5IJ9B

Cryo em density of microtubule assembled from human tubb3-d417h mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
426
structure length
426
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNHLVSEYQQYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 140
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij9B01
5EZYA 3HKEA 2RHJA 4X1YB 5JCOA 5ITZB 4FFBA 4IHJB 5JH7A 1TUBB 4ZI7A 4O4JA 3HKDA 3HKBA 4X1KB 4EB6B 3JASA 4TV8A 2RHOA 4YJ3B 3JALA 2VAMA 4O4LB 3E22B 5J2TA 5MN5A 3JAKA 4IIJB 2Q1YA 3WGLA 5EYPA 5JVDB 1Z5WA 3JARA 5JCOC 1W5FA 1RLUA 1JFFA 2R6R1 1TVKB 4O4IA 5C8YB 5CA1B 5IYZA 2RHHA 3WGJA 1W5EA 3WGNA 4B46A 4ZOLA 5M7EA 5KMGA 5KX5B 1W5AA 4I50B 3UT5B 2VXYA 5GONB 4X1YA 3JAWB 5ITZA 4DRXB 2R751 4KWEA 4IHJA 1TUBA 4O2AB 4YJ2B 4TV9B 4EI9A 3JATB 4X1KA 4EB6A 3VOBA 3HKCB 5IJ0B 4U39A 4YJ3A 4O4LA 3E22A 3VO8A 5LYJB 1SA0B 4IIJA 4I55B 1FFXB 2RHLA 5JVDA 4I4TB 1RQ2A 3RYHB 5CB4B 5CA0B 3RB8A 3V3TA 5CA1A 5C8YA 4U3JA 5J2UB 4LNUB 5LOVB 4X1IB 5EZYB 2XKBA 4HNAB 5EIBC 5KX5A 2BTQB 3VO9A 4I50A 4F6RB 3UT5A 1FSZA 5LP6B 5GONA 3HKDB 3ZBQA 3JAWA 4DRXA 3N2GB 4WBNB 4X20B 3RYIB 4O2AA 5MN4A 4YJ2A 4TV9A 5IJ9B 3JATA 3C8LA 5IJ0A 2BTOA 3N2KB 3CB2A 4O4HB 3RYFB 4O2BB 3ZIDA 5LA6B 5JQGB 5LYJA 5FNVB 1SA0A 3M8KA 4I55A 1FFXA 4I4TA 5BMVB 5LXTB 2VAWA 3RYHA 5CB4A 1RQ7A 4E6EA 3M89A 4ZHQB 3RYCB 4B45A 5MN6A 5CA0A 4ZOLB 1TVKA 4TUYB 3VPAA 1W581 5J2UA 4LNUA 5LOVA 4M8IA 4X1IA 1Z5VA 1W59A 3HKEB 4HNAA 2BTQA 2GVIA 4FFBB 4F6RA 5LP6A 5JH7B 1W5BA 4ZI7B 4O4JB 3N2GA 3HKBB 3JASB 4TV8B 4WBNA 4X20A 3RYIA 3WGMA 4EI8A 5IJ9A 3JALB 3HKCA 3N2KA 5J2TB 4O4HA 3VOAA 3RYFA 2VAPA 3JAKB 4O2BA 5EYPB 5LA6A 5JQGA 3JARB 5FNVA 1JFFB 5LP6C 4XCQA 5BMVA 5EIBD 5LXTA 4DXDA 4EI7A 4O4IB 5IYZB 4U3JB 1OFUA 2XKAA 4ZHQA 3RYCA 3WGKA 2Q1XA 4TUYA 3R4VA 5KMGB 3ZBPA
chains in the Genus database with same CATH superfamily
3DZHA 3LQYA 4N39A 2C5FA 2W2OA 1YDFA 1ECGA 3Q98A 3A1DA 3Q8XB 2R3SA 4JYMA 2CFRA 3O2NA 1SXJA 4FOLA 1E7SA 4ZOCA 2TMDA 4C3VA 1BVUA 3AZQA 3D5TA 5G0VA 3Q12A 4J0QA 1NDHA 3UB4A 1SVMA 4JEHA 2KLBA 4LJAA 1UDCA 3CM0A 4LJLA 4TRJA 3D8SA 1FPQA 1GPUA 3S7TA 5KKCA 3RIYA 4UBMA 4KV7A 1V9CA 1Y9JA 1YASA 4LY6A 2NUPA 3U60B 1TJNA 3BGVA 3EVBA 3K9BA 1L8QA 3D31A 3IT0A 4JWKA 2WA1A 4DL9A 3VM6A 4XM1A 5D84A 4C0SA 2E85A 3D0QA 2G9IA 4AXBA 3ORFA 2VWHA 5IC6A 3HVRA 1CUYA 1PK7A 3RD5A 3AEXA 5B7PA 2QN2A 1JFRA 1G2IA 4JLBA 1ZM7A 4US0R 4BY9E 1PV2A 3OOSA 2WIGA 4RQTA 1JKFA 4M83A 4OMUA 1YS2X 5KYYB 4JJ6A 3OZBA 2O2IA 4TWBA 3IKFA 2C3PA 5ALOA 4R41A 3IUNA 4TSKA 2B1GA 1CEQA 2H92A 3EVCA 5DYYA 2R751 4ZVPA 2A7XA 5CCXA 1GX1A 4UCQA 1X19A 3ZY2A 4GR5A 1L9KA 1XD2B 4RJJA 1YI0A 3ZY3A 4PG6A 2D2VA 3HVUA 4Q48A 4N8DA 2EOAA 3LWPC 2PSSA 4BNNA 3G13A 2CYBA 3DL7A 1XVTA 4QATA 1O97D 1FXKA 2VYCA 4BO2A 4B7AA 1PW5A 1Q57A 2GVIA 4AX8A 2QUBA 4Y67A 5L3DA 3ZMTA 3R0JA 1PLKA 4X45A 1AF7A 3KR0A 3S2UA 2R00C 1FDWA 4NUTA 3U6KA 4BW5A 2NV0A 1RLJA 3NGMA 4QPPA 3C5CA 2I6DA 4MQMA 1E89A 1AI6A 2JLYA 1ZNQO 3MTAA 2OBXA 1O9BA 3RUDA 4Q18A 1OBVA 4LC9A 3LD9A 4MVJG 3KT6A 3GP3A 4QGHA 2REOA 4RLFA 2A9PA 3CRQA 3PGVA 5HEKA 3WXBA 3OLYA 3FCYA 3RA6A 2QYSA 5BT9A 5HCNA 2WC1A 4J16A 4DDTA 2GHTA 2LBTA 3P0FA 1KBQA 4MRRA 2WILA 1UFOA 1JR3E 5TEWA 3SX2A 4Z1OA 1PEAA 3LA6A 5ED4A 3WMRA 2JCYA 3PD7A 2OECA 2PAFA 2ZDHA 3KKEA 3P9RA 1YL5A 4RJIA 1QGYA 1OLXB 2PSFA 2ATVA 3UFXB 3L0OA 5JAQA 1YDXA 3NBYC 3DAFA 4J41A 4V0RA 2QYHA 4GMKA 1TM4E 5C3MA 4NG4A 2VAMA 1QGUA 1Z39A 2V5VA 3PPYA 1Q1ZA 4B5KA 4OB7A 3F6EX 4X97A 1IE3A 2ZB4A 5CLFA 4BKRA 2AH5A 3SICE 2C57A 1IZZA 1E7MA 1Q0RA 1EQAA 2YXNA 3ZYCA 1RM0A 3M6FA 2C7GA 3L01A 3C7KA 4K6FA 1WB4A 1YIJV 1E96A 2HA7A 4FS3A 3RT9A 2JIZG 1I94O 1XOUA 1I1QB 2GDJA 3QFHA 4L4SA 3DM9B 1DOZA 4FMCB 4M8IA 1UCFA 4GCZA 1N4DA 1KK0A 2L82A 2HRYA 3JWIA 4WLUA 4G0MA 4DR7O 3T5AA 3PNOA 4DLBA 3CPSA 4PLGA 1R5JA 2C9CA 4FFOA 2KI5A 2UYJA 1U1CA 3LWNA 4OM8A 3NDPA 2BEJA 3P9ZA 1MH1A 5BSHA 2D5CA 3P10A 1Y9ZA 1VB3A 3U5TA 1SFRA 3GPCA 3K5HA 3ID6C 3JQBA 4TOIA 3CJQA 2VG8A 5TVKA 4RLHA 1OX5A 4I2VA 4ARBA 2XNHA 3OHMA 3M0EA 4XFDA 4TXJA 5D6OA 4EJSC 5EJ7A 3GEGA 4D44A 2VTKA 3RARA 1F12A 3VC3A 5AVXA 2W6CX 4GVXA 1LW6E 1K1EA 4DCPA 4OYLA 2ISCA 1P4AA 3VO2A 1T5HX 3BWYA 4IDHA 4FUTA 1M34A 3Q9UA 1XVAA 5ERYA 1IOWA 3SE7A 1YA4A 1C0KA 4ER0A 4M89A 3ZZUA 3FYDA 1JR6A 3QWHA 5HSGA 4LDJA 1RSOA 3X2SA 1KETA 2Q3HA 1AV7A 2C59A 4C7XA 1ICIA 3TYXA 1UBEA 2VC2B 1V96A 2PRZA 4MLCA 2HU7A 4J9UE 3D0OA 2IJGX 4D3FA 1H47A 5ITZB 1HYEA 4J7JA 3ETJA 4RTKA 4JJIA 4HB4A 4NDNE 2X13A 2QAGC 4LY0A 3CZCA 3UN1A 1YS6A 4H4DA 2DG2A 1SBTA 3T8YA 3PPWA 2R8ZA 3KJKA 4W5RA 1D2HA 1XI1A 4HDMB 1W30A 2D0IA 4KPEC 3LLCA 4R7CA 4ROTA 2AG0A 3GMSA 1NVWQ 5IWAO 4BV2A 2NUAB 4KQ6A 3STWA 1YJQA 1LDNA 4X93A 3QOWA 2VVTA 3IEXA 1T1EA 3QQ5A 2ADOA 4URVR 2DWQA 1KFEB 1K98A 4UTZA 1U2DC 3NG1A 3VR1A 1YB1A 3DZIA 3AOEC 3LUDA 2BGLA 1EUQA 3N39C 1C4WA 1GZ6A 1UODA 3AB3A 3LDEA 5AJXA 3B52X 5I9TA 5LMCA 5D1NA 5CLQA 4YMUA 1DDIA 3PNYA 4F7WA 2BE7A 3K16A 4WNAA 3LSSA 3SF8B 2JZOA 3JYHA 1ZJ4A 5BWOA 4HEQA 1VJTA 4L22A 4P92A 4YQYA 3OFJA 4NHEA 5E2AA 2Y93A 5HKAA 4AIRA 1DK1A 5F98A 3KS9A 1ADBA 4BFXA 2JS7A 4AJHA 4JTAB 4F2WA 2BUCA 4KIUA 4XGNA 2JD2A 4JODA 1RWNA 1N2BA 1W40A 2CJFA 2VAVA 3IP9A 4G5HA 5JD6A 2B6NA 2IFTA 2Z5LA 4PX9A 4A6PA 1A32A 3E89A 4A0FA 1D2NA 4YDHB 2EAUA 1GDHA 1VI5A 2H5JA 1ZWLA 3EPHA 1J99A 3P97A 3VVBA 4DTCA 1VE9A 1GTSA 3N5CA 3II6X 5CJJA 3ZJTA 1CIJA 3RU2A 3I2JA 1RA4A 2R96A 3CCRF 3IKVA 4F6CA 3L93A 5JZMA 1YI8A 1V7QA 4IDPA 3WISA 3PDIA 4A16A 1I4OA 2OAQ1 3FVRA 4RPIA 5TX7A 2NQ2C 3KIZA 5F33A 4KSYA 4U7WA 3M3PA 4JI1B 1O57A 1XAGA 4OBEA 1TF2A 4UW9A 5EJFA 3RE1A 2VOJA 2QJOA 1LZKA 5HOEA 1IC6A 1CUCA 3CKKA 3ETHA 3L7YA 2GTHA 4I3FA 3EA5A 3IP3A 4QULA 1ZUNA 3ZG6A 1KPGA 4YJFA 4HDAA 3C8UA 4PN7A 1USGA 4GEGA 1NXVA 2C94A 3UKJA 4RTSA 1WM1A 5E6RB 2ZANA 2VYVA 3FHLA 2E82A 4DFDA 1VL6A 4DF3A 2QF7A 3WGMA 2PRKA 4TTPA 1URFA 1T6ZA 4D7AA 1U0RA 4YX9A 4K8OA 5DLQC 4N3AA 4RAQA 1ZAYA 2UDPA 5JG7A 3BMQB 3IMEA 2EF0A 3RC7A 2RCYA 4REQA 1OI2A 1BN7A 2FTKE 4RNCA 1NZFA 8LDHA 1ZITA 1JECA 5KNDA 3E9NA 2BM8A 1QJCA 3AP1A 4NP6A 5DBFA 4DVJA 1QVWA 3ZBUA 3ANSA 4RC9A 2I2DA 4BJ6A 5COAA 3FLAA 3INTA 4Q7EA 2IXAA 5A4JA 1ZU4A 4QDKA 4QHSA 4DPMA 3ZHOA 4YALA 3HE3A 1RACA 4H27A 3N2ZB 2R7KA 1U5CA 4A92A 4IRUB 5ENZA 1JKMA 4PLWA 1XHLA 3LG2A 4JHLA 3IVGA 2GDSA 3QPDA 1VQ1A 3RS9A 3ITDA 1AHIA 3DDHA 1URPA 1PEDA 2EZPA 4Y0NA 4WY5A 1U4OA 4HVTA 1F1BA 1QM5A 4OFWA 1T8RA 3F5SA 3OJEA 3BPSA 1GGVA 4Q7LA 4YV2A 2UYKA 3IDSA 1X39A 4TV8B 2A78A 4K5QA 5LB4A 1XZMA 4CDRA 1C7JA 1ZVMA 4QUDA 3AHCA 4YAKA 6YASA 2Q6LA 5CBHA 4U3JB 2VJMB 2I6TA 1H2GA 3L18A 3PC7A 4I5EA 2EX1A 1J21A 2WV7A 4DYVA 3W04A 3SE0A 1ONNA 5AK4A 1K7YA 3AETB 4JY7A 3AIMA 2OTLF 1TIBA 3QVOA 2AV6A 1E2NA 5JROA 4JB2A 3FCAA 2VXYA 1C9DB 4TLBA 2JIPA 5JNSA 5SYMA 5IVHA 3A2MA 5IC5A 3F78A 3NTVA 2P2GA 3ZY6A 1FMCA 3KL2A 2HGZA 4CF6A 5CMLA 1U9IA 1BXKA 4W7IA 2F17A 4CL3A 4DV1B 1YVPA 1OC4A 2F55A 3DE7X 1A7UA 2JGRA 2BISA 2GDZA 1IWOA 3FNFA 2CK3A 4D9BA 1E1DA 2CNBA 5BY2A 3IULA 3CMEV 1GTOA 2G4LA 5G0WA 4QQRA 1OFGA 3SOPA 1N0IA 3VR4A 2EWWA 3K3PA 1DRUA 5CB6A 1PO7A 4MYUA 2HS4A 3QYPA 4XGIA 1VDZA 4M8SA 2EGHA 1Z15A 4OGFA 1CS0B 1JDSA 3SXPA 4YWJA 4JJEA 3Q7EA 2PUTA 4OQZA 3RC1A 2ZUTA 2YASA 4PYKA 2KKWA 4A2PA 1CDOA 1UP6A 1A8SA 1V3VA 4NFYA 2ZULA 4AU1A 2G82A 2PZAA 2X2PA 4BO4A 1W2BF 5AK0A 1J8VA 3H4IA 3QI7A 1OILA 1ACLA 3RTCA 3I76A 1R0KA 1XRMA 3DT9A 4K6GA 3UTCA 2ZQMA 3HGMA 1DX9A 2AJCA 3NNDA 5DZSA 3UKDA 1YBVA 5I7OA 1JBEA 1H9BA 3PFKA 1X1QA 4P0PB 4EHNA 4XSGA 1HNWO 1E6UA 2LIPA 3I23A 2B2CA 5EIBC 4MXDA 3WGQA 1ATIA 4KL1A 4V0MA 4CI9A 3ZZ0A 3LVQE 3GLIE 3WJQA 4B84A 2DKFA 3AFOA 1MO6A 2O06A 2YINC 4B85A 4NZ9A 4IKEA 5B66Z 5FL7D 5AXBA 4UFZA 1ZD1A 2GBGA 4M1MA 2NYAA 4XPIA 5IDVA 3T7IA 4C30A 3EVZA 1C9JA 1Z12A 3EDCA 5AKJA 3V46A 4PXAA 4M1WA 4U2DA 4NTYA 1YUNA 4HDCA 4JYPA 3JQCA 2ZKOA 1ISRA 3IPXA 3NQ41 4EKIA 1BE3H 2GFIA 3EXG1 1A7KA 3MFYA 1ECPA 4HN4B 4JFRA 4TX1A 1GK9A 1RXSA 4MW6A 3W5SA 4GNKA 1X1BA 4DW0A 1AGRA 1TB4A 1U8XX 1OXBB 1ZL0A 4LRUA 1TT5A 4UAVA 3GK3A 2O3TA 3DDUA 4ND4A 3PC3A 1LUWA 5CB4B 3RCBA 4X24A 5L45A 3CCJF 5TGZA 4DTIA 3SIRA 5TF4A 4C7JA 2BC9A 4GI7A 3KB1A 5LBTA 1P7VA 4KGVA 3LSUA 4QXRA 4U2KA 2G5TA 4ND5A 4NENA 1AROP 1NVKA 3N0XA 3TPFA 2QY6A 2FL4A 1X86B 1G8FA 2EVWX 3FCUB 1QV6A 4EEZA 2J59A 1B23P 2B0CA 4FHCA 1XDCA 5AP9A 5HDQA 3AFNA 1TYEB 5I9MA 3O94A 3QF4B 1KAMA 3O8OA 1CK4A 4ZCMA 1EVIA 4XVHA 3TX6A 1MW8X 2JFFA 3RO7A 3S7ZA 1R8SA 3LWRC 1VQ8V 3MD9A 1CEZA 1TVKB 4GBED 3CF6R 1JLLB 1L5ZA 2L69A 4XKJA 3TTUA 3F3SA 4NBLA 4GXNA 3BH6A 1UXGA 1EXVA 1E1QD 2IBMA 4BW0B 4EY7A 4O2RA 2QSAA 1JVMA 3EBOA 1Z2CA 4LX0A 1I5EA 3LBHA 4TKLA 4TV9A 4MP6A 5M5BA 2C2YA 2QDXA 4KP7A 2XMQA 4BP1A 1NW5A 2QWXA 2PT5A 5AW1A 1G4UR 4D46A 3EF0A 1DG1G 1XELA 5FJJA 5TMDA 3WKCA 1NX9A 2R1VA 1L7MA 1EIWA 5H6QA 4D5GA 3KD2A 3UJAA 5TJ9A 1XXHB 4X94A 1B42A 1VQPF 3ZGZA 2RD2A 2WIFA 1J97A 2PR7A 1BHO1 3V4RA 1IYZA 1S77D 1T3LA 1TO6A 4GBGA 4FU0A 4Q66C 3KP1A 5HKKD 2YJNA 1GIAA 5GIOE 2XYHA 1MB4A 4C7KA 2QTVA 4JBIA 2A8YA 2VK4A 1LBTA 5BQ3A 1FTGA 3H1TA 4CFSA 1O95D 3A3YA 2J0SA 1X1SA 1EFLA 2VNAA 1VHQA 2CV0A 2NU6A 3L7OA 5TQ0A 8AT1A 4L0MA 2K7ZA 4ZT2A 5B1DA 4HWPA 5JI3E 2ZDIC 1RCTE 4DR4B 2XT9A 4KW7A 4DLWA 1ZH0A 2D3OW 2BFFB 4CIYA 4BNGA 1AUPA 1QVRA 1VTKA 3SKYA 1ID8A 1JJ2F 1NC1A 4HK4A 1N2XA 4DRZA 4ID3A 3GP8A 3FWYA 3QH4A 2WAMA 3LZ6A 3CSDA 3W77A 1C0IA 2VHEA 4HR7A 1T24A 4JPRA 2EBFX 1OFTA 2H59A 4FLFA 1BFDA 4O63O 1CEYA 3NUQA 5DXFA 3MTEA 4RF3A 5IAGA 4W9NC 2HSJA 5KA5A 1TW2A 2UYNA 2C8KA 4ZCSA 1CUDA 4RV4A 4TV9F 2HU8A 2WYIA 4BWYA 4UJ3A 3WLIA 2CH7B 3KPVA 2FGKA 4A03A 1JNXX 2JGUA 1TCAA 1E3LA 4G26A 1EAYA 1LJLA 3FE2A 3TTXA 2RHDA 3BG5A 3RADC 2V7QD 1TCUA 4W5OA 3CNQS 3I6BA 5T3YA 5LUBA 3PDHA 4NHOA 2Q21A 4JUAA 4MPTA 3IR7A 2A5LA 4PFSA 1XZEA 3USZA 4KDRA 5FBRB 1UZLA 3OWXA 1KU0A 4RUKA 1Y8AA 5DMHA 1XTVA 4QQNA 2WICA 4TXHA 5DN9A 5DBGA 1VMEA 1GPAA 3GR6A 1SC6A 5E1BA 3VOSA 5BYBA 5AKEA 5IDJA 4BU1A 3DLCA 3T4UA 5F64A 1AK1A 3T5PA 2BGJA 4N4AA 4CH5A 3H42B 1ZUHA 4EW1A 2QN8A 3QX8A 3CEPB 1MNGA 1IJEA 3NONA 3H1JH 4OKSA 2BR4A 1TLTA 1PR2A 4NK5A 3FPCA 4XD7D 4WTOA 2QS9A 1P91A 2QQ0A 5ESXA 4MVOA 3BM5A 4W4LA 3H11B 1DI0A 4ZYTA 4QXAA 3NKFA 4RZSA 4RK1A 4K81B 2OCIA 4O2AA 1GT6A 3ZDXB 1WS6A 3FYCA 4CCWA 1AKQA 2QZJA 2R8EA 4XAQA 2H6EA 5I47A 4KPUA 3ZCVA 1SXJD 3MS2A 1W85B 1KYVA 3NDRA 3DUWA 4OFZA 3GLKA 1DOAA 2GF0A 2I4OA 3BILA 5CYOA 1SOWA 5JSHA 4HAOA 3KFVA 3H9VA 4R5MA 4KE6A 2HLHA 3JYOA 5T3UA 4L5CA 5EE3A 4RFVA 4KR7A 4GIBA 3Q2OA 2JGDB 3IAEA 5BSKA 1VP3A 3ZC3A 2XYQA 5HS4A 5JECA 2UU9O 1TAUA 4A8TA 5DH9A 1BCRA 4WKGA 4P7FA 2D62A 1R10A 4UHJA 3PVZA 4WCFA 1W0CA 4C08A 4JAVC 2GF9A 1V8OA 3EIQA 1YK1A 4KTVE 1HYQA 2GESA 3GYBA 2NTVA 4G88A 2EX4A 2N1BA 5IPFA 1MEJA 2DBRA 3LX8A 1JQBA 3EVTA 2JCSA 1SJ9A 3VR2A 2Y9PB 4RVNA 3A4IA 3SSAA 4OA8A 5C5DA 4CLHA 2JJ1G 2J6HA 2IYTA 3SP1A 3NHFA 1UFKA 3CVJA 2OCPA 3W5IA 2DT5A 1DELA 3S27A 1YZBA 1P2SA 4MDYA 2VT6A 4QPDA 3HADA 4HLUC 1ZXBA 3H2BA 4K0RA 3CYFA 2PXCA 1JPUA 2V03A 1R0YA 5G4KB 1M2EA 4PC2A 4IEEA 3Q3VA 2HWKA 1D1SA 3ED5A 3AO0B 1L5SA 4CQMB 2HT6A 4YWHA 1JX9A 2Z2XA 3PYXA 1MU0A 4O2AF 5KMGA 3OR6C 3DZFA 1VL0A 3BWVA 5AOBA 2QJ1A 4ZZ2A 5J43A 3EXHC 4RY2A 1SVSA 3FHTA 2VDJA 1U7OA 3P7MA 2RMKA 1ORDA 2Q46A 2GYYA 3PAFA 2PBZA 3KKNA 5CD1A 4XGQA 2VAXA 4PLZA 3DULA 1ODSA 1HFWA 4LZNA 4BNUA 3U2QA 5BQXA 1K4CC 3FYUB 2FW9A 4UTPA 4TWZA 4RFSB 1PYOA 5BYJA 1A71A 1E3TA 3H1EA 2NV6A 1I6WA 1JSCA 4C7OA 4O4JB 3LPAA 2OG2A 2QVGA 2Q4TA 1N6RA 1PT7A 1KEEB 4W7SA 4FFDA 3EG9A 4B40A 5LLTA 2OUIA 3LPDA 1X59A 4L0QA 5EK0A 2ZROA 2ZJ5A 5JIBA 2GSMB 4FNAA 2O0JA 3LY7A 4B2IA 3GUYA 2DFPA 2YC0A 1MO2A 2I9KA 1NLUA 5BR8O 2JKZA 5BZBA 4ZYVA 1YE3A 2M9MA 1EINA 2WUGA 2X1HA 5A9SB 3P2YA 3N2IA 4WNIA 3WHLA 1ISIA 1R6BX 3ABLB 4ER7A 1YT5A 4X91A 3VYRB 2BZ1A 3G2OA 2JASA 1RNLA 3S2SA 2YHBA 3I64A 1CQIB 3DDCA 3SCZA 3R3XA 3WRVA 4C29A 2JDIG 1CWUA 4M1QA 4IIUA 3P5SA 4Z4HA 4KHPO 1DWOA 1NATA 2LRHA 4GOOD 2Q69A 3E1YA 5EUMA 1DKLA 2R8BA 3IP6A 5B12A 4DV7B 1JVSA 4NH4A 2PSHA 3T99A 1E9DA 4C3OB 3SJBC 5E79Z 1YITV 2C31A 2XDYA 3AY6A 3P3PA 4ETIA 2VJAA 4P58A 1EGHA 3AR3A 3BAZA 5HQ3A 3BHNA 2FRXA 1QFYA 2PMWB 2IYQA 5AVSA 1TAQA 1YAJA 5C1DA 3U3RA 2PV0A 3EXAA 5LJLA 3IIIA 2CLSA 2Z98A 3DEIA 5ALLA 1G0OA 1L8XA 4XPZA 2X7XA 5CDFE 1E4YA 2RJNA 2V9ZA 5DP2A 4CV3A 1II8B 1E2HA 5FUWA 1JTVA 1LNZA 4MV4A 2FSVA 4OI1A 5K2OA 1UWKA 4MV0A 5DHPA 1P80A 4OUKX 3RVQA 5JMWA 2XDQA 3I2HA 2C07A 2H57A 2IX9A 2YTZA 1U1IA 3D5QA 3HCEA 4M0MA 1XN4A 4DGSA 4OM7A 1Z08A 4ACBA 1GFWA 4GICA 5CA0A 4NAUA 1ZTEA 5HQTA 4PHTA 1J33A 3Q3EA 1VE3A 1AUQA 4HATA 2RGXA 1CR4A 1M0TA 3KJJA 2MYTA 1KSJA 2NQTA 1K6JA 2GAJA 1UBSB 4JI6B 4A6XA 4FNOA 3BXZA 1UC9A 3FBAA 5K3CA 3OQ6A 1G6KA 1WIWA 5SZHB 3TOZA 4JP5A 5FLXN 2HO5A 3ORSA 2EILC 3JWHA 4MGZR 2GSDA 1QKIA 5DW3A 1QYCA 3F4KA 1J07A 2F4VO 5JD4A 4WOCA 4XQEA 4P32A 1Q1EA 1NN3A 2QI9F 4ZU6X 5FPSA 3OQIB 4A5OA 4QELA 3BKWA 1KI3A 3CCCA 4Q9DA 5CA1A 3C1AA 3I9KA 1GUAA 1EQUA 4MVZA 1TM7E 3GWKC 4DSTA 2ZR8A 1SCAA 1T8UA 5EZ6B 2ZJ4A 1WA8A 2HG5C 1K75A 3ADCA 2XEXA 1B6QA 2PZKA 4ZZ0A 1EFCA 2YZ2A 2WR8A 3I9V1 1ZNXA 5K0CA 4HYEA 1Q6IA 4F2DA 1KDOA 1Z6XA 5FI1B 2VP5A 1PR6A 1RKQA 5CDSA 4AWBA 3LU1A 3QUSA 4IRMA 2ZVPX 5FL7G 4OJMX 3TW8A 2BD0A 2XA2A 2H63A 3W2HA 1W76A 3ZH2A 4KV9A 4X6UA 1US8B 3RYCA 2IW3A 1NUSA 2HR3A 2OYCA 3CUVA 4DR1B 2P9JA 4Q6WA 4UUJC 3FAZA 3OTQA 1W36B 4CTOA 3K58A 1DFHA 2W2MA 5EKSA 3HAXD 1L1EA 3EZ9A 1RPTA 5EQDA 2RGCA 1YJ9V 4GKVA 4KRYA 2QX9A 1K08A 2JAWA 1XQYA 3B9BA 1T5SA 1DT3A 4M21A 3CC8A 1R18A 5CA0F 5BOSA 3H8VA 1YEWA 4QX6A 3DHWC 4JL5A 5KBYA 1W5SA 2Z01A 4EHIA 3M1LA 2NZXA 2D1QA 1YJ8A 4G5SA 3COPA 5HS6A 1N2GA 1Y98A 1WEHA 1QH8B 2OM6A 1UJBA 3UATA 1F4VA 2LCIA 3PQ5A 4WKNA 1H3NA 2CSXA 2ORIA 1EX6A 1E5DA 4TTRA 4MB2A 1NVXQ 1X7XB 4IWNA 3TW6A 2H1RA 4FEEA 2VQ6A 2XQIA 1EE2A 3FB4A 3ZEAA 3VVMA 5J9FA 2XNKA 1JHOA 5KIAA 3OA0A 5FL7A 3AVVA 4NJEB 1UINA 2B4RO 5AW4A 4RA9B 2H1IA 3BD9A 3ETQA 1K8AW 2P6OA 3G79A 3PUXA 4J0JA 3KAKA 5CA1F 5I8ZA 5B58T 2R72A 1JHQA 2XZDA 4JI0B 2BFOA 5SY4A 1O96A 2FB5A 4FGUA 1ZOLA 1JG1A 4HRVA 1H69A 2AQHA 4O2LA 4QBIA 4G1VA 2GN8A 4R84A 4EKNB 4FXPA 3C24A 4YHHO 4FLTA 1WHTA 2Y05A 3NS7A 1E1QG 1RKXA 1ZH8A 4YCMA 2PRSA 3CB2A 3OPYB 4KR9A 1KQFA 3PKIA 4XDKA 4NYJR 3QG5A 4Z54A 2DH6A 1RQPA 1DP4A 3RUAA 1H2HA 3D7LA 2D8AA 4KN5A 4JYCA 1TZMA 2X76A 3P2IA 1I7FA 1O6ZA 3KHUA 3C3YA 5GM1A 2JCXA 2Z5VA 3IMFA 3MWEA 4BE4A 1DKUA 4BX2A 3SEZA 1EUYA 1ORQC 3NTXA 4TROA 3EGOA 2IZZA 3ABTA 4OQMA 3S06A 3MCAB 5DGXA 2YQZA 3KEOA 2Y4OA 2CNWD 3SZLA 1L0BA 1S9HA 2H85A 2BMJA 2AFHA 4LWSA 2VYVD 5FJ4C 1VQMF 2PKYX 4V1CI 3E3MA 1G2QA 1XBLA 1SA0B 3F8TA 3ELCA 3EARA 3VYWA 1JEQA 2JGFA 2IQIA 1Q12A 3LT2A 3VC2A 4IILA 4F6RB 1V7CA 3PFNA 3AM4A 2R6CA 1JILA 4Q82A 3K0HA 3P0ZA 2ZRLA 1YS1X 5KNDD 4ESHA 2RGDA 5E4JA 2XBUA 1PNKA 5JYBA 3RYHA 2VYFA 2ZAIA 3AFIA 5LZ5A 4HDRB 4P2BA 1D0VA 1F2UB 4MGHA 2AC2A 1KGDA 2ZRCA 4G97A 1MIHA 2QRVB 4W9RA 1N5LA 3G9ZA 4NBSA 1YDGA 3F6PA 3CXCF 3EEYA 1ZYUA 5CM9C 2RK4A 1XWFA 2JA1A 4Z0HO 3UM7A 4QKQA 3LL4A 3CC4F 2GHIA 1IHOA 2HRZA 3RG2A 3MHSC 3B1FA 2BBTA 3CX5F 3UY4A 1RXEA 5C4IA 3U39A 4JGBA 3ZHUA 1UBTS 4JUDX 3I04M 4XYMA 2ZS8A 4FW9A 5C32A 1RYEA 4EO4A 1LBIA 1HDGO 1V54C 1W94A 3D0KA 1NJIH 2BEWA 4EPVA 4KXVA 1P5JA 5K5EA 2VA9A 2ZD9A 2QIPA 3KYCB 1NFQA 4YRBA 3SYMA 1XKTA 2ODMA 1RWOA 4MUYA 1LLCA 2BBWA 2ZRGA 3DMTA 5CHEA 2V7QG 7ABPA 4KZKA 4WJKB 1YCIA 1I3CA 1MVNA 1TK3A 4PAOA 4TRMA 1OSNA 2GBPA 1P18A 3L0SA 4IYRA 1OZ0A 2BHSA 3KYDA 1B04A 1ORTA 3E6AA 5F51A 4DV6O 2AXPA 4CDGA 4JITA 2ZCVA 2WYVA 3AERB 3M6MD 1N33O 4IRXA 5FTJA 3D4IA 1WDMA 1FP2A 5AVUA 4J11A 1XILA 4HWOA 1QRRA 5LD2B 1EDOA 4M76B 4OI0A 3AHIA 3WNZA 2CK3D 5EXEA 4DS3A 1QIDA 3ZWOA 2EFJA 4JJKA 4DA7A 4DY6A 1A9SA 2HK7A 3VX4A 5AJTA 4ZVQA 5EAIA 1A76A 1V71A 3VR4D 2CLCX 3CD6F 3SZOA 3KQNA 3AG3C 4XWWA 3SIWA 4MUGA 2IU3A 2APJA 3KDSE 4RH0A 4QRDA 2PJUA 1AUOA 4MVUA 2P78A 4M9UA 3A14A 4UQPA 2NP7A 1JRLA 3E3AA 1U7HA 4ZAYA 1Y4SA 4XX0B 3B1KA 4LOAA 3PC8C 5JMPA 1G9XA 1ZWIC 2EU8A 3WRXC 5B1EA 3DDZX 3B9PA 3BMNA 3C6MA 5CBGA 2ATIA 1HGXA 4MRMA 5A02A 2QLJA 2X8JA 1VG1A 4GPD1 4O4HA 3CC2V 1OCEA 1M1KW 1RQNA 2YWDA 2CFCA 3EGIA 3PTZA 2XHZA 5B3SB 4PGFA 4OMCA 4JMPA 4IH4A 4FPPA 3LT0A 4Q3NA 1WZUA 4OQNA 1YBHA 3M3HA 1C0EA 4YS6A 1YE5A 3MBOA 5C37A 4HFNA 4W1SA 1J0AA 2O2EA 1DJLA 2UV8A 3B3JA 3GVCA 2JGNA 2WBLC 1U2QA 1FP6A 3A04A 4M7OA 4C6SA 1KORA 4AMVA 2N3ZA 3I0MA 5K3FB 1N8KA 3VYSB 2GETA 1L6RA 4BQNA 4PGMA 1MDFA 2R68A 1BZKA 2OK7A 3GFTA 1RYYA 2B4QA 4KGZA 5HZGA 5IJ9B 3H18A 2IYNA 4R9VA 4CCSA 3ETGA 1G59A 5BNWA 3T5TA 3LVRE 4C0HA 2HLDA 4ARUA 3IAAA 3FOWA 4H0NA 1P72A 3W8DA 4LCKA 1Y7HA 3I72A 1RIFA 1QNFA 5LP1A 2ZP1A 5HXUA 1WUIS 2WSSA 4J7UA 3HCAA 5EOVA 2VDUE 2WWTA 4P82A 3ZZ1A 3E35A 2QMEA 1LLQA 5AKXA 2VJYA 3N59A 3W5CA 2Q8VA 1E0JA 3V4PB 3I04A 1I8TA 3EGXB 2EFDB 5A3RA 4W1QA 1L4BA 1PD0A 1AKVA 4RVUA 5EZYF 3HBAA 4OPHA 5ICSA 3KT3A 3ZKAA 4O4HF 1N77A 2KGWA 4FYWA 3I0ZA 2YICA 3GLRA 3LYHA 3FWNA 1VARA 5D3ZA 2HBZA 3DXXA 2NP6A 3RHSA 1XQWA 4V3CA 3ASYA 2HQSC 1NMEA 2X0JA 3RVZA 5CR9A 5A6VA 3M82A 3WP1B 1F8XA 5G1NA 1IJKA 2ENWA 4QTZA 3BTVA 1KEUA 2VSXA 4P5DA 4H44B 1R4NA 2ADMA 2QMYA 3HPLC 3AEYA 1YUBA 3LQRA 2QTPA 2BF7A 4F2PA 3GLHE 3T9FA 3Q0IA 4KVGA 2H06A 3IC7A 2XUQA 4HGZA 1CHNA 2PF4E 2WWYA 4YRAA 2CDRA 3V7UA 1ODFA 3TGLA 1QFMA 4MICA 5GVSA 4A1FA 2IY9A 2XB8A 1ICEA 3WXMA 3IDFA 1QG0A 1WEKA 3UJHA 4C20A 1I5RA 3A6LA 2LKDA 1EBBA 4OQEA 2UZAA 5LU9A 2BZSA 3QVTA 1KKUA 2HSWA 1OCRC 2H2IA 3FF4A 3UT5A 1XEXB 4KQMA 2DOKA 2YY7A 5HY0A 4YP7A 2H8GA 2QTNA 4OBXA 4FJCC 3NT4A 4JBGA 3MCTA 3NKVA 1Q6HA 2FXIA 5JLAA 2Y4UA 2XD9A 3TR5A 1LLFA 2HSDA 3EZGA 5L4LA 2EWCA 1FS6A 1HY3A 3ZXXA 1AP5A 4YONB 3CE2A 1JB9A 1IPHA 4OXSA 3G9UA 4AYXA 2ZJBA 5EIHA 1TD9A 2ZYSA 1R9GA 3RVSA 2JEYA 4NEGA 3UWDA 5FUQA 2HA4A 1CETA 2QVLA 2R1UA 1ZOPA 1WG8A 4P3NA 1FTYA 1AK2A 5JZVA 4K6KA 4Z9BA 2GVNA 1Y66A 3BDIA 1YHQV 1P17A 3ICWA 4OF4A 3BWDD 3O7WA 3GVXA 4HZUA 4LDPA 2GPSA 1ZM2A 2YBEA 3S70A 4C2TA 2WJJA 2BGTA 2FY8A 3TPZA 2P4QA 5E2IA 4PD4F 1CEEA 1JPJA 1GRRA 3T9AA 2WTMA 2G1KA 2V6FA 4BWGA 5KYTA 1SU4A 1IATA 1X1DA 3TTYA 4RADA 3KHKA 4Q4DA 2IOYA 5CJPA 2Q3BA 4PXSA 3N27A 5KJ6A 2P5OA 2PZEA 4KVFA 4DV2B 4ND7A 4CETA 4GG1A 4HDNB 3RPEA 3EE6A 1JA8A 4GSKA 3DUFA 5L3SA 5AM4A 1YJWV 3MDSA 1AHNA 2WU1A 4BLVA 4JB8A 3DQPA 5BQFA 2JFGA 4GQAA 3A2LA 1D6JA 1THMA 2Y4NA 5BSRA 2GO7A 2H17A 4N8EA 4CG1A 2R25B 4Z51A 2GLZA 2N9UA 1YMVA 5EA2A 1D1TA 4DAEA 1UBLS 2DY0A 1UPAA 4PE5B 4CLXA 2EQ5A 3EEBA 2ZVQX 3SF0A 4LH6A 2GCOB 4D9IA 1B74A 3F4LA 3G6KA 5BV7A 1RXCA 3VTIC 3PV0A 4XBFA 1U8FO 1TF5A 3D4NA 1H2NA 1H6AA 3AQ4A 5E1MA 2WF5A 1AGYA 1YCHA 1NBAA 4G27B 1T2DA 3R3JA 4H4EA 3W9SA 4W63A 2W0FC 1E2MA 2EFGA 1KZ7B 1KVTA 2HXGA 1B3BA 4N0DA 3WB1A 4WE3A 2P65A 2FQ1A 1UDRA 2Y1EA 2F4NA 2A6PA 3BMCB 3PC2A 4V2IA 3M5CA 3R3WA 4RKWA 5EMJA 4FR5A 2Q99A 3W8EA 2Q68A 4BXOA 2DKOA 4Z0PA 1Y4UA 3E7WA 4I99A 1NR7A 3VIUA 4BDTA 2M6YA 3U0VA 4TMKA 4NYMR 4ZRNA 1XNRO 3G2KA 2CGNA 3WNQA 1M76A 5FPYA 2JLWA 3CS3A 1XK6A 4Q3BA 4ZFNA 4B32A 2CSUA 3KJXA 1H1LA 3HN7A 2XH8A 2FU5C 5ALEA 2J5KA 2I65A 4UEKA 4NR0A 4I6GA 4Q1CA 5EJ2A 1I2ZA 2QTHA 2QPLA 3PXGA 2YYZA 3PUYA 1JG4A 1FNKA 5K0JA 4FFPA 5FUMA 3NALA 3FUWA 2GPJA 3JQGB 3PWSA 3VR2D 1JU9A 1GILA 1ABEA 3LC2O 4N23A 4EZIA 1DWQA 4HVCA 4NYKA 3ZWWA 3LF2A 1XJ5A 1N9GA 4K1XA 4WZAA 1S2OA 2XAHA 1I94B 3CX3A 1GFIA 3VDNB 3KJEA 6AT1A 4JBLA 4NMLA 3WL6A 3OIFA 4JT8A 4DIFA 4FBGA 5L6MB 4CKWA 4UD6A 4DRXA 4LSGA 3NAQA 4DR7B 4F93B 2Y99A 3K5OA 1L5LA 4PTLA 2YR0A 3RTGA 3N6RA 1W8DA 1MC4A 3UPUA 1T3ZA 2OTMA 3D01A 1TMGE 4QDOA 4ZT7A 1TKRA 1EFPA 2EHJA 4NEHB 4PA7A 4DA4A 3OWOA 4X8OA 2OGZA 1NR5A 2I2FA 3KZKA 3PNPA 3RM3A 5F12A 3QTTA 3ZHXA 2BR5A 3QY9A 4NIMA 4BQQA 5LCXA 3GPLA 5KHAA 1S1CA 4PF1A 1SG9A 3CA8A 2VDOB 5FX2A 1CUJA 1E6LA 2ZIXB 3WQBA 1MB3A 1FDRA 3L6UA 1K4DC 3A9VA 1GYPA 1E2PA 4GSLA 1JDBC 3SKXA 3RRFA 5CITA 2B37A 2CLMB 1BVHA 5MF6A 4WXHA 3AJAA 2HX1A 1C7ZA 4R9UC 1T9CA 2ZYUX 1I7NA 4ABYA 2OC4A 5HIKA 1V6AA 1TM5E 3NRCA 2BOCC 3ZK8A 3JQ7B 3CINA 5LDDC 2DOSA 2V59A 1YZQA 5L9AA 3L1KA 4DT1A 3HDTA 5K4AA 2B21A 3OCCA 1NMYA 5A3JA 4LWQA 5NULA 2UYCA 4XVQA 4BZPA 1N1GA 2AR7A 2DHEA 1EA5A 1EFHA 4AECA 4MYDA 4MYCA 5IWAB 4H3KB 3PIIA 1EWKA 5HY2A 5IMSA 3O8BA 4YUVA 1XRJA 1JI3A 3SYTA 1G20B 1DBFA 2DU8A 4BLSA 4WN9A 3WJ2A 2G80A 1ML4A 5AVOA 1ZDMA 1DTEA 1Z0UA 4PLTA 4P7JA 1N2CE 4KL8S 1WNTA 4KO2S 2A5JA 4YRJA 2CNWA 1OB5A 3MC1A 4IZIA 1P3DA 1QZUA 4KMRA 1JDUA 5JZSA 3CH4B 5DISB 4HPJB 1R9NA 2HDHA 3ESZA 3I1YA 3E53A 1EP9A 1DIHA 1T1GA 2ECQA 3M7MX 4Q39A 4LNUA 3DHNA 3I1JA 3U7QA 3ZWVA 1TK9A 2HV8A 1A96A 1M9NA 5BWBA 1T5TA 5KNBD 2B99A 2XY4A 4FW8A 5J47A 5KTMA 1J20A 1NPDA 4QNMA 4KDFA 1Q0PA 3OE7D 1NG9A 1JKIA 4QT0A 4WI1A 3HKDA 4PZDA 2H48A 4PTYA 1PV4A 2JVDA 2N48A 3JSNA 4OQFA 2CD9A 1TA8A 2SKDA 2ZJ7A 4ZT5A 5KYUA 4GX0A 3GC6A 3THWB 3BYZA 1RKUA 1ZP6A 3CNBA 1VQOF 2DLCX 1UMKA 2CK3G 4RDIA 3K96A 3TRKA 3PCTA 4CU2A 5DI9A 1KQNA 3X2QB 2OGUA 3VCZA 3IMKA 1GKYA 3LSQA 1AA6A 5FP0A 2IHYA 2QMQA 5JW6A 1EFAA 2J9RA 3THOA 5CHYA 1QOQB 4UMEA 1KSHA 2ZJ8A 2P6MA 3GZNA 3OFKA 1NP6A 5FJIA 3QKRB 4G9EA 3K8ZA 3RSOA 3BEOA 3Q0EA 3X1WA 1NSTA 2QTRA 3ELWA 1GG8A 1T9HA 1OWLA 2FUNB 5B30A 1V9PA 3MAAC 3GVHA 4JLSA 2I33A 4D98A 2EHDA 4UHEA 1O0BA 2Q3EA 1YE8A 2PQ2A 2Z2YA 2ODBA 2FSHA 3H1PA 1R4MB 2O3UA 4UOZA 4WJZA 4NOLA 1NF8A 2X3FA 3CKMA 5EQJB 2FV8A 2QTWB 4YMWA 3SPCA 2GQ0A 1TCCA 3GH3A 3GVIA 3S81A 1TQHA 4ISCA 4BEWA 1WZCA 4KR2A 1HT1E 1JPXA 3QUBA 1SRYA 2F9ZC 5B58C 2BMEA 3HB1A 4OA5A 5E7JA 5ISMA 4TL8A 1SPBS 3DB2A 2BH9A 2IUFA 3F5FA 3FUXA 4XDHA 1BXGA 2M7WA 1OXMA 3P0IA 3D43A 4UUBA 3DBLA 3KZXA 3RS5A 3WICA 1YF2A 4AF7A 4X44A 1BXRA 5P8WA 2CXOA 5E7QA 2EATA 1KFKB 2Z6UA 2CTWA 1NXPA 2J3LA 2O8NA 3NDJA 3OIDA 1W0JD 1KARA 1OROA 521PA 1QORA 1PPJH 1SU7A 1JUDA 3S0HA 4A82A 1FKAO 1EWVA 4M6WB 1KQ3A 1HX7A 1ADCA 2HZ7A 2JLVA 3ZKWA 2HJSA 1ETHA 3LFHA 1JE1A 2WKQA 1FFXB 1SHKA 2CVQA 3BVPA 1YIAA 1L7VC 1ZGCA 1S6YA 4Z1MD 3UWPA 5CYFA 5BMVB 1IXZA 3QEBZ 1WDKA 4HKTA 3UJ8A 1Z6GA 4WBSA 4YIKA 3KUXA 5FBHA 3D6NB 3KOWA 3K6SB 3RS0A 2ZRHA 2R65A 4QO8A 3PQ7A 4QOIA 3SC6A 4MVJH 4TVKA 3OQMA 3ZLTA 4FLUA 3MLAA 3SQXA 1V3QE 2LV8A 2WFZA 3TM4A 3NLLA 2CXXA 4AT1A 1SQVH 3INNA 1VJRA 4YJ3B 3CT6A 3HTXA 1E6EA 5IT4A 1JMYA 4LF7O 4OATA 1Q43A 3B8EA 2GPWA 3CCMF 3ZIAD 1G17A 3U3ZA 4R05A 3JAWB 1Y3CE 3EIEA 4CMEC 1GU1A 5LL6P 3VAYA 3IC5A 4MR9B 2A5GA 3QX9A 1AS2A 1YZTA 2PMKA 3IR5A 4D81A 4TT3D 3PNQA 2G63A 3U3OA 1RQXA 2QN3A 3O4RA 2HDNB 1CF4A 2XOEA 2H9AA 3B1WA 2D7DA 4FS8A 1C30B 3A37A 3G0HA 5HK8A 1L6IA 4CCAA 2FDRA 4J1SA 1WVGA 1XRLA 3ROEA 1Q86H 1QNMA 4GZRB 1R6NA 2W11A 4IIFA 2Y48A 5AK3A 2J9XB 4ENSA 3ZTYA 2E4VA 2HO4A 2IH1C 3DFKA 3RAEC 2YY6A 1M7GA 2ZJ3A 4ARZB 3RJMA 3URKA 2AFRA 4GLFA 3ZYZA 1XP5A 4N9QA 2HK6A 5DOVA 4HD8A 2ZS9A 1JVNA 2VRCA 1QCEA 4CS4A 1Y8QA 2WF7A 1TTPB 4CKBA 4CG2A 2OZKA 2Z3WA 5IHPA 2J67A 2C3UA 2CUGA 1UEJA 3N2GB 1LKZA 1GUFA 4HH4A 3VZDA 1BGWA 3THYB 1Y74B 2NXCA 2FK7A 5KJ1A 5JZOA 1NOJA 4NATA 1SEPA 3TL2A 1H4QA 3FSJX 1MV8A 5H9VA 3RVYA 4IH1A 3EAGA 4BIIA 2JKYA 3L9XA 1C1DB 5E0OA 2COKA 3HDYA 2BFCA 3L0YA 1J0XO 2NTYC 1BIFA 3BN3A 4JZYA 3ND9A 3RAFC 3HV2A 3FYIB 2HA6A 2HFJA 2N42A 4HUJA 1VQ4V 1RABA 1GPH1 3ESJA 3FBGA 2VS0A 4PDVA 4GPIB 1J5XA 4KO1S 1FDSA 5DBOA 3CONA 4FT4A 5DDIP 4RIEA 4HJRA 3FPJA 4JGIA 3QU7A 1JKXA 3A9TA 3RT7A 4DQDA 3IKEA 1IOVA 5AJUA 1DMSA 2EYQA 4DNOA 4AJOA 1G18A 4CN8A 5A03A 2Q27A 4DLSA 3WLJA 5K3AA 1UXOA 2Q9LA 3OQNA 4WFKA 1SXPA 2FNAA 3TD2A 3LS2A 2JARA 5HFMA 1AUVA 1FLDA 4AKHA 2DPXA 4N12A 3LPCA 2GXQA 3FLEA 3GRCA 2VAWA 1Y1QA 1DSSG 4HNAA 1G7CA 5EVJA 2VF4X 2FQWA 2EDAA 1Z0DA 2YJ6A 4B8ZA 4EUEA 2JLXA 2NPOA 2VPXA 3TSCA 1A9RA 3KSZO 3BWBA 3ABKC 4Q47A 2QBYA 5EMMA 4CL2A 3WFIA 3DTYA 4RWZA 2Q2OA 1KS9A 2G9UA 4QFMA 2DQ3A 1BW9B 1K6MA 3ZBTA 1W4CA 1Z4NA 2ZKLA 4IO1A 2N46A 4DNFA 3S1AB 4YCSA 4YJHB 2HI0A 3OO1A 4AKGA 3PFGA 3I6IA 2VDWA 4GL2A 3NO4A 3HXPA 1FX0B 2PRYA 3SHTA 1WABA 1FYVA 2MIIA 4B34A 3F97A 4XEHA 1QH0A 1NJ1A 2QGZA 3VHQA 3TQRA 4BT6A 4G4IA 1M67A 3DBHA 3Q7SA 4O3FA 1U0SY 1LC3A 2CUZA 4P9OA 3QPVA 4UARA 1Q6ZA 2EJ7A 1E3IA 1FC0A 3BWMA 3J7AR 1EBFA 1AQJA 2O1SA 5GWXA 4E2XA 5D5HA 3WQQA 1N8RW 1FXWA 4KXNA 3ABQB 1SXJB 2R5FA 1EK2A 3RBZA 4S0ZA 3ASZA 3K15A 1GKUB 2VCYA 1R2QA 3HYRA 3KE9A 2VS1A 4UPVA 3B6EA 4BQIA 4Q9LA 4YMLA 1OAPA 5A5GA 2PNFA 4MA0A 1LK5A 3TZ6A 4V24A 4S1VA 4CM3A 4J9YB 1GPJA 2HNKA 1WMFA 2MR5A 1EMDA 3I34X 5DI3A 2NUPB 3SJZA 4B83A 2HLDD 4M9CA 1SB9A 2Q67A 2R62A 3A3PA 3AIOA 1DEXA 3LW7A 4QBFA 3DA8A 3CWCA 1VQLV 1VBNA 5K8VA 2BSQA 1NF3A 3DKVA 5IABA 2IHUA 3JRWA 2GB4A 2HCBA 3DGEC 4RMIA 4C5BA 2WSSD 2A0XA 1YI2V 4C4WC 3WDLA 4RETA 2QZ9A 4D7SA 2PX0A 3WFJA 2JHAA 2AK2A 3GVPA 3DP9A 3PGA1 4OVKA 3FKSA 1I3NA 1CRPA 2ZF8A 5D1HA 4UTRA 2D1YA 1MOSA 5IAOA 3I5MA 5KKAA 4RJ2A 5FI0B 1RE0A 1J4AA 3H2ZA 4Z6KA 2G76A 3G5LA 1IM5A 3H2JA 4L3WA 2C2BA 1CULC 2F8SA 2SCUA 1QO9A 3CV3A 2QTGA 2ZAMA 1T1SA 2QRHA 2ZEJA 2EP5A 4HQNA 2H2GA 2FPOA 4G0ZA 1LQTA 2QMUA 3R6GA 4MGKR 3GBPA 1KY5A 1VA4A 2ZCUA 4H08A 1U98A 3JU3A 3G7UA 3WO0A 1QYRA 4E13A 4JUCA 1KAHA 1TUBA 3JY6A 2W9XA 1JHYA 3KAQA 4OLJA 4O4LA 1EP3B 4G1CA 1QE5A 2C82A 3AX6A 1FXKB 2ZINA 4EX6A 1N3BA 2L35A 1FXWF 2A5FA 3ETCA 4IJ5A 1IN4A 2P4SA 2ZTLA 1ZI8A 2X5OA 4JB3A 4EGCB 2WLNA 2XA9A 4JC5A 4Z7JA 5DEOA 1MQ9A 2QUKA 3HTNA 4DG9A 3T1YB 4RPCA 2EC5A 2OCCB 2PLNA 3QHPA 2RAUA 4KN9S 3DONA 4TYPA 1P33A 2PYIA 3CCVF 3V00A 5IDYA 1VQ6V 3DB1A 4HZIA 1EJ2A 3MMSA 2P90A 1U0JA 1ZGHA 1YKGA 3TKAA 3KKMA 5IT9N 1DBQA 2A79B 3KXPA 3FPGA 1PR0A 2FJUA 2JK1A 4Q4JA 1YFZA 3DKIA 1ACJA 3P9KA 2QJRA 2INGX 3GRKA 1ONSA 1OXKB 1Y7TA 1WE2A 5TARA 5H3CA 5B53A 2VWKA 3FNQA 1FDVA 2WWXA 2QPTA 4L08A 4CMIA 2LD4A 1FBTA 1T8YA 4R68A 4QU8A 4E22A 2WU8A 2FVYA 3TKYA 4U02A 2XRYA 3TAHA 2WW8A 1SWWA 1QQBA 4DCUA 4B3MO 4PQEA 4LJRA 2WSLA 2AUTA 3C2QA 3ZDRA 1WQ1R 3IAS6 4X20A 1QGUB 1ZM3A 4XTCS 3BC1A 1OFUA 5JJIA 3GWGA 4FILA 4L07A 3QPCA 2MYPA 4O4LF 3DVAA 3ADBA 3GLTA 2X23A 3WJAA 1JHPA 3SJQC 3V1YA 4WWHA 3EH1A 2QGFA 4JLOA 3EMKA 3NM4A 4YT8A 4N3NA 2YC4C 3IRVA 5HP7A 4BTLA 2BTUA 4R16A 4OQDA 1HQCA 5EMNA 3GGDA 3QPAA 3PWTA 3T3GA 1T0BA 3H1FA 3I01M 4DM7A 4GRDA 2FZWA 2X6BA 3CMAV 3EQ2A 2JIBA 2OUKA 1ECBA 2Y0BA 1TJ5A 4LE0A 1ONBA 1I24A 4WOKA 2XR1A 3ES9A 2ZOVA 4WOJA 5BSFA 5HTOA 1X8KA 4ERHA 3JQDA 4K1LA 4LXQA 1HO3A 3CCUF 4N0MA 4BVBA 1M8KA 3KKKA 3C3PA 1QC5A 5J2UA 4II3A 2PKEA 1R6UA 3HO1A 2ZS7A 3FW1A 2UYPA 4L4XA 1GGNA 5BOVA 2OTJV 3KELA 3KOYA 5BWCA 1KXJA 4DJTA 4PLYA 3ASOB 2XIQA 2MK3A 3PNSA 1HE8B 3F0TA 1QGOA 2P35A 5KNBA 4J1NA 3NHBA 1X7ZA 2RB5A 5U4QA 3SS8A 4KVZA 4X3PA 2JHCA 3B8MA 2YFYA 3OE7A 3ESBA 3FB7C 5FI5A 1FQJA 4C6HA 1XPRA 1DHTA 4UBLA 1OCOC 3SR0A 1ADJA 1UKCA 2OZLA 1M34B 1GP2A 5SV2A 3WY9A 5TQ2A 1IB6A 3IESA 3A4YA 4EF4A 4JLWA 5CLHA 1RXUA 1RSOB 1D4AA 1E2BA 1UBGA 1H3EA 5A9RA 5JEEA 2H00A 4P84A 1PFQA 1X7PA 1K6EA 2DWDC 2BZ0A 1Q0TA 3CLHA 1OX4A 2YI8A 4L6IA 3B9QA 9ABPA 3O31A 4PHHA 2GHRA 2R7AA 2V58A 3OI7A 4MW4A 2GX6A 2B98A 1GV0A 4M8KA 4JOSA 1WRBA 2G6TA 5A2QM 1IVYA 5C52B 1FTSA 2FR8A 3VTAA 1PQWA 1VJ1A 1QO7A 5JXWA 3LCJA 5IEJA 1N25A 1VE6A 3OPVA 4FLZA 3A3OA 4DBLE 3PKZA 1CTQA 3UFBA 5BN3A 3D7RA 2B8JA 2C9ZA 4PGAA 3YASA 5AVKA 2LGQA 3U3KA 3MCQA 4YR9A 3SFTA 1M2KA 1D5AA 5B5SA 3A06A 3K5PA 5J2UF 4KHPB 4C82A 1PL0A 3DTVD 3KJZA 3KWLA 4KUEA 4ND8A 2VR1A 4N3CA 1RAGA 3AL2A 3RC2A 3SYQA 4NQRA 2P9BA 3LX4A 1FRQA 4PA6A 1PFWA 1OX6A 2VOEA 4XB1A 3AKCA 1IONA 2WUFA 5IC4A 2I1LA 4EVQA 1JAIA 1FFCA 4HXFB 4UE2A 2ATXA 4WNAB 2J3QA 1IH8A 1HH4A 1U9CA 4P0QB 1J6UA 4ZT4A 2H6LA 2UUAO 3WV5A 1T2CA 3WWEA 4ALMA 1KYWA 1F7VA 2Q6KA 4OFXA 4AQDA 1OBFO 3QU4A 2W2VA 3E84A 2DFDA 2YH2A 2IUEA 3FZGA 1EUZA 1W0JA 3GEHA 1PZXA 3IQXA 3AW8A 5D7BA 3I01A 1YTUA 1Q6YA 5AWFC 3QVXA 5J9PC 3QE0A 4FGKA 1C8VB 5YASA 2BGNA 2BCCH 1GNVA 3P0RA 4GDFA 2XZLA 2GRAA 3NCTA 1U97A 1JAXA 2UUBB 2X0LA 1GPDG 3I28A 3GT3A 3S8YA 3J81N 3H9EO 5CNMA 4Z1MA 2Q8QA 3PDIB 3ASNC 4BWVA 4GC5A 4H7PA 1GN2A 3GEEA 3DP7A 4RVOA 2VBIA 1VL1A 3MOGA 3TSOA 2EXXA 4RVCA 3NDIA 4ZYLA 4M98A 1HG0A 5TJHA 3C9RA 2I3AA 4L8FA 4RXUA 1WCXA 2F4VB 4BZQA 2AGAA 4OKNA 2FYTA 3W4JA 4QU5A 3FFXA 3KNZA 3AF2A 1L5WA 3H5IA 5KYWA 4I9FA 1KRWA 1WBJB 1KYQA 3MTJA 2C5BA 5K0TA 1ZUNB 3ROQA 1VFPA 1F20A 1UM9A 3ZIAA 4MW7A 3NRBA 4I5SA 1QLHA 4A0HA 4AJ9A 2XMPA 5JJEB 3DTTA 2PFGA 4P4LA 2ZYDA 1P7PA 4CEIA 2JL1A 3LNCA 1NFRA 1X80A 3ZN0A 2C99A 2A3QA 1NM5A 2VDPB 4TT3A 1TYBE 3MA0A 4WESA 1V47A 1X7YA 2Q5LA 3E23A 1QUFA 1F4LA 4EI8A 2H4ZA 3FX2A 4K8ZA 5JQGA 4J4BA 4OU5A 3OCWA 5FPRA 3T4XA 4ENWA 1A2BA 3FCSB 5A2QA 4AJLA 2Q0QA 1JQJC 3KOMA 1S0UA 3KU4A 4GRAA 2OGSA 3KK0A 1YRBA 2YYSA 3FFBA 5DB4A 1VMAA 2JATA 3PPXA 2QKCA 3JYCA 2C7RA 1QVZA 1E7WA 4DC1A 3APQA 4KR0A 5AM2A 2PIAA 2N05A 4MTCA 3BJMA 4B46A 4Y9UA 3IPLA 1SKVA 1P4SA 5FPOA 3MWDA 4ZV7A 3LQFA 2OHXA 2UZ0A 2EG5A 4ZDIA 1E2FA 2HBRA 1LPAB 1YTLA 1QF7A 1Q77A 2E5LO 1XHXA 1VJDA 4E30A 5GINC 3EZ6A 4QBGB 2J5QA 1W96A 2RAVA 1N7IA 1UPGA 1W48A 3MEQA 2Q2QA 2CL7X 2JBAA 2CFTA 2M6LA 3JR7A 4WZ6A 1C0LA 3NHPA 3ZCPA 4MARA 1SZDA 2QLNA 1JJVA 3K04A 4PN3A 5FO1A 1SDSA 1SBQA 5DNWA 1VZ2A 4BX0A 3WYGA 3U9LA 1BEUB 1I3LA 4KYTA 3KXDA 4G4GA 3FXAA 2YIBA 1YZYA 4ZD6A 1E8MA 2AZXA 1BEZA 3Q3IA 4LMRA 4G1MB 2I3BA 3K94A 2BKXA 1J5EO 4DLAA 2EIKC 2IU0A 4TTJA 5ALSA 2HX0A 4G5FA 2J7KA 1O9GA 1QD9A 4YHHB 3WGNA 3GLFA 2Q6OA 4Q6GA 5KHGA 4BB9A 1LVUA 1Q7YW 4QYWA 3USCS 4ZYUA 1B8NA 1OWPA 1FS4A 2H1HA 3EBPA 2JLBA 3NZEA 3TQIA 4KU4A 1GAWA 2PLAA 2E4XA 3PVSA 3BJIC 2GRJA 5JQGF 1A77A 3AFHA 1H6DA 1XRSB 4HC4A 2V8OA 4OH1A 2ACEA 4E15A 4OGQB 4MWEA 3K0DA 3KSMA 5DHRA 1QPZA 2P3QA 2HP0A 3RA5A 1H2LA 2IWRA 3KQMA 1W1UA 2VSQA 2WHQA 3AP2A 4EJFA 2WOOA 2QP4A 4F91B 4GVPA 2GEJA 5IKXA 4C0BA 4UQLA 4ZTZB 1QH1A 1C3VA 2BMAA 5KJCA 3FPKA 3AI1A 1H66A 2XAGA 3V7EA 1WB8A 1DWUA 1K3EA 4OI4A 2ZE6A 3EQ8A 1K5SA 2JLUA 4L0DA 4PWZA 3W5BA 1LPNA 2ASEA 3R9KA 3ZD7A 2WG0A 4PYMA 1Z9BA 4CQNA 4DMGA 3DL2A 5DCYA 5L3BA 4Y8VA 4AZVA 3EIXA 2LW1A 4UBJA 5ITWA 2XDAA 2BP7A 1X42A 2HLDG 4P54A 2YZKA 2WINI 1WW8A 2VQDA 1FDIA 1JG3A 5KQGA 2Y9MB 3IPRA 4BUCA 3VFDA 1T4BA 3SKVA 4XPIB 3VZSA 2GAIA 2WSSG 2WLMA 4Y30A 5LYJA 1SELA 5JAZA 1XZAA 2XUHA 2Z57A 4BIMA 3DNPA 1RAEA 1VQKV 1XQ8A 3A0RA 4L95C 4EFNA 3ABMB 2IHZA 4Y2UA 4MTLA 3E82A 4HAYA 4MMYB 3RAGA 4EG3A 4UPDA 4PVDA 1TT5B 2GEFA 5DHAA 2R44A 3EXIA 2AMJA 4IEIA 3QTCA 4QA9A 3IAM1 2MMGA 4C4SA 4PJ0Z 3C9TA 1XO1A 4G4SP 1CP9A 3RU9A 4J76A 1F0PA 2H2AA 3AR2A 1IEWA 3ED1A 1PT6A 3O65A 4FDAA 3VH2A 2ZU0C 1T0HB 2C2AA 5EB1B 3SPXA 3GRPA 3L5KA 4QLBA 3EWNA 1XX6A 1Z75A 3K08A 3FTNA 1T0KB 1ES9A 4NENB 4F86A 2MDTA 2GJ9A 4X0EA 2PH1A 4F46A 1V5WA 5IP5A 4ND6A 1JVBA 5FA8A 3IGAC 3OKPA 4INOA 2HA2A 3O1LA 4BVFA 5GAJA 4B74A 2WT8A 1WV0A 2UZ1A 1CUXA 2PX4A 3KZNA 1CUHA 5HDBB 2LP7A 3DE6X 2LBPA 1GJRA 4QQKA 1NVEA 3NHLA 3N5KA 3O8OB 1RC8A 3L7DA 4B33A 1ZVKA 4CUJA 1FNBA 4YCAA 2YJ3A 4XDJA 2O20A 1M74A 1FJGO 2KW5A 2NIPA 2BUBA 2QR2A 2RJ3A 3V8MA 2JLQA 2Z95A 4G65A 2Z1UA 1AKRA 3VQYA 3BD8A 5KVAA 4IDBA 3HJFA 2IPNA 1PKEA 5F5LA 2J3DA 3RNOA 1C9KA 2P2YA 5LYJF 2ZE8A 4TV9B 1EXMA 4WA7A 4G1UC 4P1ZA 4EABA 4RCVA 3H6KA 1ZGJA 3QEMA 1XEQA 4YO7A 3OT7A 2V7TA 4B1FA 3FOCA 1NHWA 2ZYVX 3EY9A 3NC0C 3BXEA 4A2QA 4UCOA 2SECE 3TCXB 1HOXA 4UOEA 5GVRA 2LVBA 3WGGA 2Q6IA 4QEDA 2R1VB 2DSNA 3CCSF 1SD1A 1DX4A 4TYNA 4KYIB 3JVUA 3AV0B 1T1JA 2R00A 3H3FA 5P21A 1YL7A 3OLQA 3IKLA 2VRCD 3NWPA 2FSFA 4D3DA 3VR5A 4AMUA 3VNBA 2W70A 5LZ7A 2Q1XA 1QX3A 5FAXA 1ZHHA 1U81A 4ZQGA 1ESNA 2QTVB 1OQAA 3DCNA 3UJBA 2CWWA 4XARA 2F7SA 1WQ4A 2O2XA 5IH7A 2G8NA 3GJQA 1QUEA 1SUAA 5ED0A 4P98A 1VCIA 2NU6B 5TQ0B 1TEXA 3HCCA 4G89A 1OCZC 1T25A 5FWAA 4NVRA 4MEJA 1ESEA 3SN6A 4UEOA 3WAJA 4CLRA 3NMUC 4DSUA 1CEXA 1DT5A 4Y2JA 3L06A 4GW3A 3LPLA 1Q20A 4BGIA 1M0EA 1VQ7F 5DEIA 2DHQA 2YWEA 1QE0A 3VAZA 1ZD9A 4JTDB 3KSBC 5DGIA 1AGPA 4GMGA 4KUMA 3EUWA 2PZLA 2G88A 4FJ1A 4G28B 1TJ3A 3QLVC 2NVUA 2AZ0A 2P9YA 4TMVA 1KO8A 2PUGA 1K06A 4Q7JB 2CXRA 2X9NA 4LDZA 2UYNB 4BN4A 3URMA 3T0GA 1XTUA 4DJAA 1Z26A 1T8SA 1MTZA 1KY3A 5JH7A 2QI2A 1KOLA 1NBMD 1U80A 4UUOA 3I52A 1IBCA 1K33A 2FEKA 5TQJA 2WHXA 2AMLA 5HXZA 2AZTA 4HTAA 2OY0A 4R9RA 3W5AA 3QRWA 5K0LA 4GSYA 2XUPA 1OGJA 3N8KA 4PFJA 4F0JA 1Z4OA 3RRXA 4IIJA 4WFIA 3ZEIA 2IODA 2XUAA 3ACDA 2E3CA 1QWOA 5GONA 1DCMA 4F2GA 1MPXA 4YIPA 1SBNE 1BROA 4X6LA 4DGQA 4Z4IA 2R87A 1WMAA 3HG7A 2CEAA 2ON6A 3EZYA 3UWOA 4FMTA 2J32A 2FSSA 3Q6MA 1O94C 2P6JA 2I62A 4F9GA 4IYHA 3OTOO 4LF6O 3CUWA 3VZCA 1S7GA 3GUVA 3JD4A 1OWMA 1SC3A 4QO7A 3MJHA 4NOMA 4X3OA 1KIAA 1IEXA 3WWCA 4WMLA 1UUFA 3TZCA 4K6CA 3OM0A 4R8SA 1XZCA 4IZHA 4RSRA 3A9UA 4Q9IA 1CPYA 2CF6A 4H0CA 1EM1A 2VZEA 4XDZA 4IQFA 4HX5A 1L4UA 5ALFA 2Q5EA 4O2AB 2P3SA 4H7DA 2BOBC 1PP4A 3HFJA 2XCSB 2Q41A 1BSMA 3UM9A 3KLPX 4KPUB 4CQLB 5EO3A 1JDZA 3WZLA 2XAAA 3AXSA 1DJOA 5T4BA 1NJ5A 1WN7A 1KNQA 2XVAA 4P2GA 1Q84A 2JHGA 1EFKA 2JF0A 1KI9A 1XZFA 3ABUA 1PBNA 4N5DA 2WKSA 5JH7F 4Q1BA 1S9DA 5HQJA 3G4SV 1LXCA 2QP3A 3D8UA 4LX8A 4RO0A 2PH3A 1HE3A 5JSQA 4JLKA 1NR1A 1BCRB 1AIPA 1NVDA 4WCFB 3IMPA 2QAGA 3M2TA 1UBUS 2IS4A 4IIJF 5LZ2A 3DZ8A 1OAKA 3ZGOA 4NG5A 1ORRA 2JHFA 1QIGA 3HDVA 4I1RA 3BWEA 1EZZA 2G9ZA 3FKSD 5GONF 1Y76A 4N5IX 3AC0A 3TINA 1TZ2A 4UHFA 5K4HA 4JI2O 4R7TA 2H07A 3FF1A 3NATA 4KQJA 1I5XA 4Y98A 1A5SB 5EWMA 2J4DA 1TZBA 2GGSA 1V4VA 5G2OA 3ZVNA 1YVUA 1AQNA 2VK2A 1AN0A 5T7BA 2MINB 1U2DA 3WDKA 4RD4A 1G1XB 2YS7A 2YRXA 3NETA 2OM2A 1AHHA 5D86A 3DTVA 3K2BA 5E9AA 1AI5A 1DO0A 3AR5A 4XQ9A 4MW9A 4EDHA 1KQSF 4C3UA 2ZSIA 4G4ZA 1SCBA 3K32A 1DIRA 1LEHA 1V45E 5A4MS 3B7PA 4PPFA 2WRZA 2VJCA 1I2AA 2O8EB 1L5KA 5FI3A 5BSEA 4LOIA 1YS4A 1GADO 2W00A 2X0EA 1N0HA 5KMGB 3SZUA 1VA5A 1TZJA 1ZMXA 4AJNA 3V1UA 3GFQA 5HRUA 1I9CA 3HB3B 4HB0A 5IXJA 3ANYB 1D2RA 5ICFA 4HGYA 2F62A 1HFEL 1JT2A 4ZT3A 2RMKB 3HUEA 5CP8A 2WM8A 2ZCEA 5FEMA 1GZSA 4W8GA 3TX2A 4C43A 2CNNA 4R1QA 4RZXA 2PYDA 5BRJA 3NIFB 3HR7A 5EI5A 4WKOA 1ZNWA 4QPJC 3I56F 4CKXA 1ZK3A 2QV0A 1ZVQA 4C7OB 2JJQA 3ZHTA 2PL3A 1FUEA 1ZCJA 4P83A 4KFSA 2IS6A 3VYTC 3RKSA 2FQQA 5EJ4A 5FWXA 3EG9B 4CFYA 1M0WA 3BYQA 4JC8A 2PUCA 3WMXA 5JCJA 1CUAA 4FGJA 1Q0LA 1T0JB 4PZEA 2CSLA 2Z1DA 1D0IA 5JY1A 1NMSA 2HWUA 1QQ5A 4ENVA 2WA4A 3OW2U 3K9LA 1J1ZA 4F06A 2L6LA 2PGOA 2P2LA 1PR1A 3IXLA 3WWZA 5ALYA 1V39A 1VYHA 4HAIA 3KETA 4ZEMA 2H8KA 3BIJA 4Y1RA 3HUTA 2GI4A 4OX9O 1UDWA 4EVSA 4WRRA 4FI3C 1W5EA 3IR9A 3N1UA 4ZN6A 2JANA 3JTMA 4TLDA 1R1DA 2OZBA 4BO0A 5EHQA 1T43A 5BORA 1VYTA 3W1WA 1VBMA 2Z8YM 4ZCQA 4TS9A 4YRLA 2JBHA 2WIBA 3ODPA 3RLFA 3OM3B 3PGKA 3OUFA 4ZI2A 3HJUA 3OQVA 5F77A 1XN1A 2XCRB 6ABPA 4HGRA 3HXLA 2KM1A 1IZ9A 4UC0A 2R8PA 3DKKA 2CKDA 4HYOA 2XYPA 1EESA 4H2DA 3Q8MA 5HQ3B 4H60A 1TTTA 4ERXA 3S2EA 2WK1A 3PEVA 4AJKA 4IDAA 2FEMA 4GVLA 1V9SA 3ND8A 1TYCA 1AHPA 1I2CA 4E6PA 5FADA 1BGVA 4NCNA 3MT9A 3LC1O 5H0IA 3UJ9A 3D7MA 4TWKA 2XMZA 1EDBA 1OZHA 3WGJA 4D7TA 3D2LA 1J5PA 4L8LA 1QS0B 4GMHA 1D4ZA 1K86A 4JB0A 4I8XA 2XDQB 3Q2KA 3HU3A 3PR1A 1MG0A 1UAYA 2H5EA 3GZJA 1UMDA 5C5IA 2YWRA 3ZE1B 5CA0B 1IY8A 5T41A 3U40A 5EIAA 1NQ5A 4YP9A 4MWGA 5LLSA 3WK8A 3WPXA 2B36A 1RT9A 4PELA 2Q0XA 3DLAA 3JPYA 2IHJA 4HX9A 4F71A 1KDPA 1VPDA 4FXOA 4KWHA 4IMIB 1ECFA 1KK1A 4DMUB 4E21A 4WECA 4QUKA 4QZVA 2HS0A 3MJTA 2MSCB 4N5HX 4AY4A 5CIQA 1FYFA 1XLWA 2QQEA 4KSBA 1IBSA 1TI7A 3RYFA 5L3EA 2VPWA 3EASA 5LQDA 3H5RA 1GU7A 1YB2A 1VOTA 1NW6A 1TU4A 4M86A 1HNXO 4ZZIA 1XT6A 1QLEC 5AHRA 4IIHA 1EVKA 2H1VA 5CA1B 5IYZA 1VHJA 2PEZA 1ZH2A 4D9CA 3V5NA 1K4KA 1CRQA 1K8XB 1M6NA 3FH0A 1D6SA 1WA8B 3QW4B 6CHYA 5KUTA 3AESA 1AMUA 5AW3A 2EEZA 3QI2A 1CT9A 1QVFU 1JSZA 3OD1A 4CKCA 4HWSA 3WRYA 1GR1A 2QV7A 3U4QB 2ZCJA 2HU5A 4ZEOA 3T1TA 4OP1A 3I2FA 4HAMA 3RYCB 1OV4A 1KJQA 4GWGA 5SY6A 3PXDA 1BJKA 3JTEA 4YREA 1GVHA 1P2GA 1GL9B 5C34B 2VFAA 3EZNA 5KYXA 3FG9A 4IVPA 3AHEA 3RQSA 4U63A 2AX4A 4B3XA 3NIGB 4QLOA 2PS0A 1YSCA 3RUIA 1PSWA 1NKVA 4LDNA 2IWHA 1MCZA 4BNHA 2Z1EA 4DUYO 3GO4A 4J0CA 4PBSA 2XVMA 4NNJA 5BOSB 5EYPA 3V4SA 2GHYA 1E2LA 1PJ2A 4MT8A 2FQXA 2QWRB 1EN4A 3A0UA 2ZR2A 2IBSA 2IDJA 5B6JA 4G07A 3KJGA 1ZA2A 3NGXA 2VHVA 1N7HA 3LSYA 1J49A 2GN0A 2Z8YA 5I5GA 3IQWA 1M93A 1YK0A 2CDCA 2SKCA 5C0OE 3N0TA 2R8YA 4E3ZA 2O2SA 2OG1A 3K9WA 1WU7A 4J2TA 4I4CA 1NQVA 4AN4A 2LDXA 3AG7A 1FU7A 4P0TA 2Y68A 2PE5A 1IQUA 2JK5C 2CMFA 4HGOA 5AKYA 1TLLA 5TV2A 1V55B 2PVSA 1H2FA 4D79A 3GGCA 4RYLA 5IYZF 4IHQA 2XTMA 4W5TA 2PT6A 3DMPA 4MHSA 4YMIA 4DJDC 1W0KA 3GX1A 2OYRA 2XCQA 3E83A 5FAKA 2DJ5A 1O96B 3LOUA 3RVOA 3S68A 1Z3IX 3LX6A 4JYZA 2FPXA 1RLIA 3G8YA 1HKUA 1KR5A 4UZFA 1EBUA 2B8TA 1CRWG 3WKDA 4F5YA 1WHTB 3E8GA 2A9RA 3BE4A 1NXSA 2X14A 2QK4A 2BSKA 1SUBA 4FUQA 4BVHA 3IURA 5HNKA 3STTA 3LCMA 1GCGA 1QHTA 1RQ2A 5EE0A 2ARKA 3CCLF 1BG6A 1QHFA 2FK8A 4NFSA 4CLEA 4AAYA 2VCEA 4Y1GA 1KDRA 3I7TA 1XBTA 1QVAA 3WMFA 1REQA 2W71A 4K35A 3NPAA 3MWEB 3BA8A 2O5RA 4PIVA 1T10A 3GI1A 2BBSA 4GXQA 4DADA 5AT1A 1FMJA 5THQA 3GB7C 1KBOA 2WDPA 2YQ5A 1SKYE 1EHIA 5JJ5A 2AFHB 3GJ6A 4LWSB 2P8JA 2PXAA 3D8TA 3UMGA 4ESVA 3B1ZA 2C9YA 1I5YA 4ZYWA 1Z07A 1JEDA 1JEQB 4X8AA 2VRZA 3ZV3A 2CDNA 3HZOA 3DPIA 5JDCC 1E0SA 1RI3A 2EJTA 4J9ZB 4FOSA 2WF9A 2KB0A 4PDMA 2JH9A 1T9BA 1YQQA 3PC4A 4V0QA 1Y6GA 3L72H 4GGPA 1XKLA 3OSZA 2FSUA 3FNBA 4FZ1A 3RYHB 5JARA 1B14A 3QLEA 2IL1A 1I3OA 4UTOA 1VMKA 2PGDA 2M6SA 2CZQA 2CLEB 1YJAA 4CPDA 3VYUB 4QLAA 4CM4A 5ALGA 2CHSA 4KAFA 4BMVA 4H7HA 3RLIA 1HDRA 2C7BA 1P39A 2QJTA 2Y69C 2PXHA 4MP8A 3ETEA 1HNWB 1TCVA 1V2GA 2X9GA 5LGTA 1OTYA 3LTEA 3CH7A 1TAEA 1RYFA 2EDCA 2GPBA 3DG9A 4UHHA 3ZK7A 3ESYA 3D7KA 3AY3A 2YEVA 3NOVA 3UPDA 3BD7A 3OMNB 1YKSA 2BEWB 5ICEA 4KBGA 1Y8RA 1EFUA 5EFZA 5AHWA 1NBMG 2XQGA 1TA0A 4I1UA 3S29A 2ZXWB 2PDAA 4PTZA 1TNDA 4J94A 3C74A 3WJPA 5B1IA 2XDWA 3GCWA 4YLEA 3PJRA 4BFVA 3CS5A 1P84F 1YDHA 4MLPA 5KTSA 3T54A 4ZQIA 2QE7A 5KSOA 4EA7A 1QFSA 1NYRA 4I5GA 3AP3A 2Z6AA 1PD3A 1KKLA 1LPBB 3IKJA 2IV2X 2YIBD 1S72F 4Q9KA 3KYDB 1EQ2A 2SICE 2IG8A 1UT5A 1B0UA 1ISFA 2PX8A 1M83A 2BEUA 3E1GA 1IN1A 4FYIA 4QU9A 2JFQA 1RBYA 1C5KA 2FN9A 2QYOA 1WMEA 2V7PA 1GN9A 3TQSA 3VUEA 2CMHA 1ODTC 1G42A 5KCZA 1WNSA 4BVKA 4DEYA 4F3TA 4LQ4A 5A5DA 2GCEA 4G0NA 4OH7A 4W9NA 4L7VA 4JLNA 4PYNA 1J9GA 3NTUA 1OCCB 4FSXA 2OE2A 2RHWA 2JI4A 1HE4A 2BM1A 4MCJA 2MSWA 2DJIA 4B76A 2AZ2A 1UFVA 4D56A 2V0NA 3QTYA 2GMWA 4XIIA 3PYMA 1NBMA 3CPJB 3IELA 2F1JA 3K06A 4BFYA 1GQOA 2XKKA 4IEFB 3NHAA 2V1XA 3H0CA 1G5IA 3HCDA 1HEUA 1X92A 5ILOA 3TH5A 3U4IA 1QQ7A 5EZYB 1J39A 1KO4A 3O21A 2XSZD 1LF0A 1K4YA 3BMNB 2ZJ1A 4MRMB 2X8JB 1VLVA 4O4HB 5D5QA 2ZM5A 4WCDA 2AOUB 4RULA 3F7NA 4MCIA 2PBLA 4RUFA 4N0QA 1NT2B 2LDBA 1G41A 2O54A 4LYFA 1DAPA 4RHEA 5DN6D 1C8LA 1QWSA 7MDHA 3ZXUB 1EDEA 1ODIA 3OFVA 3HUDA 3G5TA 1KNKA 4C6TA 5KDLA 3N7AA 1IY9A 3H4TA 3C5VA 5HJEA 3UC9A 1ZJZA 4RQFA 1EXWA 1M0SA 3MJVA 3ITEA 3AL0C 3UEOA 5BV8A 1YQEA 1F14A 2Y77A 2PX3A 2ZXEA 5JPDA 2J87A 1MENA 2W2TA 4F4HA 4UU1A 2H52A 2FRDC 3FKSG 2EKPA 5EP3A 3D8RA 4HNQA 3VKGA 2OPHA 3BHMA 3TE7A 4BBZA 4OXQA 2GN4A 4B9EA 3K0BA 3U44A 2C2KA 1T15A 4MW1A 5AKHA 5C8VA 3ESXA 1SBYA 1XLVA 4DCSA 7REQA 2O7VA 4ZO8A 3LP8A 1Z2NX 1UK9A 3K2EA 5FBLB 4OSOA 3EIFA 1HETA 4ZCLA 8ATCA 3G3EA 4JLVA 2WB2A 1V1JA 1Z4MA 5GP1A 3GP5A 3IYLW 4YC7A 4QIHA 2WLKA 3U61B 2HADA 2Q8PA 3ER9A 3ZU6A 1UKVY 3BZUA 2X4GA 4JA0A 1IZ7A 3E9ZA 1M1YE 3P0EA 4DIBA 5KEIA 4FE4A 3OAAD 2DP4E 5AFSA 5KYKA 1DKRA 5FCDA 5FUXA 4YGYA 1Y6RA 3B6IA 4LV5B 4GXRA 2HCRA 4TL6A 1T0PA 2A84A 4E5MA 4C0WA 2BKLA 4MQ4A 1U0NA 3G2PA 2RONA 2VSOA 5DYIA 2AHZA 3DZKA 2AKYA 4F72A 3NEYA 4MS1A 1JLHA 4UUMA 4XEUA 3NI2A 2I3GA 4P7BA 2VA8A 1LLDA 3OQBA 2JLAA 4M87A 5K7SA 3S2ZA 2DUJA 3ER6A 1WULS 4O6VA 2QTZA 2YIAA 1NBIA 3SIUA 2HQ1A 4HX2A 1BWPA 4OFBA 5KDOA 3T7AA 1R4NB 4B3TO 4HQRA 4UCXA 4GHWA 5JMOA 1L4EA 4HLUA 2I80A 3DV2A 2R4TA 5K6TA 3GAMA 3JQRA 2XNJA 3A25A 2EL9A 4PZ9A 4OL0A 4INJA 3IT3A 4DPKA 1DQZA 3WXMB 1G8SA 5AXDA 1IQRA 3GGJA 4YAJA 3VU1A 4ILKA 1JFFA 1PF7E 3TDMA 4A27A 3EXHA 3TFOA 1RTKA 4M0KA 1OA1A 2X5XA 5EHGA 1TEVA 1VLHA 1AG9A 3UT5B 1BS9A 3WQHA 5HHTA 3NOQA 3ISJA 2WJ4A 4B4WA 1WLEA 2ATCA 4K6HA 3PEUA 4EYQA 4MO2A 1EBOA 1G5QA 4U2EA 1UJWB 1CJSA 4ANFA 1K73W 2NSHA 3VR5D 1U28A 4FMBB 1AJNA 3OMLA 3DO8A 4JJZA 3WE7A 3G6BA 3FNEA 5B2FA 1NVAA 2ZWOA 4RSHA 1QSGA 1Q81H 4Z53A 1R74A 3QIVA 1G55A 4J75A 4A8JC 4FCWA 3U37A 2R8XA 3DKPA 3PLAE 1T6YA 2R85A 2GTAA 4EPYA 1YFJA 1OOEA 5K8TA 1VXRA 4BGUA 2H2FA 4IMRA 3EBLA 4JIMA 5DNEA 4DYLA 1AMNA 4PLPA 2HHAA 2BSXA 2XYRA 4HZUB 4WZBA 2GM5A 3L1IA 3OCJA 5K3SA 3EODA 4WASA 3NYRA 1KHHA 1D7AA 5LM3A 5KOJA 1CUZA 2ZM6O 5JD5A 4RHUA 3WFVA 3B5JA 3M5DA 2B6HA 1IZYA 2PA0A 1FTNA 4E1AA 2E48A 2FEAA 4G5GA 2QWNB 3QUCA 4QE9A 1SKBA 2CVPA 3K05A 4F4CA 4BBAA 2UU9B 3TAUA 3UMVA 1U65A 1IVSA 1Y6JA 3PVCA 3NVDA 4K3UA 1EK5A 5CYGA 1M2WA 1CIPA 4JXZA 1Q6UA 5H5JA 3HZHA 3OE7G 3DUFB 5GTDA 1P19A 1HLFA 2YV3A 4KNVA 4L8WB 4UVEA 2ZUCA 3ZV4A 1P49A 5EPEA 3LP5A 2PGAA 1DXQA 4INPA 3AG2C 3I5UA 2PMEA 1X7WA 1HPLA 3L77A 2Y1KA 3PFFA 2JS3A 5D3MA 1XNHA 3VKFA 2DT4A 4WHMA 3W7XA 1W4AA 1A7AA 3U6BA 5JBQA 2QTFA 1NXTA 3WL7A 3ADDA 1ZWKA 2QE6A 4O02B 1NTMH 3LWDA 5IJAA 1QTNA 2YJZA 1LC0A 3ON5A 2WUEA 3BL8A 3UH0A 2EKZA 2C7PA 3PL5A 5D3QA 5ER9A 3WZ2A 4IHKA 3VNAA 3ZGYA 4FZRA 1GXSA 1B8OA 2P2DA 3DWGA 4RGVA 4A2WA 3AZPA 5I7WA 3GQVA 3DC2A 3EPPA 1Y3AA 3ETLA 4BXOB 2ZWVA 1EWQA 1CUIA 1PCXA 2ZATA 3A6KA 3ZE0B 2HKOA 4KI0A 3BGSA 3UQ8A 4PLHA 1PNQA 3JARA 4JJAA 3KO8A 3EZ7A 3VVLA 4NEQA 4RA6A 1L8LA 4QUBA 1MRZA 4EI9A 4URFA 3L3BA 1H1LB 1L4MA 5CX1A 1DV2A 2NOAA 2VH2A 2R86A 3TPCA 4ZGGA 1PWZA 2GTPA 4B3MB 4BRZA