5IJ9B

Cryo em density of microtubule assembled from human tubb3-d417h mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNHLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 140
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij9B01
2BTOA 4EI7A 5LA6B 5LP6A 3WGMA 4IHJA 5LXTA 4EB6A 2R751 5EZYB 5GONA 4U3JA 2VAPA 5ITZA 3HKBB 4HNAA 4O4IA 4X1IA 5FNVA 4ZHQA 3ZBPA 3ZIDA 5IYZB 5EYPA 1W5EA 4WBNB 1FFXA 5JVDB 3JALB 2R6R1 1W581 3RYIB 3M89A 3N2GB 1Z5WA 4E6EA 5KX5B 5KMGA 2RHHA 2VXYA 3UT5B 5LP6C 5J2TB 3WGLA 3JASA 3N2KB 4FFBA 3RYHB 5JQGB 4IIJB 5KMGB 4X1KB 4X20B 3JAWA 5IJ9B 3VO8A 3JARA 4TV8A 2Q1XA 3JATA 4O2BA 5JCOA 5CB4B 4O4LA 4KWEA 2Q1YA 2BTQB 3HKEB 4I4TB 4TV9A 1TUBB 5LXTB 1FSZA 5BMVB 5CB4A 1RQ2A 3JATB 3VOAA 5EIBD 4DXDA 4TV8B 3RB8A 4ZI7A 4O4HA 3V3TA 1OFUA 4X20A 4X1KA 4IIJA 4TUYA 5CA1B 5IJ0B 2RHJA 5J2TA 3C8LA 5BMVA 1Z5VA 4YJ2B 5MN5A 3HKCA 1RQ7A 3WGJA 4I4TA 4TV9B 3HKEA 3WGKA 2BTQA 3R4VA 5LOVB 4EI8A 5JH7B 5KX5A 3RYFB 3JALA 4O2BB 1FFXB 5JVDA 1SA0B 4B46A 1TVKA 5MN4A 4I50B 3JARB 3RYFA 2VAWA 4U39A 3WGNA 3JAWB 4O4IB 5IJ9A 5ITZB 4XCQA 4ZOLA 4I55B 5LOVA 2GVIA 3M8KA 4YJ2A 3VPAA 5EIBC 1W59A 5IJ0A 4TUYB 5JCOC 4O4HB 3VO9A 4LNUA 5J2UA 5EYPB 3ZBQA 5MN6A 4B45A 4O2AB 4X1IB 3HKBA 4HNAB 3RYCA 3RYCB 1TUBA 5EZYA 5GONB 4EB6B 4O2AA 4O4LB 3E22B 1W5AA 4IHJB 5J2UB 5M7EA 4O4JB 2RHLA 3JAKA 2RHOA 3HKDA 5LYJB 4DRXB 3RYHA 5JQGA 3JASB 3N2KA 4FFBB 4F6RB 1W5BA 3VOBA 5CA0A 3UT5A 4I55A 4ZOLB 4DRXA 1JFFA 4M8IA 4YJ3B 3JAKB 1W5FA 5C8YB 4I50A 1TVKB 3N2GA 1SA0A 3RYIA 4WBNA 1RLUA 5C8YA 4YJ3A 3CB2A 3E22A 5IYZA 5JH7A 4EI9A 5FNVB 4ZHQB 1JFFB 2XKAA 3HKCB 4U3JB 5CA0B 4F6RA 2VAMA 5CA1A 5LYJA 3HKDB 5LA6A 4ZI7B 5LP6B 2XKBA 4LNUB 4O4JA 4X1YA 4X1YB
chains in the Genus database with same CATH superfamily
3B8HA 4ME6A 2AI1A 4H16A 3OFVA 5BXZA 4RETA 4P31A 5KNCA 3BGDA 1HQCA 3EPJA 1E64A 2XOXA 1C9DB 4U3JA 1ND5A 4B84A 4DTIA 2OESA 5KYYB 2OHIA 1F8GA 4RFVA 4P93A 5L45A 1PKXA 1ZSVA 4LE0A 2PM8A 3IAM1 2PKYX 4ID3A 5KNBA 5AHXA 4WBNB 1UXOA 1Z83A 5CFRA 4GR5A 4M37A 2DCMA 2JGNA 3HB4X 4I4TF 1W2WB 1UPCA 1BX1A 4RTKA 4EYGA 2QEQA 3TAXA 1V7ZA 3PFWO 2DERA 2Z2ZA 1H2BA 3ZUGA 1ENYA 3ETDA 1FU4A 1QG0A 2HLPA 2JFFA 3OETA 3ZWAA 4BAUA 1I2DA 3NHYA 5BSFA 8OHMA 3EPRA 1V55C 3K59A 1L6IA 4RMNA 4B35A 2QAGB 1A9XA 5J4LA 4X1OA 1GTMA 1MO2A 3DGEA 2PX5A 1VQ4F 1T3LA 4TVOA 1YAJA 1T1GA 1JVBA 2B82A 3C0KA 3K3PA 4HZIA 4H27A 2YEVA 4XA8A 1AB6A 4CG1A 1LSUA 4IVPA 1H3NA 1OAKA 1K3EA 2GK6A 3E3AA 1KC1A 4DUGD 3TNDA 4KG7A 2XUFA 1QMPA 4A92A 5B53A 1H9CA 1C7FA 1J5EB 2Q3FA 3HLYA 4PBSA 5IJWA 1JHZA 4L4ZA 3QU2A 3AR6A 3NBKA 4LN1A 3RA5A 1CY4A 4KL8S 3KB6A 4M36A 1UEIA 1V11B 1Z6YA 4L22A 4Z49A 2D0PB 1K4MA 1Q6HA 2GTPA 4RFSA 1NY6A 2PD6A 3OH8A 3UGTA 3S7TA 3VA7A 1SRYA 2QL6A 5D3QA 4H77A 5TEVA 3W05A 3DF9A 1KORA 4R69A 4EITA 3G1WA 4KKVA 3RS5A 4XR4A 3AEIA 4YFYA 1KR2A 2R2GA 1Z2GA 1YZ3A 3M6AA 2VDMB 4D8TA 2KTUA 4NBVA 3EPLA 2FPRA 3LLVA 4X3OA 1NXWA 3FD9A 3KJGA 2NTNA 1QGZA 1F4PA 5AKZA 1G5IA 1K2WA 4GQIA 4JLOA 5HA5A 4KPUB 4QYMA 3UN1A 3ZJYA 4C7OA 4LZOA 4X41A 4AY5A 4YR9A 2VRCD 4MV6A 5ICGA 3ABLB 2DYRC 2WLIB 3PT9A 3FHJA 4R40B 4HQNA 4W1QA 4FJ2A 4Y6PA 1ZD1A 2NU9A 3H6GA 1YQXA 3NT2A 3T4UA 1V48A 5CH5A 2D06A 3G6KA 4RY2A 3VYSC 3GXOA 1TECE 1IY2A 1L7AA 2A06H 4QJ5A 5A2QA 4KV7A 1JEYB 1EK6A 3D43A 2HA3A 1PT9A 4JQSA 1WUHS 1LRKA 3ZHZA 4PYJA 4RSRA 5TE9A 3EDOA 2BMEA 4EZIA 1ULHA 3DEIA 2W6PA 4F3CA 3QLVA 2CV0A 4GX5A 1TTQB 1IZZA 3DZFA 3LCRA 2HSJA 5AUNB 5FADA 3V1KA 1W0JD 3U16A 3ZYCA 4MB6A 3E1YA 4A2PA 2RKBA 1Y81A 4R6XA 5IJAA 5K9ZA 1J1UA 3E7PA 2CLDX 4XW2A 1U40A 1RAAA 2OBYA 2RB4A 3U4GA 5F64A 1MNAA 2BGTA 1VBKA 2QY6A 1VA5A 2AJDA 3LWNA 2B4AA 3NEPX 2W2NA 2ZB8A 1CDZA 4QE9A 1DADA 2BSKB 3VXKA 1AHHA 2ASEA 2GBIA 4ILEA 4OB6A 2O1SA 4Y3UA 9LDBA 1V95A 3R76A 2IYLD 1FMLA 3ZX6A 2B21A 2KSDA 3G0DA 4TXMA 5EN4A 3M34A 5DHAA 1ZGZA 2J5BA 2UZ3A 1HURA 3UFXB 5EA2A 4A3SA 2A9HA 2A9QA 2EJUA 5LMCA 4Y9UA 1NR5A 1VF5B 1T5HX 1VHQA 1FFDA 1ZXLA 3BK7A 3RC2A 4DNFA 1T5EA 2F1OA 1AB3A 2Y6UA 3K5WA 2Z58A 4CV3A 1VI6A 1DEAA 2VWJA 3HCWA 1J39A 2QMEA 1SNYA 4MYCA 2XD4A 2GM3A 5EUCA 1DAFA 3F3YA 4DLKA 3SVTA 4DC0A 3ME5A 5E7JA 1C29B 1OF1A 4BMYA 5DN6G 2VXYA 2ZSJA 3CW9A 4OM8A 3AK4A 1ZCAA 4OJYA 4G5XA 4YYEA 3K5NA 1DRVA 4DCTA 1TRHA 1R0ZA 3HY4A 3ZE0B 4LYDA 6ABPA 3LU1A 3COWA 3FF4A 3ENZA 4OXRA 3HG7A 2Y4NA 4IX1A 4DCJA 4ZDIA 1EUDA 2G09A 2ID9A 4XUGB 3IAS1 2O4CA 2IJIA 4ED9A 4J2TA 3QQ5A 4LEIA 4YP7A 1PSDA 1XTSA 4JUDX 4AMVA 2XGJA 3M2PA 4WFHA 3ZDRA 1L5GB 5JWRA 2GA8A 4PI0A 1TT7A 5HOEA 4QUBA 2VDVE 2BFAA 2PUEA 3FSJX 2FK7A 3BSYA 1PRYA 5CU7A 2R7KA 3SICE 3TNLA 3DBRB 5J2TA 3VMFA 4ND7A 1SZXA 4O02B 5ALXA 2P7IA 4MZDA 3NEJA 4Q93A 4ZVQA 2BTQA 4FFOA 1PYDA 4DZTA 1C1DB 4MUFA 2XE4A 1MJNA 2BMVA 3H2KA 3V1UA 4Y9RA 5AM4A 3RBAA 5EL0A 5KYUB 5AIAA 3L8EA 3MC1A 1Z4PX 2V7QG 2QQ5A 1A8UA 4IJVA 1C9MA 3EMBA 1ILEA 4O2RA 4Z4FA 2BBOA 4JXKA 3QBVA 3MSCA 2HU8A 4OJTA 4Z1OA 1E3MA 1F51E 4DLPA 5H81A 2YV5A 1OZ0A 4PDVA 1KBZA 2HLDD 2TMKA 2XMBA 2B34A 2UXBO 1N7IA 1VPDA 3T1NA 3TD9A 3F73A 3DGEC 1YFZA 2PMPA 4UZSA 5I7SA 5KJ1A 5C52B 1ZAYA 2JDID 4B2LA 3H1GA 3DT6A 2RGXA 4IVRA 5AHKA 1CP2A 2AC7A 2VZLA 2WD8A 3CMEV 1FS4A 3V8RA 4FSDA 4FYIA 3JD2A 2RGWA 4FX5A 4NCXA 5K5EA 4QRDA 5EQFA 4Z4CA 8ATCA 1D4FA 3K6JA 5EKDA 5HFAA 1XG5A 3ZEIA 1OH7A 1I7PA 5HZKA 4L8VA 3JSXA 3N0WA 1KJ8A 4TQDA 1KZGB 3GGDA 2BH2A 2JAOA 1TB4A 2HYDA 1VYUA 3CP1A 4TM8A 1NFRA 1ADCA 4MS1B 1XHZA 1FZQA 2ORED 1QJ4A 4PYLA 3DVAA 2BGWA 2I2FA 3OCJA 4F0JA 1WV0A 2WWFA 1KFCB 3GWKC 2DMXA 4Y6QA 3ZKWA 1E9CA 4ALJA 4QBTA 1WKBA 3HU2A 4MVJD 4BOYA 2O2HA 4C07A 2QKAA 3VTIC 1ICIA 2C0QA 1XVVA 2H4FA 4W5WA 1N25A 1QV6A 3F3MA 1BVRA 1NP6A 1SCJA 1KZ1A 3L0PA 4HB4A 3QU5A 1DF4A 3EXEB 3FIJA 2PNJA 1W49A 3N2GA 1WUIS 2Q6AA 2RGEA 4RTMA 3BXEA 5FUQA 4UPEA 3PFBA 4UASA 1ZN9A 2RIPA 4WDRA 7REQA 5AG2A 2ZRCA 1BAPA 3OEYA 3HKCB 1V96A 3P97A 4U3JB 3MRSA 4R16A 2VWGA 3PJEA 1XVIA 4KFTA 4G28B 4X00A 3ZDBA 4A10A 4EA7A 4X90A 5DHRA 1QRDA 4HX5A 4G56A 4UW9A 1IJFA 3V8MA 2RGRA 1NATA 1GARA 2NSYA 2WJPA 4C0WA 3QKUA 1NNLA 1W5TA 4A91A 3U3XA 2RGGA 1QYDA 3LUCA 2IIVA 3EOZA 5DM2A 2F8LA 3DHVA 2DB3A 1W96A 5I7WA 1AGNA 5C5DA 3ZU2A 3CYFA 4DR1O 1QR2A 2BD0A 3M6XA 3O4RA 4MEAA 3WPXA 2F43A 3FIUA 1QF6A 3LQQA 2X8JA 3K0FA 2A1TS 5KJEA 4M0CA 2Z98A 1L6RA 4QOSA 5HILA 4JGGA 5G1PA 5JZBA 1VF7A 2FJPA 1H9BA 2V4MA 4ZT3A 1DVRA 3L1UA 2XUKA 5FWXA 2C9BA 1YJQA 3QVGB 2VHTA 3EQ7A 3NBFA 4UTVA 4UATA 4HDKA 5BSHA 2HWWA 1FDSA 1P44A 1TQ8A 2IZOA 3IGAC 1PJBA 3BIJA 2G76A 3EYWA 3F5DA 4REQA 1S77D 3BIWA 3UKDA 2ANCA 3CEMA 1X0VA 2OB2A 2YJ3A 1QSGA 3WFZA 3A2NA 3ETEA 3N6XA 2RI0A 1K4YA 1OGJA 2QWPB 4QUKA 3MAJA 2JNWA 5IARA 5SZJA 2J0VA 3TXXA 1D0SA 3BB3A 4A7PA 1AC5A 1NTRA 3OZIA 5CEJA 2Q6IA 2Y1OA 1BZKA 3H4MA 3R2JA 5HW0A 2PE5A 4WBSA 3AF3A 1W25A 5FI0B 3A6DA 3WYCA 2QRLA 4HDOB 4N3GA 1SUDA 4BVTA 2WIJA 4G86A 2RJ3A 3UJNA 5KHIA 1SRRA 1EMDA 3B1XA 1N32B 3I2KA 1X1AA 4X63A 2KI5A 4V2UA 4O2BF 1Y3HA 4DQKA 4D9FA 5ICSA 1W36D 4XM1A 2W0FC 1ZNQO 4NFLA 2IEDA 4KQCA 1Y8QB 4G0NA 4H9GA 4S1NA 1UWLA 1SETA 3G9QA 3I04A 3M7MX 4F4HA 1EFCA 3WO1A 3UJAA 2J09A 1OILA 2QRHA 5MN4A 4UBMA 2NX2A 3P19A 2V7VA 5CW1A 4MH0R 4DSOA 1PD1A 3I73A 4LSZA 4CNQA 3I64A 2ZRBA 3NRBA 2GM5A 4MTGA 2XOKA 4Z8XA 1YJNV 4JJZA 5EAIA 5AICA 5AK4A 1GZ3A 1SUEA 1V3QE 4JDPA 4Z4GA 4WFEA 3CM0A 2J3EA 1CS0B 2CLLB 3JQFA 3KUKA 5ITWA 2QLMA 4IGFA 1T0PA 1QO0A 3K94A 1T6ZA 4ZK2A 3WB1A 2X1LA 1R64A 5EP4A 4LGVA 1F2VA 3W5CA 1WXXA 2RNBA 3WQQA 2NWQA 2QRGA 4KQIA 1UXGA 3W9BA 3DBVO 4ZI5A 4DNPA 4RZIA 1RWOA 1QVZA 3AOEA 4LF5B 1DOHA 3QVJA 1ZUWA 2DY0A 4QDXA 5K0FA 1CUWA 4MHOA 3F78A 3RQSA 3SJUA 4LP8A 3TTXA 2AI2A 4ZA2A 4DLTA 1W55A 3EDQA 3RS4A 1XCBA 3DZCA 2IYTA 1ZISA 4GZ3A 1ZNYA 4IFBA 1RABA 1U3DA 3S28A 2OD7A 2ZJ1A 3QEKA 1S4QA 2CSLA 1DC4A 1PHRA 4RSMA 2CXPA 1NKDA 3BD9A 1PUJA 2F4NA 4MWDA 5DW0A 5IY5C 2C0CA 3W6NA 3WP1B 3EEQA 3SHWA 5I7AA 2CD9A 1DZIA 4DK0A 1JI3A 4G1VA 3RG8A 4D96A 5I7FA 4ML3A 2ABWA 3DONA 1C0KA 2HZBA 3E9QA 1VQNV 3QQPA 4IV5A 4K03A 5EJAA 3ZS9A 1P7CA 3BRWD 2ODNA 2RK4A 3FXAA 3NKLA 2R8PA 1R0CA 1XKXA 4FGZA 4RFSB 1MKYA 2PMCA 2PT9A 4N9QA 5HIIA 3I3SR 3SC2A 5I5GA 4UHJA 3SR0A 4O08A 3U1BA 2CSXA 3PQCA 2VJBA 4WZ6A 4UBJA 4NVRA 4JWKA 3TQHA 1F4NA 4J1TC 3E9NA 1P1CA 5JATA 4IIVA 1G19A 5JMWA 3D3NA 3HA3A 3W6UA 2PX6A 5B66Z 1YFKA 2X58A 1B15A 1GQYA 5I8PA 1F3LA 2VRBA 2ILMA 3D7NA 2QTAA 3QVUA 4JI4B 3SJ7A 3JD3A 1JEOA 2HTFA 1JNYA 2GF2A 3AG5A 3KRTA 3OE1A 3GFTA 2R6R1 4Q3LA 5IYDO 1AZWA 3SYTA 3AFNA 4IAOA 5HKBA 3ASUA 1ABFA 4BC0A 3BSFA 4QUIA 3CCUF 2FWMX 2ZIWB 2Q67A 2A0YA 2OORC 3A3KA 3GJQA 4V0NA 3N8HA 4AMGA 4ARCA 2X8WA 4PYNA 2FEMA 3B09A 2O50A 1ZH4A 3UK0A 1ZJ5A 4MMYB 4WACA 2RHGB 2EQAA 5TXGA 3UOAB 5JHGB 5JAMA 1VYHA 4PPQA 3W8FA 3ADCA 1FFAA 4CBCA 3O91A 3OG9A 4OJQA 4ZEWA 1J5XA 4MCIA 4I4TB 4NAVA 2EZ9A 5TGTA 2RBGA 5HKLA 1FQJA 1ESDA 3VOSA 1RYZA 1FDIA 4GKKO 1CEXA 4CMEC 3AHEA 3PHBE 4XDZA 2ZUCA 3K6KA 3WWDA 4DV5O 1IPAA 2R86A 5GTIZ 2AXNA 4I7EA 1XTPA 1T1EA 2V5AA 3U49A 4J4HA 2GA9A 2VSFA 4O2AF 5B1HA 1C80A 5CA1B 3ZWBA 1JHPA 3GJ8A 2Z1FA 4AJEA 4B76A 4DNQA 2QTVA 1KRHA 1CE8B 4YCDA 4L1KA 1TRKA 4JQCA 1O96A 2RH9B 1H4QA 4EAQA 5CM2Z 3DAHA 2WPNA 3CHYA 4RLHA 5M3BA 1VQ5V 2ZYDA 1QYVA 5JQGF 2FE4A 1ZRSA 2ETNA 4UUBA 1PGNA 3V9PA 1XLTA 1E3LA 3W9SA 4EX7A 2ZS7A 1XQ1A 3RE3A 2KW5A 3K9GA 4IDEA 1QP8A 2YYAA 4FHFA 3GJZA 4EVIA 1S2NA 1D04A 1Y0BA 1X92A 2ZBUA 4TSFD 4OLJA 3VPAA 1L5SA 2ZWPA 3M82A 4I66A 1JLLA 2CCJA 2ERXA 4KVZA 2OO7A 5A6SB 3T15A 5BP7A 1TK9A 1WXWA 5K2OA 3D3IA 4QULA 1T5BA 4LCJA 3RR2A 1JLKA 4RKQA 4ETIA 4K26A 2UUPA 2X1HA 5FP0A 4AJOA 4FGWA 3OMAB 4B7CA 1J97A 4DAEA 3L7CA 4EJ6A 5AJUA 4R1QA 3DDOA 1VHWA 3DUWA 2XNCA 4JJ8A 4PO1A 5C1BA 2J48A 5JSZA 3GRYA 1P0IA 1FA9A 3BF7A 2UXDO 1WNFA 3IVRA 4KXQA 4MUEA 2W7TA 3AC0A 3B1KA 3KFLA 3NV7A 2AF3C 4K9DA 421PA 5LM3A 5EWMB 5LQMA 2WWRA 3CR3C 3B5EA 3NDIA 1N9GB 1BXKA 4OQPA 4EO4A 1K8RA 4YQZA 3PXCX 3T7EA 1CFJA 1FTSA 2B9VA 3CC4F 2FG7C 3EFOB 3QUCA 3AEQB 4NV1A 2BKUA 2D4HA 4C30A 5BR1A 4EYQA 5BNIA 4DWWA 4KBFA 4KXLA 4TXJA 3QE9Y 3KKLA 1R4ZA 3AB7A 3KTOA 1X7ZA 4RHUA 4C78A 2FK8A 1RXYA 1Y8AA 3AF4A 4QOIA 1P7PA 1J2UA 1TD1A 3SEZA 2Y1WA 1LKZA 2BSXA 1DX6A 2LBTA 1P0PA 3UK1A 3VH3A 2MSWA 1V9PA 1KQOA 4GOXA 1R4MB 4PC1A 4V2IA 1AQJA 1TCVA 1K92A 2GHRA 2QJWA 1XTJA 1EGVB 2R84A 1Z7WA 2X86A 1O6BA 4MRMA 1UIRA 2A0FA 2F90A 1JGTA 3OY2A 4RHTA 1LNQA 1JKXA 2PJDA 1AI7A 4DSAA 4ZMSA 3MWDA 3WLPA 2NNUA 4LFAO 3GDGA 3H99A 2ZYRA 1VE7A 1LPMA 2C9OA 3DTYA 2XWJI 3K2BA 2H2FA 1I94B 2F7SA 1W5EA 4FUQA 4IKOA 4OO3A 4EGAA 5IAGA 2CHUA 4OU4A 4F5EA 3W7AA 4BQEA 3BWYA 3D8SA 5JS2A 2FX3A 1TZMA 2DUWA 4RZHA 2PIAA 5IANA 4GKJO 4OX9Y 1BCRA 5K0ZA 1DPGA 4KQXA 3AERA 4CEIA 1IZ9A 3FUTA 2X9NA 3N2LA 5SICE 4I4CA 2EJBA 4URVR 4UOZA 4JI0B 1FP2A 1E3WB 4QT0A 3RVBA 5A03A 1MAVA 1ZIYA 3WLKX 1W47A 1X1EA 4Q1DA 3EGDA 4GNKA 4Y67A 4OHCA 4WLUA 1DXQA 1BVUA 4GUDA 4NEGA 4H0NA 3DV0A 5M29A 2CGEA 3AVPA 3Q5DA 3BZBA 2O1WA 3UCXA 3RVOA 2GNOA 1CB7A 1Z73A 2FPGA 3AFIA 1DC7A 4E2XA 1ADYA 4K6MA 4HVLA 4ZDJA 1KTVA 1X9HA 1A7KA 2A3NA 1GLGA 3GJ4A 3LHFA 1M8FA 4PTYA 3H3JA 1K5HA 4RUFA 1OXUA 1X1QA 1A9OA 2GPWA 3H3XA 3JQ7B 3RU9A 1QNMA 3JWHA 4E51A 3UH0A 5IUJC 3DB1A 2NZ2A 3ZRXA 1D9XA 1F2UA 2AT1A 5E2AA 1O57A 5FOQA 2JZNA 2DF8A 1VE5A 1HE5A 2IQIA 2I4NA 2JEZA 4KDRA 2CJWB 1U4NA 1ETHA 3JR7A 4PYQA 5YASA 4BGVA 2W6NA 3RF6A 2H5IA 3F7TA 5AUPB 2BEUA 1P84F 4BVRA 5F52A 4GEGA 2F43B 2J0SA 4GHWA 4D79A 3M6LA 2OORA 1DX4A 2CGOA 2R47A 4NCHA 2LWIA 2HMVA 3QBJA 3EVCA 4G25A 4HDSB 2OFFA 1IRXA 3R5HA 2NU8B 3MPUA 3KPWA 3FPLA 4H2DA 3DVSX 4LE2A 1XZGA 1BJTA 4R68A 3FTQA 4K9RA 4AI6A 1UDXA 4H60A 1F12A 4E2YA 3HDGA 4GPZA 5T64A 1ML3A 3L06A 1XN4A 2EF0A 1SGWA 2CKMA 4L3VA 4QHYA 2O3TA 3VR2A 1RBMA 3TJTA 3ZHVA 1FLAA 3CRAA 2Z1MA 2ZXFA 3KUXA 4MGYR 4PHTA 3CG6A 2Q07A 4EKYA 5GONB 4RANA 3R9IA 4GYJA 3RS9A 4IHQA 5EJ5A 2FP4B 2PL1A 3VU8A 5ALUA 4GBED 2VWQA 2PH5A 1OYVA 2ASVA 5M7EA 1GUFA 2WU3A 2QAGC 2EQBA 2P79A 1QTQA 3SYPA 5AVVA 2O2GA 3G23A 3NTVA 3P7MA 3IAUA 3AFMA 4FEEA 1ZOIA 3R0IA 2G63A 1DBVO 3E8SA 3CMAV 4FVTA 4PFQA 5D5HA 4CQLB 3I5XA 4URWR 3G71F 3MMXA 1QNLA 2BLNA 2Q8QA 5CGZA 4QTYA 1PFGA 1RLIA 3UH1A 3UMBA 4WNAA 1X7WB 4IR7A 2Y05A 3F5MA 4G5FA 4UULA 4WA8A 4GX0A 1KGDA 3FKSD 4C3ZA 3BTSA 4D02A 1Z13A 4GDMA 4PSDA 3FG9A 2GBLA 4GDFA 3NDBB 1RXSA 5EJIA 2ZR2A 4QM7A 3M6IA 2QI9F 2DLNA 3ZRSA 2YNMC 2GNAA 5EIAA 2WT4A 2MHCA 1ZM2A 3S02A 2RONA 1WG8A 1U0BB 2WHYA 1EYZA 2WF7A 3RD5A 2PCJA 1L7NA 2PMFA 3SJQC 1GRJA 3CE9A 3IQDB 3ACBA 1WUYA 4OGWA 4U6SA 4QRHA 1GKIA 4W9NA 5EESA 3UC5A 5JCZA 5GAJA 1V3UA 1QLEB 4IQ0A 1G9XA 4IXMA 2RJZA 1NN3A 2UUCB 1TIBA 2UYYA 2I4TA 3ENVA 4B4WA 1UXJA 3WMRA 3ZW8A 3RJ9A 2IBSA 1SD2A 5F5LA 3W7WA 3UZUA 2W58A 4F8EA 3HNRA 3SDSA 4LVOA 3ABIA 4BN0A 2Z6QA 1VSTA 2I87A 3KAJA 2GKGA 1CQXA 4DUPA 5KHLB 3T9AA 3CEJA 3W9YA 1KEEA 3L8FA 1VPTA 4U8GA 3HB5X 5THXA 1TYCA 1IBKB 1N6LA 3R5XA 4BDSA 5LQNA 2Y0PA 1WRBA 3L0DA 4TWIA 4UOQA 3LNTA 1I4TD 2YHIB 5H7XA 1UKBA 1E1RG 3FB4A 3OU2A 5E4FA 1XZ8A 1KK3A 1G291 5DCLA 1HO3A 5L3EA 4G0UA 3BRWA 1I0LA 2YDXA 1U0TA 2QTMA 1DRJA 1KGSA 3BICA 1YZUA 4K81B 3ZJ4A 4FLWA 1N5LA 1JFTA 2FFJA 4L72A 1RPRA 1DXHA 4J7AA 3OO0A 2Q5JA 4JI8B 3EZNA 3ZQ6A 1A4XA 3M5CA 3VJLA 1VH8A 1E18A 3O73A 4RD4A 1EEHA 4DUZO 2MSDB 3NEYA 3NR7A 4X7MA 1CIPA 3FM9A 4IQGA 4E13A 3RGWS 1DWQA 3D7RA 4MUIA 3IESA 5JWHA 2REQB 3WGKA 3DBHB 4WBXC 4B7XA 4NTYA 1U2SA 3ERNA 1R6DA 1C30B 1X4TA 1JA9A 1GPJA 1OZFA 1CVRA 1WZIA 2MR5A 1R7RA 3B6EA 3ABKC 2X1VA 3OIDA 1W94A 2WFAA 4R8LA 5DNEA 2XGSA 5DLPA 5EWJB 1U1GA 2D2XA 3Q9SA 4E88A 7YASA 1J07A 1XVLA 2WAAA 2ZIUB 3QOWA 2RHBA 4UB6Z 1IOLA 2WJZB 3UJ6A 1XQYA 1XZMA 4J9VA 2OCKA 4S2EA 1ORDA 3AV0B 1KEEB 3WBBA 3QIVA 3A6PC 5EBLC 1W59A 2C9CA 2J4FA 2R4QA 2GT1A 4YALA 4RWEA 3BRCA 1LU9A 4WCFB 1FXKB 2GN4A 4YMGA 5LR6A 4C3UA 3ETHA 4XARA 3TB4A 1Q43A 1VHDA 3OBWA 4PYRA 3OZSA 4AZTA 1O6GA 4YUZA 3BGWA 1BYIA 5G0WA 1RBQA 2AFIB 1QHHB 5DM60 4Y2UA 2PYDA 1M10A 1W5AA 2ODMA 2P9QA 3EZLA 5DTMA 4C8EA 1HPLA 4OHFA 2OIEA 3HM2A 3RS7A 4YT8A 2F17A 2LRHA 1JXMA 2Q41A 3ORSA 3WB2A 3G8BA 1ZZEA 2MWMA 5E6UA 1UK6A 1SC5B 1N2EA 2YXBA 4DRXB 3NDRA 3JQPA 2QGNA 2V4ZA 2EZ4A 2WA1A 3FPHA 5GJCA 1GA1A 3G2JA 1LZLA 3ZNNA 4JI1O 4UDXX 3AZQA 1Y66A 1GUBA 1N0WA 5AW8A 2V1DA 1F20A 1AA9A 5EZQA 5AIBA 4UUQA 1EZVH 1XZIA 1G20E 4LPKA 7ABPA 1ZRNA 4EQ6A 4TKVA 2NV2B 1DGQA 2W6IG 1RCFA 3GIDA 5FUYA 4HYOA 4F9GA 2QX8A 3CB2A 1FXWF 2DR0A 3HO8A 3KYJB 2G1PA 3HS3A 4CQNA 2GHTA 4M0PA 3QF7A 3IOMA 1CY1A 3K04A 4UM8B 1WXGA 4BLWA 1GNLA 3RFXA 4LNUB 3L4BA 5KVCA 4YEDA 1YJAA 4RVUA 2ESRA 3D2AA 2QYOA 4WFKA 2F93B 3KR0A 1V3TA 4FUTA 1AVMA 2IWHA 3LC1O 1CUGA 3A2MA 1OVGA 2XNDA 3E1SA 3FVTA 4RK5A 5DX8A 3VVMA 1V5GA 4L4UA 2BTUA 4P98A 5I9TA 3PB3A 5BSKA 3O65A 2QT0A 3I8OA 3LUFA 4MMZB 4UXHA 1CEZA 3Q1KA 2G04A 2KMLA 3AEQA 1BMDA 2VNJA 3QEMB 1OY1A 5TS3A 3ZWNA 3I56F 3F4KA 1VF6A 4MUYA 2ICAA 4AZVA 4QTUB 2ADPA 1IXYA 3PJRA 4U02A 1Y4ZA 2BJVA 2BMWA 2ZJ2A 4ZEVA 1PNRA 5JBQA 2NSHA 1GWNA 3DW3X 1HLDA 4F5YA 3NTQA 4H6PA 1GTZA 1ZMTA 5IK2A 2HZ7A 3AVUA 4E33A 1HE8B 2VOEA 4ETMA 4Q3AA 2I6SA 1UKAA 3I32A 2DKNA 3K5PA 1FFWA 1T3HA 2HQRA 5D85A 4NK4A 4UEJA 3X1MA 1YRAA 3L71H 2XMCA 2IYEA 2PL3A 5IKMA 2D3OW 1BHJA 2GO1A 4JI6B 2VIIA 4KLNA 1TNDA 3T8YA 4CC6A 2ALEA 1FFEA 4L7QA 4FFRA 1PSZA 5C80A 2VRZA 3JQGA 1JOYA 4UVBA 3L05A 3GQBB 4IIHA 2JIMA 2HWXA 5TT0A 1KARA 2QG4A 1M8JA 1ZUIA 3D2CA 5CH3A 3WK4A 1GHTA 1MJHA 1SMKA 2XYGA 2XUJA 1CULC 1M1YB 1W88A 2I3ZA 2LIPA 4Q48A 3CVYA 2ZT5A 2CLKB 5HXZA 2KTVA 3SJBC 3GMIA 2OV4A 3HDTA 2EJCA 1NTOA 1S3JA 2FKXA 1YDEA 2FHPA 1UBEA 2PZGA 3PPVA 5ESRA 1C7IA 3IAAA 2HFKA 4JU9A 4LS3A 2Q1UA 1YRHA 2GJ9A 4EUSA 5B6JA 2H2AA 5A5GA 1LPOA 5L3BA 2FQQA 1NOIA 2EJWA 3FOCA 4LJ4A 1M1ZA 4MVWA 2Y27A 2FFBA 3IMGA 3WK7A 3NEAA 4I5FA 4DR2O 1CB0A 2F9MA 2OFXA 1DKNA 1GAEO 2W4IA 2GWRA 2H1SA 1EA7A 2XCOA 3SJCA 3I6QA 4DGSA 4ZKIA 1ECBA 3DPUA 5AK0A 1TUIA 4Q9DA 3RSFA 4CR6A 1TIPA 4ZBMA 2R8OA 3F7OA 5AVUA 1H8EG 2HHHB 1XUOA 4N0EA 4YQYA 1KI3A 1Y5NA 1FNMA 1G6HA 5DX0A 2IBMA 1EFKA 3E70C 2GJ4A 5DYGA 1KNJA 4EG5A 3ER8A 1WKCA 3JR3A 1JDUA 2W2LD 3CG0A 3GGSA 3RAPR 2JK1A 4ZOEA 1WD7A 4BT7A 1Z4MA 3R6DA 5EO3A 3GFRA 4CH4A 2XSZD 5FKJA 1ZBQA 3N75A 5L3VA 2V59A 3UA3A 2QLJA 2ZSIA 2GSWA 1N1GA 1YUNA 4BTLA 1XRSB 5DNWA 3WNVA 4X64B 1YB7A 3OQVA 1IU9A 1K9VF 2ZBEA 4MR8A 1ODKA 1X39A 3CV3A 4EFMA 4X7PA 4LYFA 2IGBA 2PLFA 3ILYA 3REFA 3K1AA 4GI7A 3SOPA 3VKUA 2X0FA 1IUNA 3VR4A 1FF9A 4TT3G 3GLIE 4W82A 1JR2A 2IHTA 3H5NA 2ON6A 4RCYA 3I52A 1ESMA 4QKQA 1YUMA 3FYUC 2QI2A 2RHMA 3M3DA 3TVDA 5FLYA 1NBOA 2PQ6A 4J4TA 2JNBA 2GFIA 2HK8A 1WHTA 3C7AA 2MYPA 2RG1A 5ENZA 1SVOA 4CMCA 4F4JA 1BGVA 2XKJE 2ZR3A 1X6VA 5JSZB 1QE3A 4NB5A 4ZVOA 5C3UA 4MUGA 3IEVA 4NZ9A 1S72V 1NQ3A 4HNUA 3ABRB 4YA6A 4C2TA 2H0QA 2CHVA 1JHQA 1X52A 2HRZA 2QZPA 3T1HB 3OTFA 3UWSA 4PXSA 1XALA 2AQIA 3PGKA 4J7JA 1WHSB 2IP1A 1X3SA 3B78A 3EF0A 4RZSA 3ZWMA 4BMOB 3VDQA 3FFQA 1X1DA 3FAKA 4C4RA 1QCEA 1PZHA 3SR4A 5EHNA 5IX8A 2O3SA 3N27A 1YI0A 3Q3IA 2UZ4A 4GGMX 3PJSK 4O4LF 1VQ9V 3TTWA 1PNKA 4CLDA 1W1WA 2XNDD 4L9SA 1ECLA 3MGKA 4JXJA 1DEKA 3NCTA 1SWWA 1X94A 2FRXA 3WDKA 1BRMA 4BO9A 5KEIA 4KWEA 3LWPC 2XODA 1U02A 1XQ8A 5KHGA 2C78A 3NS7A 1FSZA 1TFUA 2GN9A 2WV7A 2DRIA 2YFKA 3KKEA 3VSDA 2YZKA 4UFOA 1VJ1A 5IY5B 2AKAB 1IE3A 1XTVA 1VJ0A 3ML1A 3Q3VA 1QS0A 4NCIA 2GXQA 4WCFC 1ROPA 1PGQA 4MA0A 2ZIVB 2EJ7A 2AFHA 4PZEA 3E1GA 4IKEA 1UXKA 3NM4A 3DDWA 3W2HA 4U7NA 3KDPA 5EFOA 4P3YA 2WICA 2P77A 1NH2B 3SXPA 1T6XA 4J41A 3DTVA 4MVJP 4CM9A 1OIXA 2VJOA 4NJMB 1EUYA 3VAYA 3PZRA 1SO8A 1WO8A 4NK5A 4XFKA 3VHXB 3ABLC 3V1LA 2BRUC 3AHDA 1V25A 4BLQA 3AX6A 2PX4A 3CCSV 1U0GA 2IDMA 1V0JA 4FQ7A 3VR2D 3AGPA 3A9UA 4Y2SA 3WMFA 1MFPA 1MQSA 3TVTA 1ABBA 4FGKA 1QBKC 5FAXA 5HUQA 5JBIA 1VIMA 1NW3A 3HB7A 1UDRA 5AUOB 2DY1A 2OXEA 4MR9A 1J99A 1XEQA 1BWQA 1JIXA 1K6IA 2ZGVA 4Q7JB 3CCJF 3MMSA 4QX6A 1ZHOA 1QF9A 1N3BA 1L5YA 2CCGA 1GV1A 2H1RA 2VAXA 3K9BA 4UXJA 2X41A 3BE4A 1B2LA 1RI3A 2YMMA 1XNQB 1EWVA 3ZD6A 4QNMA 3EPKA 4QRIA 3SLKA 3THXA 1XEWY 2C2KA 2VCHA 1W36B 4E5PA 4G0OA 3RDPA 5ALOA 3TW0A 2R00C 2ZYUX 1NLFA 4F7DA 2HAEA 2QW1A 3AJ9A 1J2TA 1F0NA 1K5GA 3G89A 2YC2C 4OEHA 1DBIA 1GG2A 2GXUA 2I78A 1PGOA 2WSSA 1CLEA 3WL7A 1C3VA 4M9UA 4DLAA 4E7PA 4K6CA 1J2JA 1YB1A 2JDIA 1RTKA 5SY9A 2OCCB 2KB0A 4KN5A 1DKLA 3IEWA 4UM9D 4KACA 1W4BA 4FN4A 3SEAA 1JLMA 3KB1A 3LDUA 2X0EA 4BO5A 5BVGA 3TAUA 2WOJA 5HTKA 2M6YA 1NR7A 1NA5A 1XRRA 2H3HA 2WYUA 4NF2A 4I08A 3LKZA 2IYAA 2ZYHA 3W8EA 3O95A 3DFUA 3KTDA 1Q77A 5EIEA 2YRWA 4XVRA 3DMFA 3UMYA 4U1RA 2CC2A 5JEDA 3D6JA 4TSRA 2C0PA 1L4YA 4DUYB 2EFYA 5AW3A 3DZHA 1M2EA 1Y5LA 1YTFB 2JFNA 1K8AH 1IHDA 1SVKA 1YOBA 3AESB 3G0OA 3P4UA 2ZXWB 4M22A 4MLCA 4RL6A 5BR7A 3PTLA 1NMYA 1ZINA 4IL6Z 4MR7B 3UMMA 3JVUA 1N9KA 3L5OA 5CBGA 1W75A 1RI4A 2ZRMA 3HAXD 3KWMA 3O7MA 2F1KA 2JD2A 4PZ0A 2QAJA 3K2IA 1BD3A 3NMUF 1TE2A 2Z5LA 3PNLA 3QYPA 3COPA 4Z0PA 3W5SA 4CM1A 1Y9AA 4YMIA 3UO8B 1Y89A 3LZDA 1BQEA 2EAUA 3ZRVA 3RADC 1Z5WA 4ZK6A 3IDZA 3G4SV 2HJGA 2H3EA 2AZ2A 4IDQA 1U8XX 3AR9A 3F0GA 1KZ7B 4NBLA 4WD3A 4YJHA 3WBKA 3ZU5A 1F06A 2OYRA 3RJZA 1E61A 1ISHA 3DEJA 1B26A 4JHLA 1GP2A 4UVIA 5E6RA 5IJ9B 4XD7A 5E6UB 4IIBA 4CMIA 3IUSA 3D00A 3JQGB 2O19A 4F3KA 4MGEA 2XAFA 4CFYA 4Q4HB 2X2FA 5HQJA 5BSEA 4RDHA 1DO0A 2F3RA 3MJ4A 1K7CA 2PZLA 3C3AA 1R0XA 2DE0X 3HFJA 3GZJA 2CKDA 1ZHHA 3AU8A 4MSUA 4ZI7F 1E3IA 3FTPA 3ZY3A 1GKUB 1Q44A 1DJPA 2IU4A 5HKKA 5AI4A 1RBYA 3FZNA 1YBAA 4H7JA 4M9RA 5B1IA 4N0QA 4LQDA 2RQ6A 1CQZA 5LMNO 3RW9A 4OAOA 1XDZA 2MYTA 1FFYA 1CK4A 2B92A 3PEFA 2EARA 1OGIA 2IOQA 3DE6X 4Z2WA 3IOCA 1MTOA 2ODBA 4LYEA 5KNDA 3ZLBA 4LWSA 3OFSA 3QX3A 4OBWA 1QGUB 3T1HO 2J9FA 2V4UA 4MINA 3VR1A 1H2KA 2V3WA 4UFZA 5TISZ 1FX1A 3BJEA 3EF1A 4J7CA 1GMGA 4O2LA 4NKGB 3TDKA 4EWLA 1J7JA 2Y71A 3ACDA 3DAPA 4G0XA 2IFTA 1AMOA 1VA4A 1TM1E 2C9YA 2Q9UA 1H8ED 3IXMA 4HAUA 1GTJ1 1UJ4A 1I3NA 4X62O 1E5LA 1Y82A 2HIHA 3C4VA 2FNAA 4UVHA 4B6OA 4C6HA 1B1CA 3FNIA 1ZVJA 1VL6A 4KUHA 2HA7A 2KM1A 4MAFA 5EBMC 2RDCA 3E9RA 4X7RA 3S2UA 3QV2A 3I55V 4DIOA 2ZAMA 2G38A 2CDNA 4AHCA 1VIDA 1E5DA 1P8JA 3EJWA 3H8WA 3G5UA 3FYTA 3QVVA 3T7RA 1WE2A 5CN0A 4ENSA 4NEQA 3ICXA 2O05A 1WX1A 3K0FB 4IDDA 3V00A 1SVSA 2P90A 4BO1A 3OE7D 1K68A 2WT8A 3B3FA 4UVGA 4DG9A 1RZRD 1QQBA 3I8XA 4HGPA 4Q1EA 3WHPA 1AMNA 2A30A 2ZR0A 4O4LB 4WK2B 5J2UB 1TF7A 1X1BA 1PK8A 3L77A 4AYWA 3ZDQA 1TUEB 1JPJA 1BSVA 2ZRLA 4M1OA 4FM9A 3RFUA 2E48A 2G6BA 2ZEJA 2ZB7A 2H8KA 1XP8A 1LB1B 3K03A 3W7XA 1T0BA 5EJ6A 2JLCA 4ZO9A 4AXXA 3VOBA 1PQYA 4MGKR 1Q7GA 3D9QX 3D6AA 4W8HA 4DRXA 3DB2A 3WIEA 2R6CA 4LZAA 1G6UA 2HSEA 3IPYA 2OAQ1 3UMJA 4AK9A 5KIAA 3ORHA 3BRSA 3ZWPA 5HR5A 2QMYA 3P3PA 2HK6A 2PVSA 5LBIA 4ANFA 2WD7B 3W5DA 2OXCA 4P53A 4A0GA 3E22A 3EIXA 2H7YA 1K63A 1LPPA 2JAPA 4KQMA 3ZGXA 3SZLA 1A9PA 1I7SB 1FW6A 5FUMA 4HOYA 2Y1KA 4IP0A 4FFVA 4MMXB 3MBMA 1QCZA 3MCVA 4OYLA 9LDTA 1HOTA 2IK8A 2HLDG 2R11A 3L9XA 4KQFA 2ZYAA 1SPBS 4CCWA 4GUAA 4ZGBA 3LPDA 2WSSD 5EPUA 2CV2A 4X1YB 2I1WA 4MW7A 4WCFA 3JTMA 2FRDA 4Y2YA 3I2GA 3R74A 1RWPA 4EJSB 3ORQA 4GYYA 4YAGA 3QE4A 3UTCA 1TMKA 1ZX3A 5IM5A 4MPJA 2DFLA 4GQBA 1KBOA 4PLPA 2A84A 2EW1A 5AT1A 4AXBA 4ON9A 4RJKA 5LZ5A 4UE6A 3RFCA 3OUSA 1AR5A 1UPAA 1PFUA 3EZ2A 4DIFA 2V03A 1QP7A 4ENPA 2J30A 2CTPA 3CCRV 3MYYA 3TOSA 2P27A 3NP9A 4M9QA 1R18A 2CW5A 4YDHB 1AOXA 1QFYA 2H9AA 1C3OB 3QEMA 1V4BA 1CIVA 5JQGB 2E5LO 1JJBA 1GR1A 1XZJA 3BE5A 3R24A 1L5LA 1RAHA 6REQB 1NUUA 3S8EA 2UAGA 3PC7A 1KEPA 1OW3B 3Q41A 5IFKA 5JT1A 2FXIA 1VJGA 1L7QA 1Q90D 3DXFA 2VA8A 3PC8C 3EJ6A 4UTOA 2PZAA 4OQEA 1VGRA 5CBFA 1N0JA 3BABA 3ON5A 1RM3A 1NQUA 2HMYB 2EBOA 2VWPA 4EW6A 1O77A 5LL6P 4ARVA 4MUBA 4FDMA 1RXUA 3D7KA 3C8UA 2JAWA 1VHAA 1M34B 2PYIA 2XYHA 4YV2A 2PMDA 2HFEC 1FEZA 2QRNA 3I6MA 1DO8A 3CVVA 1K8ZB 1D5AA 1CN7A 2FSSA 3GDWA 1G21B 2FCRA 3WYNA 3HDQA 4MQ6A 1T91A 3VU0A 3ML0A 1G59A 4PGFA 4JOSA 1OX4B 2IKSA 5JAZA 1BEEA 4MEBA 5K0BA 1GPBA 5JVDA 5C5EA 4I5EA 3LXMA 5D3KA 4IXDA 5KSYA 1BVYF 2PO7A 5KNCH 1IZ8A 4B6FA 4ICGA 1DO2A 2ZRAA 5IHXA 2E4ZA 2PTGA 2WMNB 4KGDA 1H2ZA 4GMGA 4ZICA 4CS2A 1GUYA 4MNTA 2JVJA 3TUJC 1PUIA 2V4DA 1T29A 1NZ6A 4FBGA 4KMSA 5DXAA 3A04A 3G5AA 3N4YA 1IVYA 1UIMA 2C4WA 1EFPA 1UMBA 3A1TA 4HQ0A 4RSHA 4YAWA 1EBUA 1Z2DA 1TQ2A 3MOIA 4G5RA 4AU1A 1UT8A 3H75A 1PNVA 2WT9A 4UV8A 3GRVA 4XEUA 1RDFA 1YB5A 3UV7A 2F9ZC 1XYGA 3PUKA 1GTRA 1SXJA 2QXUA 4HRYA 3UAVA 2I1QA 4YAEA 5HIJA 3AY3A 1VZ3A 1MUUA 1DBFA 3P10A 3RC8A 4PU0A 4CTJA 4UHKA 2J6HA 2QQ0A 3EQ6A 4RXTA 4C0AC 5JFTA 1XMXA 3BA9A 1AUPA 5BMVF 2OYQA 1ZXBA 4RJTA 5KLVH 1V71A 2ZXWC 1MAHA 2H65A 5DN9A 5DNDA 4ZU3A 3ELYA 3Q7IA 2ZPAA 3LMEA 1XU7A 3O3MB 4B81A 4FOOA 3NAMA 2A5JA 4YAIA 4R41A 4AFNA 3OQBA 4IJMA 1WW2A 3L0CA 1A8PA 4LX8A 4OXYA 3W8DA 2R8BA 1ONNA 5EJ7A 1W5FA 3WC4A 3ZCVA 1MT0A 4CQMD 1CZNA 3OM0A 2OBMA 1LV7A 5LLTA 2ZU0C 3SYRA 1J8QA 3AJDA 5B1NA 1E5TA 4BT6A 1R8YA 1V5EA 4RH1A 2AOTA 3WYGA 1TZBA 1XC7A 3FVQA 4IHKA 4Y6OA 5ALGA 4GXRA 4HUJA 4EY7A 4LPSA 3OZ7A 3KVRA 3PDCA 5H02A 3TL2A 2XTMA 3WYAA 5DB4A 3LDCA 3EG9A 3G0BA 4LF6B 3BJZA 1E4EB 1VL2A 3DAFA 4Q24A 5TQ0A 5KNDD 3NAQA 3ER9A 2XF8A 2NAFA 4GAEA 5JBNA 2I67A 4F71A 5T4BA 4FNGA 2I4LA 2IZ1A 4G1CA 2A9OA 3DBOB 2XBLA 3OPNA 4IDHA 4DGQA 3BC1A 5FL7A 5KJ6A 5BN4B 5C7LO 4WHMA 3WX0A 1Z88A 4A4DA 3LH5A 4LCEA 1OA1A 2CXHA 3A4NA 4PA6A 2R8ZA 4NECA 4ADSG 2EFJA 2AZ0A 2PYJA 4WGFA 1QVGF 2E75B 3FAVB 4LZWA 3ET5A 4DV0B 4RV4A 5KCMA 4BBJA 1QGUA 2J9FB 1U1DA 3KYBA 3R6GA 3HUDA 3PNVA 4DBVO 2ZJAA 3SYLA 1IHYA 4B87A 1GX1A 3SK0A 5HE9A 1ZW1A 1OU0A 2DJIA 3L8ZA 2EX3A 1C4OA 4BKMA 3CXRA 3KOUA 2G9VA 4YI5A 4Z86A 3HWSA 4R2JA 1Q82W 4Z9BA 5EMJA 2FFHA 1PE0A 3THYB 2EILC 2IITA 1O94D 2HDOA 3Q8MA 5JJKA 1ZCFA 1VB3A 5CITA 1ONPA 2ORYA 5JJ5A 4FINA 5F5NA 3MFYA 3I0ZA 3WGUA 5U1PA 5F4ZA 3I83A 3P9PA 3F0TA 4NBRA 5BUQA 2XXAB 1STOA 1CUDA 3HJRA 4Q4HA 1TYEB 4NZPA 2XUGA 1WZNA 3CLVA 2QP3A 1OXMA 4LVNA 1WUJS 5CLFA 3W1EA 1DDGA 2L2QA 3ZCPA 4B80A 2GK3A 4L5JA 3K0GA 1YCIA 1RIFA 1CUIA 1QYIA 2IW3A 2ZQZA 1ZC4A 1OAAA 4EABA 4EJMA 3WLQA 2RGBA 2C2ZA 4RF5A 1X7WA 1Z62A 2NXWA 4JT9A 2Q7OE 5KDDA 1G0OA 3V48A 4DW8A 4KR7A 5KREA 5JJNB 2HRYA 2IYRA 4DRZA 3CSDA 4JTDB 1VKJA 3AY6A 4ZVMA 1KVSA 4G4IA 1DG3A 1XCMA 5EJFA 2JLAA 1IZYA 1V26A 1FXWA 3LA6A 5C81A 5IUNC 2ZUDA 5AHOA 1D1QA 4K6HA 1XL1A 5H3CA 3S1LA 3SHOA 3AF0A 4YR7A 1P1FA 3P4EA 2SKCA 5BRAA 3IVMA 5H8WA 1K6JA 3O47A 1O7JA 3G7NA 1FRZA 1K66A 5IWAO 4W9NC 2FPKA 1BA3A 1M2OA 2PTHA 3B89A 4UHFA 3U7QB 2XGGA 3RWBA 4JEMA 3LY7A 2YJ6A 2UU9B 1EA5A 1KNQA 3E9DA 4LC0A 3ABMC 1NP3A 1QYCA 1YE5A 4PE5B 2DHRA 4IHJB 4NCAA 2VQ6A 5ICCA 2FZ5A 1SCNE 1ZC3A 4GE0A 1DDOA 1M54A 2IXTA 3C5VA 5BNFA 3RVSA 4G4WA 2YMQA 3D5EA 2GPAA 3DEZA 1M1KH 1OLXA 2DPHA 4FYJA 4YUVA 1SPXA 1UC8A 1TMGE 4X3PA 2B4TO 2CDAA 5D3MA 4JLDA 1TYZA 1OYYA 1DIAA 2XPCA 3HN2A 4TS4A 5KYXA 1AIPA 1E6MA 2A9JA 4Q05A 2Q8VA 5FJJA 2G17A 1GPMA 3L74H 1LRLA 1O6CA 4FDUA 3ZZUA 3GFOA 5G0VA 5IAJA 4AF7A 1ILWA 4ZVRA 2VJDA 2CTWA 1B8OA 1W35A 2BFEB 2P2ZA 3E86A 2DBZA 4Z3DA 3T2MA 1HLFA 3GLUA 2PI4A 4AQYB 4U2DA 1KEVA 1KO7A 4KLRA 3HJAA 3QWBA 3PWZA 3VGPA 4CKZA 5FT9A 1W0JG 1LBEA 3LUPA 2W6ZA 5K05A 4GZRB 1PNTA 1ULBA 1K5DA 3C3DA 1DPFA 2GVNA 1HFWA 3A6GA 4NSNA 4QGFA 5D01A 4H35A 5JY1A 1IUOA 5E7MA 3COSA 3PFHA 3TD3A 1PV0A 4HWRA 5CRIA 5IZCC 3CUUA 3AO0B 2Y0IA 4JYBA 3CA8A 5DRTA 1SZJG 2FR8C 4V38A 5EVJA 3R8FA 2B5UA 1XNQO 4QTXA 3R7SA 3CVXA 4H7PA 3ZLJA 1IXSB 1ZL0A 3HFRA 4HLDA 4EG6A 1H47A 1U7TA 2V55B 2LCQA 4B83A 1YD7A 3HUEA 3TCKA 3UG7A 5BVHB 3DTTA 3KQOA 3V97A 1Y6GA 2GFQA 5JNRA 5DTEA 4RJJA 2LFRA 4RV5A 2QX4A 4URZR 1GNRA 1H22A 2ZNJA 4PYKA 4UFPA 1FZTA 3LL7A 1M6EX 3EK2A 3GLTA 4V0SA 1XNGA 1PTKA 1Q0TA 1A76A 1RM5A 4DREA 1XPUA 1U63A 3DE3X 4R1SA 4OH7A 2DH6A 5H80A 5JD5A 5LYJF 1Q6ZA 3Q8WA 1EB8A 2NN3C 4IEFB 3HSKA 2G9QA 4MX8A 1QAOA 5CGQB 1GY8A 4B44A 4B3XA 2V6IA 4BATA 1PM9A 2P4KA 2W48A 1WF3A 3IQHX 3O2QB 3V32A 1C81A 3GWGA 1U2PA 1WXHA 4D42A 3ZHRA 5LKAA 1PJ3A 2IXDA 3B9PA 1NX6A 2FW1A 1V41E 2FDRA 2CDYA 2WC1A 1QP4A 2W43A 3KYDA 3V3TA 2HLDA 3C9TA 3CCEF 1YZLA 2EG5A 1U04A 5JMTA 2G8LA 3DAGA 4DV4O 1Z5VA 3O8NA 4HN2A 4PZ9A 2VF2A 4AJPA 5B4VA 1ZIXA 4QBFA 4X92A 3I34X 4EW3A 5INTA 5L95A 3W7SA 2G1UA 2DPYA 3HJFA 2YCLA 5TMPA 2Y99A 1QONA 1QH1A 1BGYH 1ENVA 1UF9A 2Q45A 5EPEA 2ZRJA 3E3LA 2DBQA 5GANK 3F1LA 4XDHA 3M1AA 4UHEA 5C53B 4ABYA 3LX8A 5KTOA 1GLVA 4DXHA 3KLPX 1Y8CA 3O8LA 13PKA 4X8MA 4ND6A 4B43A 3VVLA 1AA6A 3DQPA 3N2NA 4KV9A 3P9CA 4AUKA 2CZQA 1FRNA 3IDAA 3JTEA 4A0RA 1HEIA 3Q5GA 4C14A 4J90A 1BQ3A 2QJFA 4RA9B 1Z25A 3EH1A 2X4DA 1K6XA 2WFLB 1BE0A 1K88A 2X0JA 1FNSA 2ADMA 1N3YA 3OCZA 3ODGA 3LUGA 2RAFA 4I2NA 2XOKG 3NUZA 3RVJA 3DUFB 3QA3E 5HP8A 1EGAA 3I4FA 3S27A 4OHUA 4OXNA 2V7GA 1I32A 2HHAA 2ZZMA 1V43A 2GBFA 4I0XB 1AUVA 1WU8A 2CLOB 4DO2A 1SB8A 2AL7A 2HCJB 4HDKB 4PYMA 4QASA 4S35A 1SHJA 2HQOA 4RH0A 2YZGA 4PDLA 2EZOA 2PKQP 4YIHA 3VNVA 3VH1A 3U4QB 3B13B 1S5JA 1QHEA 3JZMA 3RUDA 1UFYA 1VJCA 2OTLF 2J0QA 5ICFA 3ZV6A 4E32A 2QN9A 1ZA2A 5LLSA 4MZXA 2AOVA 3RVPA 5E3JA 1YXMA 4AT1A 2ZE7A 2CUTA 4RTOA 1OFIA 5BORA 2CXOA 1IK6A 3VNBA 3WZLA 4LXYA 3RT7A 4ZIBA 5K4HA 1XHEA 1SQVH 1M72A 2AB0A 3BIXA 4DA0A 1J23A 2VYVA 1H85A 4TMZA 1H3FA 2WHQA 4IGGA 4QUEA 3UMVA 3U80A 3VM6A 3V4FA 3UG6A 4E14A 5EJ4A 3M6MD 1RRGA 3I0NA 5KOIA 4OB7A 3L73H 1CDDA 1W44A 3OFND 1HK7A 2XVZA 1G3IA 2J3JA 5G40A 2IJKA 1WMAA 1TTHA 4TUYF 3E8BA 2C3PA 2ZUBA 3OE7A 2B1RA 1XRNA 2CXXA 4FZRA 2IOYA 5EYPA 1E5QA 1LWNA 3NGXA 5BRJA 3EC7A 1DIHA 3K70D 2O7VA 2O3RA 3RT9A 3WNBA 2CVFA 2AEJA 1M34E 2EP5A 2XCLA 4FGUA 4RX1A 4TXNA 1BE8A 1YVEI 2W8ZA 1KJJA 1ESNA 4HGZA 2DVMA 1TLTA 2FG5A 3RFVA 1PR6A 3RUAA 2ZFUA 4YRNA 1NGSA 2PLNA 1RMTA 2WJYA 1Z5UA 2XUAA 1JTFA 1AN0A 2C2HA 4LTNA 4LY0A 4P8RA 2P3OA 3MJEA 4DC9A 9GPBA 1FKAO 1FBTA 2R6GA 1RKXA 3K53A 2HGZA 5JMPA 2B78A 1CY8A 5JECA 3EZ6A 4MWBA 4JBWA 1I51A 2YNMA 3H13A 3KELA 2J3MA 4DMHA 1F60A 1LFAA 5CB4A 1AURA 2QNIA 3BD8A 3CQ9A 3V3KA 3Q3EA 4DIDA 5JS6A 5GVRA 1EP2B 4Q7QA 1N2OA 3QHAA 6ADHA 5F3WB 5C51B 2VDRB 3GO4A 1EWKA 1FPQA 1RPNA 4ER7A 1HDGO 3G8YA 3WLMA 2BFFA 3O8CA 3DW1X 3OPYB 4HN4B 4RIGA 2XT0A 1MD9A 3WZMA 1Z26A 3PICA 4AUEA 1ICEA 1IJKA 3ABMB 1N6IA 3C1UA 5D1HA 3Q0IA 2WU4A 2ZRNA 1ZNXA 1DBPA 5FR1A 1CG6A 3C8MA 2AW9A 3MTDA 1SXHA 1J8DA 2N04A 1CQJA 3VHQA 1CPYA 3IUPA 1C1DA 3GJ3A 3LUAA 4RELA 5DBEX 1FE8A 3DA8A 4PC7A 4E09A 2VTBA 3KWFA 3E0QA 1R1DA 4NH4A 4QLAA 2P6RA 3PLAE 2TECE 1KEWA 1W30A 1KI1A 2EWCA 3FPCA 4Z99A 3QVXA 1P17A 2HU7A 1QE5A 3V7EA 2O2DA 3BXZA 4U7WA 3RVRA 4LNUA 3OX2A 2JKVA 5C1PA 1GAWA 2AHRA 5JLJA 3MT9A 1V45E 3VNSA 3FYUB 3SQDA 4DA7A 1B0AA 4R5MA 2LDXA 4Q18A 4HNAB 1EIZA 2B5VA 3R3HA 1PJLA 3NUQA 5IW8A 2K9PA 1PR0A 4D80A 1TZCA 1SULA 1MABG 2BCCH 2GM9A 2Q3LA 1KKLA 4KR9A 1Q0SA 4RK1A 4DYLA 1OCZC 5F2KA 5DEIA 4FEGA 4A26A 1O9BA 5G4UC 1OR8A 2ZW9A 4YCBA 4ZAYA 5IJXA 5C8YF 5EE3A 3HXLA 1RPTA 4G88A 1ULTA 1E2FA 1Z0SA 5BR4A 3ZE6A 1V37A 4Q3CA 2X6AA 1JR9A 3STYA 2HHJA 1N5IA 2KPOA 1X7XA 3WIVA 3G2NA 1XF9A 3W78A 1H4SA 2XT9A 1AQLA 1JIUA 1UBKS 3UO2A 1P72A 4MP8A 4R0NA 1FVOA 2W2LA 4MVXA 1G5HA 3KOWA 2CL5A 3BEDA 1SKBA 3DNMA 3OHMA 1WIWA 2J85A 2A1TR 3MUNA 4KDEA 1JR3E 4MO2A 1DAHA 2B2CA 3HCRA 4RPIA 5DHSA 4MW9A 1E1CA 1F8UA 1VLJA 4DPMA 4BW5A 2RGUA 1DT9A 1IHUA 4X8AA 3S7ZA 1LXCA 1U1CA 4MV0A 5L4NA 3FSGA 4JVLA 1VJRA 3KSZO 3B40A 4J7KA 4JLBA 2VJPA 3ZD7A 1Y6XA 2IH4A 3BFRA 5IN4A 2GTAA 1N5OX 2Q8PA 1PK7A 3LXUX 4IIGA 2VAPA 4N49A 3I2YX 3HM9A 3AM1A 3ZBQA 1SIUA 3DEHA 1KP3A 2Q7HA 2ECPA 2HEGA 4WBNF 3K9LA 3T7TA 3Q6NA 5AI9A 1MMMA 1XHFA 2OHVA 4INZA 1LVGA 2AD5A 2P0YA 4J3JA 4TPKA 4XIFA 1SBNE 1R6TA 2P3LA 3SXUB 1MV5A 1U3TA 1YUBA 3N1UA 4KGXA 4RH3A 3WL8A 4YMTA 1OB5A 1NVGA 2HMAA 5H9WA 4ASUA 2HM7A 1JU4A 4C87A 4QU9A 3WGLA 1Z5ZA 1SUWA 4KO8A 3E81A 3SSOA 1QVVA 1FW8A 4GLXA 4GU5A 2VF7A 2JA2A 2Q68A 2XRFA 3N70A 4OBBA 2C2YA 3TRJA 5FPQA 2NN4A 2WB2A 3THRA 1WXEA 1IOZA 4PTLA 3R7AA 1DJNA 1C7JA 1QLWA 1E3QA 2GPYA 4YB8A 4K7JA 3UV3A 3ZVMA 4G9GA 4JJ7A 5JYDA 1U5BB 1HYQA 1GRCA 2OV6A 3CPWU 1G21A 5ALFA 3G5LA 1PLJA 4WLNA 3G5MA 1KXZA 3TEJA 1A27A 1IM5A 5I51A 4F4LA 1YT5A 3GEMA 3GAAA 4HQKA 4EF5A 4HAOA 3ZNQA 4BCDA 3DZIA 4EG0A 2PVPA 1DBSA 1XLVA 2ACKA 1FNKA 1JDZA 1SB9A 4DJFC 4DQXA 1CXZB 2R4TA 3CVJA 3W7UA 3H83A 2OCAA 2QRUA 2W4QA 3LQKA 3ASNB 4DCGA 5HCIA 3AUJB 2WPDD 3TPCA 3WISA 2NU7B 1YQEA 2R5FA 1J1ZA 4H7DA 1AHNA 2FUG1 2I5PO 3HBMA 1GFSA 4AJ2A 5CJJA 4LF8B 1J20A 2PI5A 2BN4A 3O2JA 5AYVA 3WSWA 3TGUH 1IWOA 4M1WA 1ABEA 2BFDA 3D6HA 1C3OA 2FB9A 4U9HS 1SUAA 2CWDA 4XPIA 1QGOA 3C14C 5FI1B 3WIBA 1RRMA 1N78A 4NTWA 3ZCCA 3LUJA 1N0NA 3VYTC 4TUYB 3VU9B 4D82A 2CEKA 2N46A 1YWGO 5ILOA 4OMDA 4XJVA 5D5QA 1XDSA 2UYOA 2RJNA 2AUTA 4ITUA 4M0DA 4NATA 4ND4A 4J7UA 2FH5B 3L4EA 4IG4A 3L49A 5FL7G 1NNI1 1VPVA 1Y3BE 2V7QD 1Q1AA 3OMXA 4M1MA 5JSYA 3R7NA 1C9KA 5CFNA 2AR9A 1CP3A 2MOKA 2NYUA 5HDQA 3SHVA 1O94A 4CLRA 1MV8A 4F2GA 1XZCA 2JH3A 4NLLA 3U3MA 5IF9A 2WE8A 2IZ0A 2JK0A 3A1NA 3VJMA 3NFRA 4FJ0A 1CUVA 1NE7A 2UXCB 1J21A 1HDCA 2HD4A 4HAXA 3IRVA 3MTQA 4LRQA 4TS1A 3X2FA 3IQXA 1GZ4A 1RHRA 1SQXH 3CPSA 1YR9A 3FWYA 4GGOA 1PYOA 3IE2A 5ER6A 1P49A 1YVRA 3ET4A 4JEIA 4MDHA 2QX7A 4EY5A 3COJA 4J11A 3OONA 1HGXA 3ETNA 4F6CA 1OCEA 3V5NA 2Q3MA 3D8UA 4G3XA 3SU8A 1EBOA 4IMRA 3V1TC 3P8ZA 1W41A 4UDNA 5CHEA 2M9MA 2VPTA 4N7BA 3EPHA 4ARIA 4WOJA 4GBJA 3K9WA 3RFFA 4LFCO 5JJLA 3R66A 1BCSA 4AILC 3ND8A 4HNTA 3CMCO 4CUJA 5COBA 4E1VA 3FYEB 5JRZA 4O29A 1H2EA 2FYTA 3UBTA 2R9IA 1WF6A 3O93A 4OYRA 1NVXQ 4LRSB 3TXYA 1DP4A 3ZGYA 3NXSA 1QHYA 1Z35A 1P5ZB 1LLFA 3RT3C 1GADO 2J9GA 4WN3A 1FDOA 1S2DA 1MOFA 4P2ZA 1SUIA 2JGEA 3ZI4A 4C3VA 1DRKA 1LLQA 1XTIA 2QKYA 3J80A 5BSVA 3SAJA 5FD8A 1L4LA 5AVRA 2DWDC 1IBMO 3B9QA 3GMSA 1NLUA 1XTQA 3TW8A 3E27A 1QQCA 4MARA 2VJAA 2PY6A 3GVCA 1Y7LA 1YOVB 5JE8A 4Q7MB 5FR2A 2QR4A 1RAGA 2EC5A 1D09A 3AUSA 2GUZB 3GPIA 3ZZ0A 4JF3A 1LDEA 3KEFA 3TGWA 3E5RA 4JENA 3TRIA 1Y76B 4KHZA 3AF5A 2MDTA 3F6MA 4MKXA 3A0RA 3CJQA 3HCPA 4IIJB 2K1EA 2REOA 1U0OC 1UKZA 4FPPA 1B6GA 4HBNA 3QKIA 4JITA 2ODEA 5LP6F 4U4AA 1P7BA 3BXOA 3F7VC 1AS2A 1SR8A 3HZHA 4YJFB 4YRRA 3JRNA 2OHFA 3OLXA 3F4BA 2DZDA 3E3NA 3SC6A 2LQTA 1Z7EA 3UT0A 1MHPA 4DSUA 3PFIA 5EGNA 5HQ3B 3K15A 3QOYA 4OQNA 1L4HA 5LUBA 3MINB 3T4EA 4ESOA 1HX7A 2JBAB 1AHIA 4DLLA 4FNMA 1XV2A 3BMNA 5AI8A 4E5YA 3AUAA 4F2HA 4GVLA 4YMUA 1ID8A 1H2XA 1VBMA 2ZJBA 1R88A 5CM9C 2FFRA 1RA4A 4P9PA 1XA3A 3C8ZA 1X7YB 3L0YA 1FB5A 1O97D 4IH4A 1N5MA 3ZK7A 4BP1A 5TIIA 2QRPA 3DE0X 1MRZA 2BZ1A 2H5LA 5CLIA 2QR3A 4DIKA 1R0RE 4IFIA 3V4SA 4ARSA 3NIGB 1TVKA 1VCOA 1DIGA 1VQ5F 2HCTA 5A3SA 5JDIC 4WNYA 4CMEA 1E60A 2AR0A 1E2MA 1LQUA 1ZVQA 1NT2B 2AJLI 1IPHA 5DCVA 3WE7A 5I7RA 2O7SA 2P9JA 1RVDA 3FETA 2HC9A 1WOMA 3ICVA 3NT4A 4MRMB 3WWCA 5E7QA 4O4HB 4OXSA 1K7SN 1E1MA 3DDCA 1QG6A 1YE3A 2PAFA 1ZJJA 1H1TA 3B3QA 2W37A 4PHGA 3Q7TA 1U28A 2XHBA 1DTEA 4G4GA 1UBUS 4TL6A 5AKYA 4F4CA 1TJ5A 2TMGA 1W52X 1CUCA 2C92A 4LYHA 1PTJC 3HO1A 4LFAB 1D1TA 2PLAA 4DEVA 4CLXA 1U90A 1WLYA 3PE4A 1U96A 1UFQA 3K2EA 4Z9YA 1UZNA 3RIEA 2JI9A 3BZWA 4I9FA 2F48A 4M0UA 3R23A 2G0TA 3IBGA 4FDTA 5JAQA 5SYNA 4YLYA 4URXR 2TMYA 3C6BA 5EWRA 2G9NA 3VVCA 4DV0O 1GZ5A 1ZICA 1IX9A 1H8HG 1NI4A 2Q0SA 4JVSB 4UEOA 2QPOA 2JFHA 2RHTA 3WI7A 1NPYA 1O2DA 2RK6A 3CF2A 3MERA 3E2EA 2QX9A 2LP7A 1L4EA 1OBCA 1VMEA 3UW1A 4C0XA 3MF4A 4EKEA 4DN6A 4YV7A 2X2OA 4BNVA 3FCOA 5J9PC 4ZHQB 3L6CA 4FNOA 4N8EA 4QPKA 4RNCA 4P3PA 1NV8A 1T5IA 4JFRA 2RSLA 3C4QA 3GRZA 3OF5A 4KVGA 4CHGA 1R5JA 2BKXA 4JP8A 3D54D 1LDMA 3LBNA 4PSUA 4MICA 2ZROA 3CR7A 2PF4E 1IPEA 3AETB 4X60A 3ITEA 1ST2A 4XQEA 1PGPA 1DMRA 2XHZA 2RE8A 3ZG6A 2Y67A 3AF6A 2PNFA 3ADKA 2PUGA 4LCUC 1P73A 1IFXA 2YWHA 5DNVA 3AEKA 3GPLA 4EGFA 1P4RA 1S7CA 3PI6A 3IP3A 5I5EA 3B3GA 1DMSA 1EQAA 1KI6B 4DR6O 1XMQO 1G64A 2E5WA 2MR6A 2ZOSA 3PHIA 3QVKA 4FR2A 4TVKA 4UNIA 3ANLA 4YNBA 5ELLA 3HTNA 3DMDA 1RVV1 1ZITA 3CX7A 4AJLA 3IBFA 4NTXA 1CR4A 2VQ3A 4LWQA 5EOVA 4ZVTA 1KAEA 1FUIA 1OWNA 2NVOA 1IIRA 1VCMA 1U3VA 1EVZA 3CCCA 3OZXA 3U62A 4WOCA 4CL8A 1JJFA 1V7CA 1KY3A 1Z22A 1FLVA 1VB5A 2AG5A 2RHCA 2VRNA 2W8BA 4K35A 4OPMA 4QUAA 4UNNA 1I7QB 4FWTA 3RVLA 3ZR4B 4DABA 2Q46A 2FWAA 3U9TA 4F72A 4CDGA 1C50A 5DEDA 1GEGA 3FHCB 1JT9A 3VDXA 4MVYA 4CG2A 1ZIDA 5BRNA 2BSAA 4MKFA 1XVTA 3OM1A 4KBGA 5IC6A 3UJ9A 3X2QB 2VQEO 5L3QB 5LD2B 1QAQA 1GILA 2Y1GA 2B20A 4X24A 1Z5GA 4DXDA 2VTVA 4IINA 5DTIA 3KXIA 1FNCA 1P75A 3BTVA 3L7NA 4YRBA 4X9QA 3TETA 2J5QA 4ARUA 4QOEA 1QIMA 2P2SA 4I4LA 2O8BA 1P18A 2R60A 4LOJA 2EIJB 3H9GA 3DLIA 1J0AA 5GQSA 1Q83A 1RCUA 1XDDA 2AK3A 2WHRA 2IWRA 3M1YA 1NJ6A 2ZIAA 2PRIA 4B73A 5K7SA 2EX4A 4JX9A 3W5BA 3T3PB 4DYVA 1VGQA 4U39A 1KHHA 4PEVA 4OY3A 4ZU1X 2FW6A 4B08A 2CYCA 1V2GA 2R9VA 2IS4A 1II8A 5FPSA 5AO9A 3TQCA 4O3FA 1I0HA 5CUQA 4I7ZB 3U3KA 4ENVA 4UCTA 3DMNA 1RMYA 4Z1MA 5U4XA 2YN0A 3WADA 1SOUA 4YIKA 3AL0C 2WF6A 1YF2A 2Z2JA 2IJJA 3N7TA 1MX9A 3ZOKA 2BELA 4AROA 1G20B 1NDQA 4J75A 3GEHA 1IV4A 3CX4A 4KX5A 3TMYA 3PU6A 1Q1EA 1SDSA 3QUSA 2RFLA 2FETA 3D4PA 2JL1A 5FNZA 3LFHA 4Q1FA 3WLRA 2GD1O 1YA6A 4R1NA 3H1PA 4Q4AB 4HWPA 1MC8A 1QCDA 2KBEA 5JANA 1JBEA 4XX0A 4UB8Z 4BQOA 1H3EA 3T3MB 4O4JB 1YR2A 1DQSA 1EUCB 1NYQA 3PRYA 1XU4A 3NALA 3GA5A 4CDMA 4R1OA 2WTBA 3PYXA 1T9CA 3K0CC 3WWOA 2ZLBA 1R3IC 1G7TA 1KJWA 4PY2A 4AMBA 2XDQB 1SXIA 1NMUB 1HMYA 3JQRA 3Q7QA 4GLBA 2H6LA 4INPA 4UVDA 5KTPA 4YY3B 4J76A 1RRVA 4KFSA 4LWZA 5CFPA 1Z8NA 4RLFA 4J07A 4M1KA 3WG7B 1W0KG 3IP5A 2QWXA 3Q6MA 1H42A 1ODCA 2W9XA 5EIFA 2VS1A 5B2FA 4F92B 1UKCA 5DI3B 1KI4A 2IKQA 3MCUA 2E7ZA 2Q2NA 1SK8A 1KY4A 1QG2A 1GZ7A 2G08A 1LI4A 2G9ZA 1X2BA 1E3TA 3HL4A 3OJWA 4YLEA 2W6ID 3TQOA 2WQ7A 1ES9A 1RD4A 2ZB4A 4G1EB 2CFOA 3QJYA 4FOTA 5EXDA 2AC2A 4HNGA 4WK6A 1PTJA 3OZFA 5HJEA 5K3DA 3GEIA 4DR5B 5EJ9A 3PHJA 5BYKA 3K32A 2OAGA 3B7PA 2VHJA 5GM1A 3L7IA 3IBYA 4CIBA 2RAVA 4C7XA 4K8OA 1MO5A 4GUNA 1DX9A 4MQFA 1BE6A 3BPZA 4RF2A 1Y8QA 3O0TA 4UUNA 1ZUNB 1QO7A 4LKOA 2ACEA 5AVJA 1GUZA 2XWSA 2O14A 1LTKA 3FD5A 4KPGA 1ZWLA 1A5TA 3AK2A 2VWKA 4OAPA 4DVGA 2VH5R 4NE7A 5KZMB 1A5AB 5BY2A 3KYCA 3SWWA 3AG4B 1CJBA 4COOA 3ICPA 1E58A 4B48A 2BHSA 2X7JA 3P1JA 4OFWA 1G1MA 3A8TA 1ORWA 1U3LA 2ECFA 3A6EA 4S3MA 2ZRFA 4R1LA 5HF8A 1OLSB 1ZD2P 5I3CA 2QM4A 2A5GA 3QF4B 4NZYA 4YJFA 1QX4A 3RUCA 2XZTA 1NJIW 1FFGA 4X64O 1LPSA 1SKAA 2L17A 5DKFA 1QVFU 3IKLA 1G0NA 1UMBB 1V8ZA 3FMGA 1P5JA 3LLUA 3QK7A 4KAJA 3X1WA 4E31A 2PV7A 3D8RA 2LPMA 4B75A 5BYAA 4J0JA 3KEGA 3LX6A 2GZ3A 4JBHA 1QK4A 4YCAA 1C0EA 4Z51A 3CE2A 3IVXA 5L3FA 2FN8A 2XTAA 4GLLA 4PLHA 5ALJA 4YFVA 1BKDR 3NGLA 2YI9A 1JXOA 3NOQA 1GG9A 1UEXC 1NI4B 2X14A 2WYHA 3JAMM 3A9CA 3FX2A 4MDYA 4MQBA 4CPDA 1WDWB 3K9FC 2WUFA 3MJDA 2G0NA 1KKCA 2POCA 3GMDA 3I1YA 1OTXA 1T9GR 2FRDC 2V5VA 4HV4A 2QD1A 4MWZA 1S8AA 2BM9A 3EMVA 1VQ7F 4CG0A 4D9BA 4KXXA 4JJIA 4AP5A 1Z8FA 1AVTA 3HDJA 3MZ0A 2D7CA 1T0AA 5ALQA 1AILA 3OMNB 5GIOC 1I2ZA 3MJHA 2MYUA 1YBVA 1ZU4A 1EZ4A 4UCFA 4NYIR 4WZBA 4ZO4A 1DKQA 3H42B 4F4IA 2JB9A 1C3JA 4HATA 5CPFA 1U2RA 1KDYA 3N8NA 5L7TA 2KQUA 3OUTA 4BFTA 1GL6A 3EXEA 3EC1A 4LRYA 1Q3EA 4H33A 4QD3A 5TQ0B 4O33A 3SFVA 4D3SA 1VQ9F 2JFBA 4IDFA 1IURA 4ERHA 1OHHD 1NVEA 4CG3A 1GCGA 2PL5A 2Q0OC 3EG5A 2C98A 1BDBA 1MPTA 2QT1A 2ZTUA 3B1WA 3MB5A 4Q9AA 4BNJA 5GWXA 2VP9A 2AOTB 4JJEA 1ENOA 3OQIB 1LDBA 4H18A 2JGRA 4UNQA 1L5HA 4BWGA 1MZFA 2I91A 1MH9A 3GAZA 2VQFO 3LUKA 3PA6A 1R0WA 1P33A 1NAIA 1QANA 1R4NB 1XEXA 2GN6A 2C4NA 4O1IA 1FYDA 3ZTTA 4YK7A 5C2JB 5IF3A 2R1TB 1S4MA 4GO1A 1RYYA 3LOUA 4AG6A 2IXBA 3D0KA 3Q1LA 4RTJA 1JHMA 3F3KA 4H3SA 3S1AB 4LI0A 1CW2B 3EBLA 3I12A 4FEYA 4V3CA 5B1YA 2R1VB 2V8BA 1MFZA 1Y74A 3AR2A 3T1QA 3W5JA 4GZMA 1WTCA 2WSBA 1DQPA 2QG9A 4ES6A 5HM8A 4RTRA 2QWNB 3EN0A 4ND5A 2PKXA 1HDEA 5HF5A 3A4TA 2O8BB 3X2QC 5A9GA 4RPHA 3W5UA 4FMDB 1DFGA 3ANXA 5DW3A 2HBQA 2NW6A 1WVIA 3A1EA 2DT8A 2C4HA 3VZPA 4BAGA 4Q9JA 1VYVA 3B9RA 3N0TA 4E5DA 2WZQA 4BNDA 5KB3A 3R0VA 5KCZA 3A0RB 3OEHD 4RIFA 4B34A 1VFNA 3K0CA 3JSNA 1USGA 3FLEA 2W98A 4OKSA 5TC4A 3AKZA 5J2TB 3VMFB 1J6UA 3DKRA 5CDFA 1AGRA 1GZSA 2CHEA 4J2OA 3GEDA 3S2EA 2HHCA 4LXHA 4TV8A 5AVXA 1CLUA 2CV1A 4OHPA 4OUKX 3KV1A 5EJEA 4U7TB 1ADBA 2WYOA 4Q21A 1EXVA 4B7UA 2XRMA 4NULA 1SCIA 1V8DA 4NI5A 4XWAA 3H2ZA 1WR8A 3OE4A 3QLTA 4J0FA 1REQB 4OI0A 3PUHA 4AQDA 1WULS 2A14A 1WMFA 1A5SB 2VKQA 3INTA 1M2JA 4OHRA 1QIGA 1SKYB 5JRDS 1R27A 4HFMA 1V1RB 3IJ5A 3QUAA 1T1RA 3ONFA 1T4GA 3OTHA 221PA 4IICA 1ZI9A 3KVVA 3O9MA 3RKUA 4DM4A 1BXRB 1DG9A 1NBMA 1P4SA 1XFDA 3JRXA 4NYKA 3DYVA 3IT0A 3NC1C 3DZGA 3NTXA 3QLVC 4RMHA 1SBQA 5DT2A 1T36B 1YACA 5BR8O 5HTOA 1W19A 2ZVYA 2I2AA 3HKEA 3OOYA 1OBHA 2Q21A 3GUUA 3SR3A 5LGUA 1F17A 4N5MA 4DJTA 1CF9A 1ZK2A 1UJWB 3MEQA 4G0MA 3BILA 4BT4A 4O25A 2DGDA 4FHEA 5JPDA 4MVMA 3D3EA 4U5XA 1YL5A 3HU1A 2I6TA 1WKVA 3SM3A 2YMLA 3PSAA 3RT1A 1M3SA 3KWJA 1ONOA 2HSWA 5EBWC 1UBFA 4K6FA 4TLAA 1Z17A 5KQPA 1B6QA 3H0EA 4MQ4A 3V2UA 3Q9UA 1F48A 3SC4A 2JFOA 4UXNA 3WLEA 4AS3A 1U3PA 1U81A 2ZAUA 2V5UA 3OWOA 5G0SA 4ZWNA 2H2HA 2LTAA 1AV7A 2R2AA 2B36A 4YRZA 5B64A 3LYBA 3BUSA 4QDOA 4W7HA 2H8PC 1BO6A 1M1NB 2BSKA 3LLCA 2YZ7A 2KBFA 2LKCA 1KUQA 3CF6R 1LK7A 2VT6A 4G6ZA 2AH5A 1GN2A 4GS5A 5BN5B 3S2YA 2X6BA 1DLBA 2NU6A 4PLWA 4E5UA 4Q4CA 3W06A 5IEJA 3THXB 2BTEA 2WEKA 1ID1A 5T8KC 1XXHB 2B7CA 2BKLA 3VO1A 1KBQA 1FXHA 2IEGA 4KE8A 1BS2A 3UYLA 4TMXA 1E7WA 4A8JC 4BLRA 3RSOA 4FLTA 2RKOA 2R6FA 3TD6A 1KJQA 3D3KA 1IOWA 3A4YA 1BEUB 4P83A 5JDCA 3FB5C 3U40A 3FGPA 5CA0A 4GIBA 1GPWB 4BPBA 2IHBA 1JIKA 3GT0A 2PX2A 5CYOA 4RTPA 2R1TA 4Z53A 4CBVA 1SQ5A 1UDAA 3LYHA 1QORA 2WLLA 2X6CA 1PJ2A 1OXXK 1Y6JA 3AI7A 3TQQA 2P78A 1YQ9A 2CJFA 4XXHA 5C7OO 1QB7A 2V9YA 1NT4A 3H4VA 2WLKA 4KHPB 4MYUA 3LY8A 3UAYA 5EMMA 1U11A 1HP8A 4U7OA 1RHUA 1WEKA 2MT9A 2VSQA 4TKUB 2JKYA 3WNDA 1Z6QA 1IUPA 4FM1A 4YJDA 3BMCB 3AEYA 3B8NA 3K30A 4IIUA 4QG3A 3E58A 1JAXA 2GCNA 2VNIA 3HYTA 5ECYA 5EAZA 3HL0A 4UNSA 2N48A 4D6TH 3WG9A 3AB3A 1CTQA 1Q16A 2HDWA 1XK6A 1GTG1 3E7XA 1O58A 1PLLA 1U5BA 2XRYA 4WZBB 3IRUA 3HZRA 3NVAA 1PAUA 3A1UA 4DS3A 2X5NA 3N0RA 5B30A 4BXOA 1UJBA 2BEWB 4H1HA 4EB0A 4PW0A 4ZRDA 5GZ1A 2I71A 2VPXA 3DL0A 1VJTA 2PSFA 2OZKA 5F73A 4GP6A 2FEWB 3ZV5A 4BNNA 2QL5A 1W85B 1E7RA 4D9IA 3NK7A 5B3LA 1BFDA 2ONCA 5C31A 1GVNB 3CNOA 4MRSA 4OAQA 3W8RA 2JLVA 2V97A 3CF4A 2ATEA 1AJEA 1I5EA 3Q7RA 3QO8A 1B76A 1F2TA 2W6IA 2LBPA 3D81A 1E6CA 2C82A 1YJWF 1WXIA 4KAFA 3SPIA 2IY8A 2Z5FA 3L9WA 4HPWA 3MOSA 4QXAA 3EBOA 4N5IX 1SXJD 4TOIA 1A2QA 1K7XB 1T8TA 1W2HA 1ENZA 2F1JA 4Q6WA 3GB9A 1FSPA 5FEUA 3PJFA 4BEWA 1EFHA 2XQVA 1B0UA 3DCNA 5KNBD 2FLVA 1Z8HA 2RN9A 1TUBB 4D4GA 2ZS8A 1BDJA 1DJLA 2XNJA 3OTOB 3ONEA 5DXJA 5H16A 3AK1A 1AS0A 3V34A 5FBWB 3JX9A 2K2WA 4LE1A 3BB4A 1R3LC 1S8NA 3GIWA 1SQGA 5CHYA 3RSCA 2O2EA 2IEAA 2Z2KA 3R40A 2LNDA 1XMSA 2CLSA 3KE1A 1P2VA 1QLHA 4NE9A 1PS9A 4YDQA 3ZV7A 5A7HA 5I9NA 4JGBA 1NMSA 3LIPA 4LZNA 4CF7A 2A5FA 2WAYA 3T34A 2I2DA 3GL9A 1JDTA 3SIRA 1R10A 1C3LA 3AUFA 4QE3A 4YMWA 5JNWA 3IFSA 3S81A 4DR6B 2XDWA 3OIUA 1QGED 3RHTA 1VLMA 4DHWA 5FLXA 2J9RA 3ONVA 3SZRA 2BZ0A 3I56V 3D4BA 3E8FA 2HN9A 5BV8A 1GZVA 4XCQA 1HE4A 1QIHA 1ZM7A 3KWLA 3TOVA 3WAGA 3AU9A 4W5NA 1GQSA 3H1BA 4BV3A 4H59A 3GWOA 3H87A 5AKGA 4XKJA 1DTWB 4BBZA 2AIRA 1S5PA 2PGLA 1FFSA 3EXHC 1MJGM 3TCXB 2AN3A 2ZATA 3EZ9A 3FJOA 4JJGA 5J2UA 2ONJA 2VXCA 1NC3A 1XPOA 3HKBA 1QCYA 2BP7A 4TTJA 4B71A 2G06A 4WLOA 1HG1A 4JBIA 1T1IA 4JBXA 4ZAVA 2E4UA 3TSAA 3GRPA 2IL1A 4JASA 1J00A 5E7IA 5HXAA