA 1MIOA 1VG1A 4B83A 2RHOA 1O0CA 4TKUB 1UFOA 5KNDH 2ITCC 1BFUA 3DYBA 3HJNA 3CSDA 1QQCA 4PWZA 4R69A 1X7ZA 3PHIA 3A05A 5KNBA 1PYDA 1X87A 3MRTA 4G1UC 3R4VA 4JNCA 1H2KA 4KJXA 4DAOA 3HB7A 5NLLA 2EQ5A 4GX5A 1KYWA 2G09A 1T35A 4ODIA 4MVJG 4OXQA 2XVYA 3K3PA 4DIEA 4HUTA 3HWSA 2PZLA 3C4JA 5LSAA 4MI9A 1V54C 4JBWA 4PC1A 3N0XA 2WJVA 3KLPX 3TB4A 2DSNA 2OBMA 3CURA 4YHBA 4F2WA 5K01A 1R4ZA 2JGIA 5LDGA 4S1TA 2WFLA 4B4DA 2FQQA 1YF3A 3ZE0B 2AJCA 1ULUA 2WI8A 3Q2OA 3FTPA 3V4LA 1O57A 3T5GA 4KQIA 4E31A 3PUXA 1ZH2A 1Z07A 3W3AD 4DSTA 1MKYA 1MOSA 3H2BA 1ZUIA 5EEHA 2Q1YA 3HU5A 3KJIA 4CZ2A 3TETA 2C9OA 3A6EA 3C0KA 1R64A 3AEXA 3NTUA 3T5DA 3OG9A 2ZRDA 2K7FA 1GRVA 2Q4BA 1V7PC 1OXSC 4BY9E 2R6GA 2D5IA 3L3BA 2D0DA 2Q49A 5IZCC 2WFAA 4EB8A 4BGDA 3JVHA 4K2HA 3G3EA 4DB4A 4IIJF 3O85A 3JSNA 5DHFA 2B20A 2W70A 3V8NA 4J0DA 1FTYA 5HY0A 4L4ZA 3BHNA 3UJAA 1KJNA 3KWMA 1MXFA 3LUGA 1SETA 1L8XA 1Y8CA 1PSZA 4CKCB 5DYNA 3D36A 2Q2VA 3TDMA 3WK4A 1KYYA 5T4BA 4UNSA 3AQIA 2R8OA 4XGIA 4PA9A 1KKUA 2IF0A 4ND1A 3EWIA 4BT6A 4H7HA 2YDXA 4FSXA 3UO2A 3AEUB 2O05A 4UU0A 1CTQA 1YRYE 2AVNA 2Y27A 1YJ9F 1KL7A 5KYYA 1YZ3A 4CEIA 3VPHA 4NXMO 3Q3IA 1X7XB 2QKYA 2H0QA 4CM8B 3CN7A 2NO0A 4QU5A 4Q3DA 1V16A 4HK4A 1E7WA 5DN9A 1IOZA 4AQ7A 4IZ6A 1DC4A 1WCXA 3OE7D 3RRMA 1MJHA 1BYIA 4LYAA 1OCRB 3TAUA 3OIDA 1MAAA 3DQZA 2WOOA 3OU7A 2UUCB 4ND7A 3G2PA 4BX3A 1HE2A 4U2FA 3SF0A 2ISCA 3CEJA 4LDRA 3CCJV 2D2VA 5L3DA 4XR4A 5AOVA 3CZ4A 1F2UB 3M3PA 1XEQA 3W2FA 1RWPA 4AMZA 1AQNA 3I0NA 2BGNA 2IHZA 1ZD4A 2K2WA 3DTTA 2QX4A 5IFLA 3AKCA 4GF5A 1RVV1 2GLXA 3L8MA 3SJ7A 1AZTA 3VKHA 2DWDC 2OOKA 2RARA 4JENA 4D42A 1NMEA 2XJ4A 1OU4A 1X1DA 4LFBO 2PV0A 2W6PA 4O8CA 1SKBA 2ANBA 4DREA 3GJXC 2CLDX 4HVAA 1SUPA 2ILTA 5HXAA 1N5RA 2G63A 1U5AA 4D0LB 1ILWA 5DNEA 4C05A 1M57C 2AFIA 2P75A 5K45A 3HY4A 2XKAA 3KIZA 2QG6A 1XHLA 4X1KB 1CIPA 2YXZA 4RAQA 2FTKA 1ESNA 3VA7A 4BNNA 3KSDO 1GA1A 1LA2A 2LXNA 3QYFA 1GR0A 2NGRA 1XU4A 2WFMA 1ZLXA 4Q20A 3VR0A 5AT1A 2XUPA 2EFGA 2XBMA 4QYMA 2JIDA 2PS0A 2WHQA 5EIOA 4OSPA 4KRXA 3VH4A 1KVRA 2Y1DA 2BZ1A 4URHA 2G6TA 1CNFA 5ED0A 5F1PA 1TM1E 4LK2A 1XJWA 2E4WA 4FU0A 2V98A 5IXYA 3GDWA 3AEQA 4ZT7A 4JI5O 5K0LA 1AUOA 1HC7A 5BN4B 3ZK9A 4TMWA 4HRYA 2OGUA 1EUZA 3FMFA 2RBEA 1TLLA 4CR7A 2JGNA 3V33A 5K6TA 1IV1A 4TMXA 1I5OA 3TEMA 1GUDA 4J9VA 1WB9A 1EMDA 4B3IA 1UDWA 1R5OA 2P5UA 4CL3A 3PHCA 3Q8HA 4TVBA 3P9QA 4GLLA 3GCDA 3HE3A 2PRKA 1J7JA 3VYTB 4NK5A 1RXVA 1DRVA 1UADA 2G17A 1G2PA 1E32A 3PPXA 3O3NB 4LG1A 4J7KA 2XGJA 3P9KA 4PN7A 3I5YA 4ZZ0A 4ND4A 4RFVA 4FZJA 4KGVA 3N6RA 2DUJA 1WL8A 1ZW1A 3RUIA 3OFND 3EXG2 3W5IA 1L7VC 3AR3A 2QJFA 3WHLA 4RHCA 1GJRA 1RPTA 1W36C 3R6DA 5EVJA 1HH4A 3TVDA 3BXZA 1NM5A 4EGSA 5JZBA 3P9YA 3L93A 5KTSA 1I7DA 3CLTD 1PEDA 2E5LO 3JQGA 4PTZA 4ZYLA 3CCFA 3F5FA 2YW9A 2G1UA 3AJAA 3I09A 1C1HA 3GFGA 2G07A 5D5PA 3GJTA 2N05A 3AJRA 2E82A 2DB3A 4MW9A 4N4AA 4NEQA 3NK7A 4RANA 1LS1A 2VHEA 4KQCA 4UOEA 5K0FA 1SCIA 2X19A 4J43A 2IPOA 4LOHA 3BXGA 3JQ7A 1HMYA 1M3SA 4O4JA 3PKIA 4WNYA 3Q72A 4ZVQA 3L7DA 4YJFB 3GMSA 4IFEA 2B7CA 4QFCA 4BMPB 4D9EA 3RDPA 1QUEA 5JNLA 3MTDA 3ACCA 1MC1A 4K8ZA 1KA9H 5BW6B 2GNOA 4YR7A 5IANA 4U7WA 4BRSA 1I01A 1U8XX 4BVJA 1J70A 2W58A 4R0MA 5DBFA 5JD3A 4YLGA 1EDZA 3HAXD 2JGAA 3QE2A 2HCJB 4DV4B 1F4PA 3EVKA 2OIGA 4EHFA 1ZUD1 4XDZA 1AF4A 4NE2A 3ZJYA 1AQUA 3H84A 5FBRB 1D5WA 1KE1A 3T7EA 1RQLA 5M2QA 3ETEA 3MCAA 5CNIA 5HJ5A 4LE2A 1IZYA 4H1TA 2BZGA 3NHAA 5EIHA 3DKVA 1YDFA 3L04A 2Q6VA 1ENVA 2W0FC 3MFQA 4HBNA 1H8HD 1J25A 1VQ4F 3QHAA 1SVSA 3RN4A 2ZR2A 2JK5C 1ZDMA 3SEZA 2PY6A 1HE1C 3MJSA 3BWVA 3FOAA 1HG0A 3RS9A 1BMFD 4MV0A 4E13A 3IDZA 2EZ4A 3QUTA 1C9JA 3JWHA 1E0JA 2VP6A 5M3BA 2DPYA 3PE3A 3O82A 1AK1A 5EP1A 5FFNA 4HB0A 2A92A 1GITA 2B0CA 1NSYA 4NEGA 3OI7A 4MWDA 4O4LF 5B7PA 4XSHA 1VLVA 5JWHA 521PA 3R4CA 3FBTA 3RVNA 1RXYA 2Q9LA 3MAJA 1VHAA 3OZWA 2VH1A 3V97A 4X97A 1VLLA 5ADUS 5YASA 4MIOA 3OTOB 1ZEMA 3KZVA 3FHJA 3FRJA 1NRIA 3IS3A 3HJFA 4GVXA 4Z99A 2OFFA 4HAMA 3F6SA 5CFZA 2FZVA 1N5MA 4DV0O 4LHVA 2YFKA 3TR6A 2XX3A 4LZAA 1IONA 4H4EA 2B1JA 2F7SA 5GP1A 3O4RA 2OXEA 4HBZA 3NC0C 2QTPA 4DMGA 3B1JA 1ROPA 4ZDJA 3QF4B 4P53A 3QMPA 3B82A 4MUBA 5TQJA 2YEVB 2QTFA 4MV9A 3Q7RA 4DSNA 4N8EA 2ZCUA 1VQNV 4N8SA 5CVDA 3K9FC 1X94A 1IB6A 4FYPA 2A9RA 1OVMA 2W0SA 4DR6B 3F7YC 1H8ED 4KXUA 3EX7C 3GD5A 3QVWA 1OQAA 4Q1EA 3R6GA 3JD4A 3PQ5A 4LHXA 4J6FA 2RHTA 4ROSA 3LUTB 2I66A 2ZINA 6ABPA 1JIUA 2O5RA 3HYRA 4FR2A 3H5NA 3I0ZA 1FUKA 4GVLA 5TJ9A 3VTIC 3ABRB 2NXEA 4HGQA 4XVHA 1R0CA 3GJYA 1N6IA 4TMVA 1E7YA 2G80A 1VMDA 4R8LA 1P39A 3T7IA 2O7NA 4B5CA 4D6TH 4N39A 4HWSA 4B6RA 2IYSA 3T35A 4JXJA 3SLGA 2GBLC 3HRHA 2ZODA 3BXHA 2AFHE 1IJKA 1LQUA 1TAEA 3L71H 4P7GA 2JD0A 3U09A 4ND6A 2VHVA 3GDFA 1NJ1A 4H3KB 1XF9A 4DNXA 2PV7A 1Z0KA 3RYIB 2EKBA 3VNUA 5BWOA 3CRCA 1NMSA 3G67A 2HJDA 2JH9A 3TD9A 1JH8A 4C4SA 2C9MA 4PIPA 1TJ5A 2I8AA 1A9XB 2PF4E 3DE3X 1ZR2A 3W9YA 3WB9A 1A9SA 8ADHA 2HS3A 2NT4A 1QQ7A 1X25A 4LF4O 3HCFA 2Q41A 5E7MA 4IHAA 2BFNA 3DSQA 3KX2A 4UUQA 1W4ZA 3A6DA 3I12A 5KVAA 2IIQA 3NLLA 1KPHA 1V5IA 5JH7B 1NXXA 5FPTA 3N53A 3GPDG 3UMVA 3LDEA 3U1TA 2HK7A 2VO1A 5DCYA 2Y1EA 2J0UB 3NXKA 1G59A 3G02A 1DIHA 1J21A 3RS3A 4BEVA 3HV0A 5DTEA 2VT3A 3WFVA 2Y1GA 1L7NA 4H9GA 4KQGA 3C43A 3DVLA 2DQ3A 5BR8O 1UBGA 2E89A 3AIOA 4MVCA 1W49A 1I0LA 1ZX1A 5ECWA 3OR6C 2PO7A 1G5TA 4M9SA 3EAQA 4BE7B 1OXMA 1E1YA 3EARA 4PTLA 3FD8A 3Q3GE 2PX5A 4C5BA 2ODEA 2HMWA 4PO8A 3C3XA 3TGPA 1GT6A 4RETA 1E4YA 2JA2A 2EILC 1X86B 4R71A 2QJOA 3GVIA 3CCLV 1C4OA 3IBSA 4EHBA 3WIUA 3A4IA 3GLHB 1DAEA 2EKDA 3BCHA 2EIHA 4HO1X 4AY5A 3ZHUA 1JLRA 3HJCA 5C34B 4BIMA 4HB2A 2QI9C 3K0CC 2NV0A 3OZDA 3G82C 4QPJC 1UMCA 4QU8A 1Q82W 2CFCA 2XQKA 3ET5A 5AW4A 1WSBA 5A02A 1Z88A 3NP7A 1QP8A 4JI2B 2XE4A 3OIYA 1NTRA 3KQSA 4Z4EA 1FS0G 4B3SO 3K31A 2ZJ1A 1P3Y1 1DXHA 5BMVF 4FVTA 5IBPA 2PKEA 3CVWA 4XCVA 2X86A 4N6OA 4Q4AB 4K9DA 2EAUA 1ZH4A 4UJ3A 5EZYF 3TZ6A 3WGLA 1EHYA 2FX3A 1M34B 3IHKA 2R96A 3V9PA 2A86A 1CU1A 3GY0A 4EAQA 1Y67A 4CCYB 3CBGA 1N33B 4FC7A 5FI0B 3B8NA 4NBLA 4EJ6A 1GYPA 3LVBA 5EXXA 3T5AA 4K3VA 1DV2A 4TRNA 3U3DA 3K1AB 1X38A 2MR6A 4DF3A 5UKDA 1VQMV 1Z6PA 1FFCA 4NCKA 3EOBI 3U7QA 4AKTA 4YJ3A 2C7OA 1PZNA 1Y1TA 4R4JA 4B87A 3LJKA 3TL6A 3AWDA 2X4GA 4M46A 5KNBD 4ANFA 1U0BB 3TAHA 3FPIA 3UJDA 1QTNA 4PS0A 4Q1AA 2CNBA 5SY6A 3I6ZA 1T25A 2QTCA 2LIVA 3BE4A 1AKQA 5AK3A 3IDQA 1YT5A 3CYFA 1WULS 4C8IA 4XB1A 5LZ5A 4DUPA 1NSTA 2GDSA 2ZROA 2FFRA 2VSNA 3CH7A 2A1TS 5C7LO 4F11A 3CUSA 3D6FA 2CNKA 4WOCA 1BMDA 3S3WA 4IZIA 1Y9DA 2C2WA 1VE7A 4RVNA 4DANA 3EH1A 4CF4A 4LECA 3ORYA 2ECPA 4Y1FA 1UXGA 3GNLA 1RIIA 3LQFA 1FD9A 4MS4A 4CDGA 4BMXA 1QJ4A 5FAXA 4MQUA 3R0XA 3WWCA 3SBEA 1V3VA 3PI7A 4AFNA 1NXSA 1MO3A 221PA 1NJFA 4F91B 2I87A 1EZ4A 1QAMA 4YT2A 1W2BU 2FZ4A 3EJ6A 5KSYA 4Y6RA 5LMNB 3NM4A 5E4FA 3U7HB 1WB6A 5GAJA 2BF7A 5J9PC 3CVUA 3SZOA 4ZHWA 1UMBA 3ZUPA 4HLUA 2X2PA 4O1MA 5HKOA 3TMKA 3O3MB 3U81A 1HLGA 4UBLA 1E2DA 3S28A 3E8GA 5CMLA 1E2MA 2R4TA 3KU4A 1A32A 3K12A 1G8PA 4IJKA 4O25A 1GO2A 2Q4TA 5KTMA 3A1EA 1M10A 1NYTA 4HN2A 3DEJA 3ZEAA 4NABA 4RK4A 4JSTA 1N77A 1LPSA 4AX4A 2IBTA 1BS3A 5L9AA 3HVUA 4AILC 2WOJA 2GOYA 3W7VA 5ENZA 1XTRA 2BFWA 3ETJA 1FNNA 5AVYA 1K34A 1EUCB 4CR8A 4JH0A 2P2LA 1PF5A 1XQVA 2ZULA 1XZNA 2ODWA 4EA9A 1OWPA 2WM9B 5JZSA 4D99A 2DC1A 4FUQA 2QM3A 2JZCA 1H0KA 5A0VA 1V6AA 1V7CA 2R60A 3NR7A 4EDFA 4BNMA 3VUEA 1GLVA 1F8FA 3WLAA 2GD1O 3CQ9A 4W82A 5CA1A 1V4NA 3N86A 2ZDIA 5FUXA 1Z6ZA 3Q5GA 3IKJA 3QG1A 1I9CA 3TX6A 4L28A 2OV2A 1QGED 3TQSA 5CK5A 2DT5A 2VWKA 1WA5A 1GYRA 3F7MA 3GZJA 2HF8A 4E5NA 1H2GA 5CXSA 3LDTA 4WEQA 4FCTA 4IPTA 5G4KB 3OMLA 3SQXA 1DQNA 3IT3A 4OMCA 1Q86W 3K9LA 4QPKA 3T1YB 4V3CA 4BP9A 4P7FA 3DTUB 4RMNA 4H4DA 4UQPA 4G5GA 3HXKA 4M88A 1S4QA 1M75A 2QUZA 5F4ZA 3O1LA 4AJIA 3I2FA 2P9TA 1DUIA 1T3GA 1ZRMA 4G0ZA 4B3RB 3ZI0A 1A3CA 1I4EB 1WP8A 4FFMA 1GPBA 2J3IA 4N0MA 5C3UA 3GA0A 4RORA 2D1SA 4OI0A 5K0BA 3EVFA 1NPTO 1T36A 5IEBA 2M6SA 4LJ4A 4PA4A 3D3WB 1KAOA 2C2OA 5B57C 4HDKB 3PJGA 2IHBA 3BHMA 2CLOB 3G6EV 2VXYA 4HB4A 4Y2TA 5HNKA 4G1EB 3EVDA 5BXZA 2JGFA 1MC8A 3HCEA 1TTQB 1Q0PA 5IJ0B 4TYMA 4FDUA 1MD9A 4Y67A 1I80A 2QMQA 4TSFA 4IH1A 5FI3A 4X7BA 2OD7A 3W3AH 1WA8A 1EAYA 5ESXA 3D1JA 1RYDA 4M1KA 3BAZA 3Q4GA 3VJMA 1FX0A 1U2RA 4XTCS 4E15A 4W7HA 3IURA 5ALIA 3FCAA 1CYDA 4L76A 1R6NA 2EX1A 3PQCA 1KRXA 2ZLBA 3GJ8A 1SURA 1GZUA 3JQBA 5ALLA 4V38A 2R9IA 3H5OA 3ZHBA 1PZMA 1QCYA 1KYTA 1NVEA 4FGJA 1XZBA 2CLLB 3SHQA 4YO7A 2B9VA 2C07A 3VCZA 1WB5A 4TT8A 5CA0B 1NAIA 5L3FA 1NLFA 3EVTA 1BN6A 1KEWA 5IZCA 2W6JG 1UFVA 3K1JA 4L0DA 2H0AA 4GPTA 2ZB2A 1K6IA 4IDDA 3D4PA 4J4HA 2Y67A 3SJBC 4OP1A 3HGTA 2WKPA 2AWNA 4PZLA 4JOCA 3PA6A 5LQKA 3C4QA 1WZIA 4NF2A 2PO5A 3LYUA 2VDVE 3ZDRA 3P9SA 5BNIA 3P9XA 1MABG 4ZPXA 2R4UA 4EARA 5KEIA 2HJSA 4RZIA 5EBLC 4JP5A 3EOAI 3T0IA 1AM4D 3PDJA 1R0WA 2VDLB 4OSOA 2ENUA 3MB5A 2VL7A 3X0DA 5GM2A 3DZDA 3ZZUA 3BE6A 5F2EA 1Q7CA 3GJ7A 1ZS9A 4K46A 2QGZA 2JIQA 2BDEA 2QTLA 2B1GA 4H59A 2EX3A 1BFDA 1NXOA 1WLSA 3TG8A 5AKKA 1LS6A 1UL1X 4NYMR 4YJHA 3L5OA 3L82B 1A5TA 1BHQ1 5K1ZA 1T2NA 2QBYB 4EPVA 4E7PA 5AKIA 3EQ9A 2XAUA 1OCCB 1P29A 2YRWA 3DBRB 3ZNOA 5EAZA 1KBHA 4XGKA 3FBGA 4NBTA 4LWOA 1S89A 3T7SA 3HUTA 1RPZA 4ND8B 4BW9A 4GI7A 1H6DA 2ZTVA 1DPFA 2QL6A 4NJMB 5AO9A 3KQPA 4BFWA 5D3QA 3C6ZA 2QORA 4GZLA 1HY3A 1PQWA 3KEOA 4DHWA 1J0CA 1X7HA 3N2GA 1KBQA 1ZESA 1LPAB 2HSJA 4OV6B 3I6QA 1U9IC 3VX3A 2WM2A 2X5XA 4W9NC 2W6JA 4LJYA 4KAJA 5IYZB 1UKEA 3HR8A 4I08A 4FMPA 2DBZA 2GN8A 3H9VA 4ESHA 1ZCFA 4V0MA 3TRHA 2ZVYA 1IEVA 1J20A 3ESYA 2IS6A 1R3UA 1RYEA 4AJHA 2FFHA 1HZZA 1JQKA 2Z08A 3R3JA 5D5QA 4U1RA 3QVUA 3RVYA 4FIZA 2FF5A 3ND6A 3OM3B 1N8RH 1GKYA 4K35A 5H5JA 5I7FA 5HF8A 5J58A 4JZYA 4KQEA 1RIFA 1JTEA 2RMKA 4M8SA 1R0YA 2Y1KA 1G6UA 1KI1A 3IT2A 1P4JA 5J4KA 2ZQ5A 2CDBA 1R4MB 2G5TA 1E5DA 4UKDA 3B36A 4X5OA 5TRTA 3PNYA 3O8NA 3CR3C 1OAOA 3L8CA 3VH2A 4KO8A 2SCUB 5IH3A 1HYEA 1GCAA 2VIIA 3PSAA 4H6XA 1P3JA 1SUFA 1GTSA 4CT4B 4HS9A 1FUEA 3KB1A 5F51A 3KWLA 1UBCA 2YBDA 4HI0E 3IMPA 3PNSA 5ALYA 3U4IA 5H4GA 3MMPA 2O5EA 1QNFA 2HUNA 1A2OA 4MYDA 3TCNA 5I7HA 3GG9A 5KJCA 2RIRA 2EIJB 1U0RA 4CQNA 4PDLA 3AF3A 1DHRA 1KQ3A 1TKBA 1P7PA 4TTPA 1NATA 2Q21A 3MLAA 2JBAA 3X3HA 4R68A 2PJZA 1QG0A 2AHZA 3L02A 3RVLA 4YN3A 4X8AA 1UOPA 1EM8A 4UBJA 4FE3A 1L4NA 5FEUA 4RSMA 4MUAA 4FW8A 3MT8A 2JJ1A 1NHGA 1XXHA 4ZARA 3SZRA 2CXOA 1HMPA 2WC1A 4NONA 4JS0A 4IJ6A 1P1HA 2P79A 3FUCA 2IGTA 5B2FA 3N2YA 4ARSA 3RTDA 2WB4A 4F60A 2GTAA 1JR3E 4RTNA 7YASA 4OREX 1A97A 3RC8A 2QPOA 1X2EA 2NUPA 1G3IA 2Q0SA 3G0BA 5AHXA 5AI5A 3TEJA 2R0QC 3LZ6A 1ZAUA 4F3NA 2C5GA 4XXHA 3H2HA 3AF0A 3OZEA 1WSWA 4ZEXA 3ABKB 5K2MA 3BBPA 4M0PA 4BB9A 1IEQA 1VA5A 3AEIA 2P4HX 1Y7PA 1JE0A 1XMIA 4N5DA 2AF3C 1JF8A 4IXTA 5CYPA 1JIXA 3FCCA 3QPDA 2OP1A 1XBIA 1T5SA 1GKLA 1FFXB 1IYZA 3ZHQA 4M0CA 3SKXA 1O6BA 3E0XA 3QPCA 2EJVA 2IYRA 1TMGE 4OJMX 1V47A 4HNTA 5HOEA 5IHPA 5A6SA 2W2PA 1PL4A 3DHVA 4M0FA 1BS1A 5BSTA 2RC5A 3TNLA 1OB2A 1KGSA 4CKEA 2DUWA 5MN6A 1K86A 3QKSB 3Q9LA 1E94E 5KA5A 4PHTA 4FZ0A 4CHGA 5AJYA 4F06A 2PUGA 2ZM6O 2W43A 1Z26A 1CY6A 1K9MW 3MWYW 3S2IA 5I8WA 1RM3A 3T0GA 1ECGA 5IAGA 2ZCVA 2BMJA 3C8MA 1C2TA 1Y74B 2Q1WA 2KBFA 3VSEA 5F2VO 3QVSA 4R2LA 5CB4A 4B0PA 1ZC4A 1KC1A 2I4RA 1EGMB 1WPRA 4ILEA 1GPMA 3O95A 3ZE7A 1UOEA 5LYJF 2D7JA 2QRGA 2H59A 4G84A 4KACA 1FFYA 1TF7A 2OHGA 4H1UA 4F56A 3R8CA 1RWOA 4E2XA 2W2MA 3WL4A 3Q7TA 2B83A 3OBWA 2JIMA 1U28A 1X1EA 2XUKA 3G68A 1Z6XA 2H63A 4UQLA 4F2PA 2XPCA 3ZVKA 4HWTA 1JQ0A 3Q3CA 4PX2A 2GN6A 3W5SA 1CJKC 2ZRIA 4HPJB 4KUHA 2CHQA 1MX9A 1DX6A 3ETLA 3UMSA 3LE8A 2F3TA 2LBPA 1NBMG 3AM3A 1JJ2U 4F85A 4OK5A 4IL6Z 4DWWA 5C8ZA 1S5JA 1ZMRA 2BT4A 2XMCA 1BDBA 3BILA 3D5QA 2O0JA 2HJ9A 4OHVA 1RWNA 2O7QA 4N3AA 4INAA 3C8UA 2WDPA 4RAOA 3F9CA 4EPXA 5DXJA 2MR5A 5LOVA 1Z5VA 3CX7A 3HB0A 3JQFC 1L4LA 1P4AA 1XDSA 4O4IA 2FP4A 3E9EA 4LVUA 3HMKA 4AO6A 4YY3O 1GN3A 1AP5A 1KAHA 1USUA 1KD1H 3A3KA 1R6BX 3DLCA 3U61B 1QO7A 3FX2A 1QNLA 4YMUA 2E0IA 1JKXA 3B89A 3A27A 3K9AA 1HV8A 2BDTA 3ND7A 2R7AA 1I5XA 4JU9A 1SKVA 1EEXB 1D1SA 2X0JA 1CHDA 4N65A 3CGGA 3CJQA 4ALJA 3M2PA 2PZFA 1JTVA 4QIHA 4W5QA 2IDJA 1XRNA 4GLBA 1E98A 3JQQA 2WLJA 3LF1A 4PSKA 5J9FA 1IBMB 2EQAA 3C8HA 1WZCA 4PTYA 3O65A 1N2HA 1L7QA 5JU6A 3K4QA 4DCMA 3OX2A 2WD7B 4WXYB 3U4CA 4G88A 4RF2A 4DMCA 3X1KA 3QX8A 1M6VA 1F4VA 3UGQA 4PJ0Z 4MB6A 3MCUA 2YWEA 4LMRA 1GTRA 3KFLA 1U1FA 2BPOA 5A9RA 1PV2A 1CG6A 3CHYA 2YQ5A 3KQHA 4IWXA 2EKPA 4FN5A 5FUBA 2X7XA 4LHWA 3LXUX 4M9RA 3FTFA 1WJZA 3DBLA 1OLSB 3ZCRA 5IBQA 4PLCA 1UPFA 3W9BA 4YMWA 2I67A 3T94A 3VYVA 5LJLA 2EW8A 5EJ7A 2QNBA 4PNZA 2BUCA 1RABA 4U7TB 3VC3A 5B5EZ 1W8IA 1YE3A 5EA2A 2OV6A 3RTGA 4JV5O 3QELB 2ZSKA 3D2LA 3ZHTA 3KYCB 3IAS1 1PCXA 3BD6A 3CKYA 1GILA 1M2OA 3E7WA 3NB0A 2MOKA 3CCEV 2EGGA 4HDQB 1CR0A 5JSFA 2VPZA 3GEGA 1MHTA 1WVGA 4XD7D 1PL8A 4KOEC 2FW9A 3IDAA 2ZSIA 4L9SA 1JQDA 1VRWA 5T4HA 1R74A 4IGKA 3TFQA 3LS2A 2NU8A 4MV8A 4PSVA 3MOGA 2H1IA 2BI7A 3JQAD 3AW8A 1UPCA 3ANYB 3DFZA 4FYVA 2JKYA 2JI7A 1BRMA 3BAFA 4AB1A 2CSXA 1EFDN 3EWAA 4URYR 4BQIA 1VJ1A 3IKLA 4IEEA 1HG1A 5DM1A 1V9PA 1HDRA 3OCVA 4MS3A 3KE9A 4WLUA 4QVIA 4Z9YA 1SB9A 3N0RA 2R1TB 3EIXA 3WK7A 2AF4C 4HLDA 1Q2XA 3EMDA 1LFAA 4K6OA 2O3TA 1CS0B 4OEHA 1B2RA 1TRHA 3F47A 1U6KA 1ENYA 4DR3B 2EEZA 1RWXA 3DAPA 5LMUO 1IOWA 3LU1A 4KGDA 1CULC 4N9QA 1G2OA 1AZWA 2ZYSA 2FPWA 4Q4DA 1LSSA 3HEBA 5F1YA 2XB2A 4LXUA 4XEHA 5LP6F 4X3LA 2FFBA 2HTFA 3TJRA 8MHTA 3E8HA 3L6BA 1JRLA 2F8MA 3BSSA 5E6UB 1U4SA 1MT3A 3AEKA 4BFCA 3AKEA 1EVJA 3VJKA 4W8HA 5L51A 3ZMSA 3S3XA 4KLCA 2I54A 1RJGA 1Z0SA 4DY6A 5HWSA 1QPGA 1BD4A 4I0XB 3AR6A 3BMCB 2Q3JA 3HK2A 4QRHA 1F1JA 4BU0A 1Q0UA 4FZ5A 2B33A 1H22A 3JYOA 1MX5A 3R9IA 2ZT9B 3KB2A 5FJ4C 4BO0A 3ROKA 4KXFB 3SLKA 1HLDA 1P0MA 2ETVA 5CIQA 3BMNB 2POQX 5D7NA 3WQQA 2E5FA 3K0CA 3L8HA 2DFVA 2QQEA 1Q3HA 1L7DA 1P4GA 1R5BA 4OY3A 1US6A 4F4JA 2G4LA 2R5NA 5G0WA 5MGBA 1PP4A 1AP6A 2VP3A 3IQZA 4RQBA 1NC1A 1CFZA 1Z25A 1Z33A 1QVWA 2WWHA 2W2LA 3IV6A 4GR4A 3HBNA 2P27A 4ZYZA 1EYZA 1SRRA 2CMFA 4L8VA 2QKCA 4TTTS 1R27A 4GCZA 5DVZA 1BW9B 4HDSA 2AMYA 1ZK2A 1UC8A 5EUCA 2GEVA 3RI3A 4IJUA 1AILA 1R6TA 4B09A 3TQIA 2ZTHA 3BJZA 3NIDB 1W73A 1O5TA 2PH5A 1JQAA 5KNBH 2POCA 3P30A 4P7BA 2AZMA 3FLMA 1QGUA 2F3RA 3A0RB 4D02A 4I36A 2BJWA 1SBNE 2YDYA 4AXBA 4UBNA 4NCHA 4GXTA 1VCMA 2WPDA 3GPCA 1VARA 1ZD2P 3TOCA 1EQAA 4TWAA 3R74A 2GBGA 3TI7A 2ZYVX 1VQNF 3OF5A 2P9FA 5HX7A 4M6WA 1L5MA 4L9RA 3STTA 4HDNA 1VQLF 3AYZB 3U40A 4TV9A 3H1JH 2IH4A 1ZCZA 3I62A 2UUBO 4UBIA 4TSFD 1Q16A 1DOAA 2WPNA 4GSKA 3F5QA 4MAAA 4IEFB 4R2IA 1Q57A 4Y9TA 5DNAA 4DBZA 3VKVA 2BN4A 2X0NA 1XRGA 3CVJA 2CZWA 1E2FA 1RM5A 1UBOS 2KE5A 2RK4A 2H9IA 4J8PA 5C5EA 5JPCA 3SPIA 1GU7A 3DEHA 1Y8QB 5CH3A 4FPXA 1W9HA 5KDOA 4CU5A 2GF0A 4LF9O 3SC6A 1YDEA 4OHUA 4CCWA 2F43B 4GOJA 1E96A 5GGYA 4WLVA 2W8BC 2I4OA 4YP7A 2VHWA 4PFSA 1VKRA 4R1TA 1X3SA 2WEKA 1E1QD 4KXRA 3B7WA 3WBBA 3WHKA 1AKTA 4FNGA 4Q1FA 5ECDA 5IVDA 4ILKA 1QJCA 4RD0A 3UFBA 5HKKA 1F3LA 5B4VA 3N6VA 2HIAA 3IX7A 3KV3O 2EDCA 1QUFA 3KTAB 4ZU3A 4TPKA 3GLFE 1JH9A 1JIJA 4BKRA 1PF7E 3WLKX 1EDOA 2XRYA 2Z9DA 1YS6A 4D0RA 1AB6A 2CZCA 1TCAA 4Y30A 3KU1A 4DKXA 1A2QA 3S7ZA 1OTHA 5KMGA 1PVVA 1DEOA 4MVJA 2CSLA 1T5LA 1GCIA 4QPDA 1BQ3A 3ZGVA 3O8LA 2C4NA 1NX9A 4AZTA 2Z57A 4INJA 2PXXA 2P67A 3SXJA 2R6DA 2XWPA 2YL2A 3TD3A 2P9QA 3E3MA 1N0HA 4M7PA 2DFTA 3GFVA 4HYTA 2XQIA 4N7BA 3H7IA 4BB5A 5DI3B 2YUAA 1H4QA 2QJRA 2AKEA 2RNBA 1MU0A 2O7RA 2PH3A 2MDTA 4XEUA 1NAHA 1PAUA 2EFDB 4PGHA 2DR3A 4QWMA 4LBZA 3BSWA 1G20E 3D3NA 2OO7A 1WXQA 3ZMUA 1T5HX 2Z5UA 1ZIDA 2WAOA 2O8BB 1EXDA 4FD3A 4MUIA 4CHTA 1JDTA 5JHGB 3ESJA 4IV8A 3L8YA 1X7GA 4V0RA 3LOPA 3T3NA 3BCSA 3CWZA 5KAIZ 3C6QA 3W1WA 1OH7A 2GF9A 4A6EA 1VQPV 3MIZA 3FTNA 4DXWA 3KR9A 1QP7A 1C7RA 3AUSA 1JPXA 2VFAA 2JNBA 5CD9A 2ZM5A 3UAYA 4E14A 5I9TA 4ER0A 1DS6A 4FFOA 5F52A 4H33A 4DLWA 3KQTA 4KX3A 3UWOA 4DV2O 2O2EA 4UNIA 1SD2A 4LWZA 1GEEA 4UCTA 3G59A 3BKWA 3EA4A 4LOKA 4ETWA 3MHSC 4L3VA 3QYJA 1I2ZA 1B8PA 1QGOA 2FN4A 3LL4A 1UJ4A 3UATA 1LTHR 2X4LA 2AJLI 1YZFA 1WDLA 1O1YA 3PGMA 4PZEA 1L0LH 2OPBA 3MINB 3MN1A 4WK0B 5ALPA 2PZAA 3Q2IA 3NNNA 3KYDB 4DJFC 3SBDA 1R6UA 1XKTA 2XDAA 3DXZA 2C5SA 3A9SA 1SHUX 4ZZ2A 1ZSPA 3RVDA 2P5TB 1VQMF 3FETA 3PFKA 3RVRA 5DW0A 1WABA 5DMXA 4ZP1A 3J7AC 5IWAB 3IEMA 1VL5A 3BB3A 2BELA 4DR4B 1U8CB 1LBQA 2OLEA 2SKEA 2CUKA 1PNVA 4NP6A 4BQQA 2IH1C 3EY4A 4KBGA 3I39X 1F60A 1JILA 2QZZA 2QN9A 1PP9H 3EC2A 3HJRA 1HTBA 1N34B 1AMNA 2QQGA 8OHMA 2OGTA 2ZI5A 4JN6B 4OTZA 1JHRA 1DC3A 1WW2A 2G36A 3ZWBA 3R41A 4IR7A 5SV2A 1QP0A 2V4UA 3Q7IA 5IDWA 2VQ3A 5GPBA 2FK7A 1PDVA 1AT1A 3ERNA 3FOBA 2JJ1D 1T6YA 2E87A 1U5BB 4EKDA 2FY8A 2IXBA 5B3KA 2QY6A 1FMFA 1IUOA 1UOOA 1ZNZA 3HPQA 4LZNA 2EKZA 1PTJC 3C48A 1P7GA 5TDHA 5FWDA 4KNVA 2XTMA 2YY7A 1KSHA 2C4HA 4BJ1A 5JOQA 3SJBA 1GCGA 5TMDA 4AF7A 4QO8A 2Q5IA 2XNSA 1WBDA 1IDN1 1ZMBA 1JN1A 4EF5A 2LCAA 2QD5A 4M9UA 2XCRB 4BAZA 1L4HA 3M1IA 3VU9B 4G23A 2O2IA 1Y1SA 2C77A 2SECE 4ENSA 2QVZX 5GTHZ 1M1YB 1BSVA 3MCVA 4MVQA 3DDNA 2CTRA 3SG0A 3AMVA 3WLEA 4MW7A 2JFBA 5TSDA 5AR1A 1Z7EA 4W1RA 2VHQA 1EFVB 4FM1A 4XX0B 2GYVA 3WMFA 1N2IA 1Q12A 3ANSA 3ZKWB 5AKLA 4RHTA 2WU3A 2PSFA 4P82A 3H2GA 3NBMA 1DELA 1JQJC 4M1ZA 2GVZC 1Z0AA 2W4QA 3NDPA 2Q4DA 1X74A 4BNWA 4ER7A 4GGMX 3O4HA 2DQSA 3SQDA 3T8YA 2PZKA 1UKZA 4W1QA 2JHCA 4I3GA 3AKDA 2BSKB 3CNNA 3ZRWB 2ZCEA 1T0BA 2HBRA 5L4SA 4CTKA 3NASA 4AZSA 4RULA 5JV5A 2Q1UA 1M1KH 4JLJA 3T95A 2DFDA 5I48A 4BN4A 4WLEA 1GZ0A 2HU5A 3UMYA 5JJIA 5GOTA 2G8LA 4F7DA 3SJQC 2HSZA 5LC1A 1USWA 3WIOA 1RBZA 3CZPA 1FNJA 2QV7A 9GPBA 2V5VA 4YAUA 4IQFA 3OM1A 1C8KA 4JOSA 4ZVLA 2IEYA 2PYLA 4W5TA 1W93A 1PT8A 3EW7A 4UM8B 1OI7A 1EVYA 4J3FA 2E75B 1X6VA 3MW8A 5HY2A 3LO5A 3EF3A 5I4BA 1UC5B 1U7HA 5DTQA 3V7FA 2ZWAA 4C0XA 3TLEA 1FFWA 4ARBA 4IIFA 2MMGA 4DLNA 2OQVA 3BICA 2REBA 3HKEB 1XCOA 1XTJA 4AKIA 1XN4A 3Q41A 4KVAA 3QMVA 2XNHA 1TGYA 3DVRX 4B40A 1EB9A 4INPA 3UAZA 1C3LA 3AF5A 4QE9A 1HNXO 2VP0A 1EPUA 5E6SA 3SJZA 1J1UA 2EKLA 1SBCA 1ZVVA 2C3PA 5ARDA 1KEZA 2OZKA 1CVIA 2D00A 1Z8FA 1LVUA 3DNPA 4GOOD 2AJDA 3RHSA 2YFHA 1Y76B 1C9KA 2BZ0A 3QVOA 1T2VA 3ZJZA 3TIXB 3OQOA 2XXAB 1Z36A 1E9DA 3I6YA 4KQ9A 1KZ6A 1ZI9A 1XEAA 4UHHA 4D0GA 3G6EF 1WDWB 2AYZA 4U2KA 3JRWA 1AI6A 1U0HC 2VI5A 3EGIA 3B2EA 1GQQA 1Z39A 3I56F 4WCFC 4C4RA 4DN6A 3WU2Z 2VPWA 5EXTA 3A3OA 2ZCJA 1IXKA 1CC1S 2COEA 3A7EA 3MMZA 1KY3A 3VV3A 1HL3A 1YQDA 4QM6A 3LFUA 4ZAYA 1XN1A 4I50A 5AW0A 4HQFA 2PVPA 5AXCA 2PUBA 4F2DA 2M6RA 4QXMA 3B09A 1Z0FA 1GGEA 4A8PA 2H5IA 1M2JA 4MV6A 5A2QN 1N9GA 3BM5A 3QFRA 4RMGA 1YTFD 1U0NA 1R73A 5K3DA 8AT1A 3F2VA 4W7IA 1VMIA 3AHJA 5L6MB 2Y4TA 4CNBA 1NQTA 4C14A 1CUVA 1QKJA 3PPIA 2O7VA 3WXMA 3WRYC 4Q18A 3JU3A 3HHPA 2IXFA 1LBEA 3FUXA 4P7KA 1Z74A 4J0HA 3T4EA 2EWMA 4BE4A 1II8A 2O52A 3HM9A 3QKRB 3CZMA 1MIHA 1O5OA 3W7WA 5KTKA 1T9GR 4WZAA 1U3DA 1CUSA 2PLRA 3Q15C 5FJJA 4B1FA 1AGPA 4QZVA 1FXWA 1U2GC 3X44A 4D2IA 1MT0A 3RVZA 5AW6A 3LUKA 3R09A 1KU6A 1EE2A 1PZFA 3NRCA 2IEZA 5EHQA 5T57A 1BS9A 3QO8A 2BEKA 2A57A 4AU1A 1Z38A 5FI5A 3BXEA 2YV5A 5J2TB 1V4BA 5IC5A 2O8FB 3LNTA 3TD5A 4KVGA 1ZIPA 2O2ZA 2HHAA 1XQ9A 3IPLA 4R50A 3G7UA 1Y4ZA 3S6JA 3J80M 4GG1A 1P61B 3A7DA 1ZNQO 4COOA 3HA7A 3PDCA 4XVCA 3S03A 3NGMA 2ZAIA 1YZYA 1E3SA 5DK4A 1KE2A 5B6IA 3V1UA 4IGAA 4NB5A 2ZU6A 2QL5A 3IXLA 5EVCA 1SD5A 3EMBA 4WVFA 3W1VA 4B44A 5JXHA 3K5HA 1R3IC 3A1NA 3D5TA 2LRHA 3OLQA 2BM9A 4HL6A 4B32A 4HZUB 3ZW8A 4LW8A 5C3MA 3F6RA 4PLWA 1B6GA 4AX8A 2EZUA 4PLGA 4GKJO 3FMGA 4EPYA 5T41A 4TLEA 1JZSA 1MRZA 3SQWA 3EZ2A 1DKRA 3DKKA 1AB3A 2FPOA 1MUUA 2A3QA 1MENA 2AG0A 4RY8A 5DYGA 1KK1A 4EPTA 2V74B 3I04M 1IX9A 4UBOA 3IEPA 5KU1A 3T7CA 1G4YB 4J4TA 1FDVA 4Q48A 1RLJA 3FDIA 4M4SA 4HH1A 3EFOB 4A0QA 4BWAA 1Z2EA 4J1TC 2B30A 4JLNA 1MCZA 4ZFNA 4EW1A 5IDVA 4HWRA 3NR2A 3K9NA 3JQFA 3I8OA 4PRKA 3SZGA 2BCEA 3B85A 3L4KA 4C88A 2HF2A 4GOMD 4KNWA 1BKSB 1XELA 1GN4A 1UXJA 1CUFA 1YB5A 1ORIA 1ZKMA 3PKZA 2W2LD 4YV1A 3R3XA 1T6NA 2XUFA 2DH5A 1XNGA 4RCZA 2VTBA 1YAHA 1TUEB 1EE1A 1A88A 2JEZA 1YZVA 4B6PA 3PL1A 1DT3A 4G5SA 3WNQA 2VS1A 4OX9O 2H3OA 3IRVA 3WAKA 4NXMB 3MGBA 4I46A 2AG1A 3CC2V 3UGTA 4GZ3A 4MH0R 4JA2A 4DOMA 4CM6A 2JEUA 3UENA 2YW2A 3PVZA 1GO1A 4MUKA 4UHJA 3VPBA 1NUQA 2WSBA 1UXIA 4CFSA 2ZKOA 4Q4JB 2XUMA 1BWRA 3KKNA 3ZPXA 3IP9A 3NWOA 3PK0A 2WPDD 4JJIA 2F8SA 3F5SA 4NTZA 1G4UR 2HG5C 2J48A 4L87A 2PM8A 2PR2A 1IL0A 2B8JA 4RPJA 1N2GA 2G25A 5JS2A 2EXXA 2KI5A 3EMKA 1T10A 4BIOA 4JGIA 3ED5A 3T3MB 4H1HA 3DG9A 3IQEA 1LY1A 2CV0A 1FLAA 4QJBA 4CF5A 2ZBRA 3F3KA 3NTOA 4K8XA 2IDMA 3FWNA 5AOAA 1UKBA 4UTVA 1MG0A 4LFBB 2FG6C 2C1EA 3DOCA 4TLAA 3PN1A 3ADKA 3QG5A 5FFMA 2Z0MA 1RJEA 1CP3A 3L0OA 4CXMA 4N5LA 1U1CA 3HWWA 1BL8A 3TRKA 4I55F 5HF6A 4QOFA 3QU9A 2IWRA 2I6UA 3ZHXA 2IQIA 4YBRA 5HKKD 3H6KA 4M37A 2QRVB 3T3IA 3EISA 4BNGA 2XOEA 2NR5A 2VJMA 2WWIA 4OXYA 4L6AA 2HJVA 5BVHB 1GU0A 2DSTA 4MRMA 1P3DA 1T9BA 4J4BA 3H11B 1TC1A 2VZ0A 1DOHA 3MB8A 3COVA 4XLZA 2DGDA 4OI2A 3CCQV 2RB9A 3ENZA 2C31A 3I3FA 4MVJD 1YOVA 2FDRA 1W94A 1TL7C 3AB3A 2IHTA 4G5YA 1JFVA 5ITZA 3OFJA 3C4VA 4HRAA 5BQ5A 3RBXA 3WNVA 2JHFA 4PN3A 2H8GA 3I6MA 3DMGA 3LHIA 2RGEA 4BEWA 3LQ1A 1RQ2A 4AN0A 1D2AA 4E5VA 2GPYA 2WJGA 1DXOA 5DIFA 3HJBA 4GI3A 5IHXA 3ZNPA 1M66A 4MINA 2GTSA 1O3YA 4GLOA 2OZLA 4EM6A 4YFVA 1WPGA 1XFAA 2C20A 3M1YA 3WYGA 4BNZA 4F9EA 4LP8A 2NVWA 3FN4A 5L45A 1Q2UA 4DK1A 1PGPA 2VF2A 2PGNA 1EGAA 2BKVA 1SBZA 2P6MA 4PVCA 4J7CA 4NHEA 5AOCA 1G7CA 3Q6NA 3T7RA 5EKSA 2GXAA 1O2DA 3C41J 1JHDA 1N9KA 1CUUA 3QTYA 4KQ2A 1ESDA 2XUHA 4G0QA 2OENG 2ZSDA 2LE0A 4JBHA 3F0GA 1T5TA 5LXTF 2CLCX 4L8GA 2YI8A 2B6NA 1ISSA 3GRZA 1GNQA 3UH0A 3ZWQA 1RHJA 3KFXA 3EDOA 4OGFA 3ONEA 4AMVA 4RGQA 4HEJA 1JHXA 4O0MA 1G6Q1 2V0CA 2XASA 2W6MA 1RAIA 3BE5A 4ZU6X 3T54A 5H02A 3G79A 4LXXA 3ZU3A 2VYCA 3AG4B 2D3OW 2DHQA 4WOBA 2I5PO 2Y0CA 1BHSA 1IU9A 3BSYA 3PLAE 2NW6A 2HQSC 1J8MF 2REQB 4DLUA 5GTDA 4PSCA 1RE0A 2MYNA 5EYPB 2OO3A 3E9QA 1RWMA 1ZG3A 1GTZA 4A8JC 1Z47A 5JD6A 3L4SO 2JCGA 5IKPA 5BPFA 1VQ7V 4CEJA 4ETIA 4ZO9A 4Z0TA 5AK5A 2Z5LA 3ZXXA 1T8WA 1PJRA 2X1HA 3E89A 3NAZA 1PGQA 4BQRA 3PNPA 4ZOLA 3CMMA 3HU1A 5I9NA 4RELA 3HXPA 3PU6A 3RRJA 1QK4A 1XRRA 1PG0A 3PWTA 4OLFA 3D4IA 4EVIA 1VFPA 1Z5OA 2GAAA 2IDKA 1MO2A 1UT5A 1HNZB 4RK7A 1TDJA 2AXQA 4IUDS 4FCWA 4NBSA 2HYIC 5JCJA 1GK9A 4TQDA 1DBQA 2IUFA 4OQQA 2OHIA 3V4FA 1Z45A 3NKLA 4BVBA 1XOIA 1ZSNA 2A30A 1PFUA 4FDVA 4GM0A 5L3RA 3DEYX 4G4SP 1CF9A 1FP2A 2BGJA 6REQB 3GIWA 2I91A 3PNLA 4EL0A 3FRHA 1VQOV 3BSFA 3IJEB 3DT9A 3I76A 3SKVA 1PUIA 5TT1A 3QY0A 4TXLA 2WJAA 5FLYA 2R7LA 4MNTA 2F67A 3T3PB 1SVNA 1ZJJA 2XHZA 1WXFA 2BM0A 1ODIA 3KIPA 3A70A 3A9RA 1HX7A 4K6KA 3AL2A 3LSSA 3V4RA 1J7KA 4Q4HB 5DT2A 2C5EA 1T26A 3OD5A 1JLHA 4BWFB 1CUZA 2Q7XA 4WK6A 1RCFA 5MDHA 1C3EA 2QEQA 4MVRA 1Y8AA 4RV9A 3NV9A 1XMXA 5HILA 2RDMA 1PR0A 4PAMA 4PZPA 5HIMA 2FQWA 5JZOA 4G41A 2W11A 5JJCA 5FWXA 1H0RA 4TMFA 1M56B 1P18A 4MS1B 1KZ7B 1EWQA 1FDSA 3ZMZA 4D3ZA 2CMDA 3DTVA 3MQFA 5JAUA 3H5AA 1C29B 4HAZA 4HAUA 5L7YA 1JN0A 4NCNA 4LH6A 2ZZMA 4IIYA 5EXEA 4OMUA 5DT9A 1Q1QA 2J9GA 4DE5A 5K0CA 3FWPA 1B6SA 1GRQA 2V3CC 1VIAA 1Y82A 1VPEA 1EFLA 1NVAA 4DV0B 3FWHA 2B82A 4G0MA 4EB6A 3U4HA 2NAFA 1T9KA 5B7NA 4F6EA 1I3MA 2PBLA 1VP9A 2P4VA 3EXG1 2J3LA 1ZJYA 1C9YA 3MUNA 3ER6A 3QTCA 4G8BA 4C0QC 3E9RA 3IVCA 1Q0QA 3BWCA 4RA9B 3ZY6A 2COKA 1T2FA 4G24A 3T6KA 3HADA 1V55C 1R7RA 4MYHA 3WRWA 3AR9A 2KGWA 1M0EA 3C85A 3RSHA 1MABA 3AEYA 2PLWA 1XO1A 3RBZA 2Z4RA 5F5NA 5KX5A 4HVCA 1SIUA 1EN6A 4KR9A 1ESMA 2BDUA 2J9FA 4Z1OA 4R9SA 3MTJA 4BCBA 1E1NA 3PFNA 3KJEA 4CIYA 1NQ5A 3I04A 5A9TA 3AY6A 1CJMA 1T4CA 3I3OA 3NAMA 4JJAA 2GPBA 1IOLA 1GDDA 1I6WA 4N0EA 2M7WA 4AKGA 4DIKA 3BQNB 1N8NA 4DNQA 4BT3A 2QEXV 1D6MA 4KK4A 1SK9A 3K1YA 5CVVA 2Z9CA 4F84A 2R8XA 3FFQA 1Z6AA 3L0PA 2XCQA 3GLGB 2WQ7A 1XYVA 4MVXA 5EXDA 4HWPA 1ID1A 2VDQB 4E5SA 2HHJA 1KZYC 4F3CA 5FTLA 2WLLA 2Y4OA 2ZE5A 1ZN2A 4CYMA 2PRJA 4LF4B 1K4YA 4RXMA 4BVAA 2WTAA 3KEFA 4BV8A 2WQZA 4Z3OA 4OFZA 1N4DA 1T3TA 4O5OA 1EZZA 2PGAA 1M76A 3WK8A 3APOA 1QRUA 4CG0A 3ZY3A 2DEUA 1KMNA 5DH9A 3ZW7A 1YL6A 4GBJA 2OYCA 2FMUA 2XZTA 1T91A 1OASA 4MDEA 5L3CA 2AUNA 2EHDA 3THOA 2IK8A 3DEZA 1UC4B 3A1DA 4KVZA 1LZKA 1TU4A 3E9ZA 3KQUA 4LAFA 1RQRA 2IIPA 2YWHA 1WO8A 3R7FA 4BO8A 2VJKA 3Q0EA 2CH7A 1VYVA 2W0MA 5JW6A 3LDHA 3FSGA 6GPBA 2ASEA 1MDBA 3BYZA 4FFKA 5ICSA 2BMEA 5C5CA 1UAYA 4TTAA 1X70A 4A3SA 1TZCA 3KUUA 1N0UA 3PGA1 4LGYA 2PXAA 5HXUA 3DEFA 1J07A 1Z7YA 3WI7A 2VOEA 2P2GA 4KH1A 1SOUA 1YHYA 1WE2A 3MAGA 2G6BA 3CRMA 4XFKA 4C7OB 1SQ5A 1KMQA 2Q7GA 4L75A 3V4OA 4CLXA 4IIGA 1N6OA 1ZJ6A 3EPHA 1Q1EA 1K5SA 3ZHSA 1IIBA 2JLYA 5GTIZ 3KB6A 1FUUA 5SICE 2UXCO 2YFYA 3WZ2A 2L35A 4Y0VA 4L95C 4B3SB 4TQGA 2BR4A 4AUKA 3ZWVA 4TTQA 3W7SA 5HUHA 1C3OB 3DKRA 5EJMA 3V6LA 2WVAA 5DNUA 3PNOA 7ADHA 4PS1A 1C1XB 4R3WA 3UT5B 2CJXA 1PKXA 5EB0A 2AOUA 1I2CA 3IQWA 1A1VA 3B6NA 3HB1A 4BT2A 4DJTA 3OT7A 2BO1A 1TO2E 1WQ1R 4NKRA 2K87A 1VYHA 4EA8A 4CG3A 2D1YA 2PA0A 2ZJAA 1QIJA 2PRZA 4JEMA 1ZIOA 4Q15A 3HA2A 4GWGA 2RB5A 1XEFA 4X1YB 2HRCA 4L3OA 2Q0QA 5B1AC 1FFAA 2WYVA 4AWBA 3B3GA 2DF8A 2YVLA 4LYFA 3SP1A 1YZLA 2NUAB 4PG4A 1KC8W 3NG1A 2D0OB 4C2UA 4AUMA 1FYJA 3ZMTA 3M99B 2CW5A 3ORQA 3Q6IA 2GYYA 3WNDA 1NZFA 3CCJF 3TR0A 4DXAA 3PJEA 4JYZA 4JY7A 3MJTA 2FSSA 3DE4X 5JNUA 3IJ5A 2Y92A 5JNRA 1H2FA 5JZ9A 2Q3MA 2Z8XA 1C8VB 4D7AA 1DO2A 2O2YA 4Y2YA 2NTYC 4KYTA 1M7GA 5FR1A 4MTLA 1UAGA 2YC2C 1VQPF 2JGRA 4L9AA 3WV4A 2CLKB 3T1CA 2F95B 4EHDA 4YREA 3SYLA 2WZBA 1FNBA 2IOYA 2XF8A 1O8CA 1M8FA 1OFTA 4KE8A 4RQUA 2MSLA 1H5QA 4YV2A 4HNAB 5FCDA 1H9AA 1KMCA 3CVVA 3D4LA 1G8JA 1OCOC 3ZJUA 4AIIA 4QYXA 4DLRA 3LCUA 3FGPA 3KJHA 1LJLA 4IDNA 4C0WA 3UG7A 1XZAA 1SUIA 3WYAA 1GPNA 4NG4A 3EVBA 5DSTA 3MNFA 4HGRA 3VNSA 3WWPA 1W46A 2HBZA 3DDHA 3NW9A 1H6AA 2ZI3A 3K70C 2CE7A 2HX0A 4X65O 5BV1A 3E05A 5ALVA 4R2WA 3H9JA 3UMFA 1FXKB 2HSEA 3ZP4A 4YNBA 5IARA 2VNIA 1UJ2A 5LLTA 5I4CA 3AR5A 4YRDA 5ED4A 2OFPA 1ZK3A 2PU5A 4XB6B 3WQBA 1AE1A 5J43A 1UM8A 5JRZA 4YRZA 4BNFA 5CDYA 1Z4MA 1OC2A 3F67A 3SXUA 2IY9A 3QMMA 4IX1A 3DYVA 3MTAA 1S5LZ 3E53A 4MXDA 2O8EB 5JAIA 4U9IS 4CQJA 4R9NA 2XBLA 2I6TA 2W6CX 3B5EA 4EYOA 5K8JB 2FJ0A 3CNEA 4WCFA 2XJ9A 3IBCA 3S55A 4G9GA 3IQHX 3LKBA 1V5EA 2JFHA 3LC2O 5FTMA 2ZKIA 1AQJA 4NZOA 3DE7X 3CRRA 3JD2A 3L5KA 2CZQA 4BCCA 1A5BB 2PK3A 4XCXA 1KK2A 3KSAC 4FXPA 3JYNA 5JSYA 4MGEA 2WLHA 1WQ4A 3TIIA 4IDHA 3KBBA 3NTQA 1V3QE 2YMMA 3RG2A 1UK8A 2C2GA 2GCOA 2QA5A 2NP7A 3O8OA 4KEAA 4YECA 5FP0A 5J5VA 1NBMA 4D82A 1XT6A 1ODKA 1YR6A 4XE5A 3HKDB 4NCBA 3OPVA 4NMLA 1ISFA 2KTVA 1OE0A 3LT1A 2IH2A 1W75A 3FPKA 1CRLA 4G0UA 1BE3H 4HZ3A 1Z13A 2JFPA 3MMNA 4YUZA 2Q7HA 1UIMA 1K73W 2GSMB 3NDJA 4HXEB 2VQDA 3HZRA 5IPFA 2C9ZA 2G9VA 1JEDA 2GBLA 3HBAA 4C7XA 1F51A 3VZDA 1H05A 3WRYA 3IB3A 1CQWA 1XLUA 3HB5X 4DHEA 1KFEB 1X15A 1SBYA 3NZEA 2GPNA 3WSTA 4RHYA 5F4BA 2XYHA 3QXXA 4MKRA 4Z3DA 4HXFB 1U02A 2AW5A 1LW7A 4JA0A 2Z3WA 3LLSA 4HJXA 1JFSA 3KXPA 3N76A 1WOYA 4I4TB 3TQTA 2NPIA 5EEGA 2H4WA 4C7KA 1CBUA 4GD3Q 2ISSD 3AVXA 1GPLA 2KHZA 2R2AA 1C8LA 3AG3B 3VNBA 1EZ1A 2OG2A 2Q7OE 5BSGA 5JD5A 1LI5A 4ZA2A 4MWBA 7MDHA 3ADBA 1WHSB 4RKFA 1TQ4A 2X0LA 5KTOA 1Z9BA 4QUHA 2HAEA 4DLBA 4WKCA 1S3JA 4MVUA 2OXCA 4PINA 4ZQGA 4WNAB 4ZZ3A 1Z37A 3SDBA 2OA0A 5TIIA 4FXOA 2C03A 5KHLB 3WS7A 2J8ZA 3L8DA 1RVDA 2C4VA 1EFAA 4Q24A 4ALKA 1VA4A 2V6IA 2IC5A 4JUDX 1SZDA 4BNTA 3T4XA 3PEVA 1JY8A 3RVKA 5DKFA 2ADOA 2N46A 3R24A 5HA5A 1V1RA 2XR1A 5AM3A 5GINE 2BSXA 1M9NA 1KYQA 3I4FA 3W8EA 1V37A 3FFWA 5MGNA 4OGKA 4ZEOA 1NFRA 1B00A 3JR7A 2J3HA 4TZ6A 2LNDA 1LW6E 4KBYA 4PIVA 4HUQA 2H1RA 3C8LA 3JVUA 2NZVG 3EXHB 4F21A 5FYDA 1YUNA 3D2BA 4QPJA 4CI0B 2V1UA 3LY9A 4XPZA 3DV0B 3LCVB 4ZJUA 4XM1A 3WO0A 2FPRA 1J22A 5FB3A 3KTFA 1GHTA 1UFQA 4XWGA 3ZD6A 4EF6A 4WF9V 2JJQA 1FXSA 1FQKA 3T1HB 3KVRA 1X39A 4YRCA 4FI3F 2PMDA 4P4GA 3C9RA 1UDBA 1EFCA 1ZI8A 1QK3A 1UFRA 1U0LA 1TJPB 5JMOA 4WL0A 3PT9A 2GO7A 4N9WA 4NAUA