5IJ9B

Cryo em density of microtubule assembled from human tubb3-d417h mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNHLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 140
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5ij9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5ij9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5ij9B01
3VO8A 4O4HA 4M8IA 4I4TB 5J2TB 4X1KB 5JVDB 5CA0B 5LOVB 5J2UA 3RYFA 4O2BB 5ITZA 3VOAA 1OFUA 4U3JA 1FFXA 4FFBB 2BTOA 5KX5B 5KMGB 3JASB 3RB8A 5IYZB 3R4VA 5GONA 4I50B 4WBNA 1W5FA 4I4TA 2RHJA 1TVKA 4F6RB 3HKEB 3RYIB 5LOVA 3JARB 4TV9B 4ZOLA 4TV8A 5MN5A 3UT5B 1FSZA 4O2BA 3JATB 5FNVA 4O4JB 3WGMA 4ZHQB 4DXDA 3HKDB 4X1YB 5LA6A 3JASA 1SA0B 4DRXB 1TUBA 3N2GA 3WGLA 4I50A 4YJ2B 5CA1B 2RHLA 3M89A 4X20A 4F6RA 3HKEA 3HKBB 3RYIA 5LP6B 1W5EA 3JARA 4TV9A 3UT5A 1RQ7A 2RHHA 5IJ9A 3RYCA 4X1IB 5IJ0B 1JFFB 3VOBA 4DRXA 4YJ3B 2BTQB 3N2KB 5JH7A 4ZI7B 5CB4B 3VO9A 2R751 5J2TA 3JAKB 4X1KA 5JVDA 3WGNA 4B45A 1W5BA 5CA0A 3E22B 2VAMA 5LYJB 4O2AB 4U39A 2Q1YA 4EI7A 5LXTB 1JFFA 3VPAA 1W581 4FFBA 4YJ3A 5EYPB 4LNUB 5KX5A 4ZI7A 5JQGB 5JCOC 4IIJB 5KMGA 3ZIDA 5IYZA 4TUYB 2XKBA 4I55B 4O4LB 1RLUA 5MN4A 2GVIA 2Q1XA 3WGJA 5LP6C 3RYHB 5EZYB 3E22A 3C8LA 5M7EA 3ZBPA 1Z5WA 4O4IB 3JAWB 3JATA 4O4JA 4ZHQA 3JALB 3HKDA 4IHJB 4X1YA 5EYPA 2VAPA 4XCQA 1SA0A 4IIJA 4O4LA 3V3TA 5JCOA 2VXYA 4YJ2A 3ZBQA 3HKCB 5CA1A 4EI8A 5J2UB 5EZYA 3HKBA 3RYFB 5LP6A 3M8KA 5ITZB 1FFXB 4O4IA 5BMVB 1RQ2A 2VAWA 3JALA 4IHJA 1Z5VA 4X1IA 5GONB 4WBNB 5IJ0A 2BTQA 3N2KA 1W59A 4EB6B 4B46A 5CB4A 1TVKB 4HNAB 3HKCA 4KWEA 4ZOLB 4TV8B 3JAKA 5EIBD 1W5AA 5FNVB 5LA6B 5LYJA 4O2AA 2RHOA 5BMVA 5C8YB 1TUBB 5LXTA 3N2GB 4E6EA 4LNUA 4O4HB 4EB6A 5JQGA 4HNAA 4TUYA 4I55A 4X20B 2XKAA 4EI9A 2R6R1 3WGKA 3RYHA 5IJ9B 3RYCB 3CB2A 4U3JB 5JH7B 5C8YA 5MN6A 3JAWA 5EIBC
chains in the Genus database with same CATH superfamily
1CY6A 1IHUA 4R54A 5ERXA 2DR2A 2JLSA 4GD3Q 5I9BA 2QMOA 2GXAA 4QOEA 1G291 3RRMA 4YHHO 2SHKA 4BL5A 3OOSA 4AYXA 2PCJA 1ZUNB 1X86B 3R6DA 2EQAA 4DIFA 3CSXA 1DT5A 1PAUA 3L6DA 4DGQA 4XZ3A 3GLQA 4OI4A 4PR0A 1BDJA 1X1TA 2UUCO 1HNXO 2WWWA 3N3BC 3ZWMA 1G16A 1RAFA 1ISFA 2JRIA 2O48X 4YXWA 5EWMB 1LVGA 1ULTA 3LPCA 4Q03A 3ZK7A 1E6KA 4F3TA 3SXPA 1PUJA 2P30A 2FEXA 4KLAA 2H57A 1BCCH 4GLJA 4IIBA 1R9JA 1B00A 1XNGA 4CEJB 2NACA 1XTTA 4MULA 1P31A 3Q87B 3HJNA 3R3SA 5H82A 5KX5F 1IQRA 3H1BA 2XPCA 2OO7A 2RKWA 3KQVA 4QDJA 4LVOA 4GX5A 1FMTA 2DW4A 3SJCC 3WRXC 3Q7QA 3WE7A 1UPXA 2RG1A 4QZVA 1T5TA 2A0YA 1W85A 3ROZA 3KSMA 1B3QA 2Z6QA 1KI6A 3AV0B 5DO9A 4CG3A 3RJ5A 3DQZA 1B8PA 3IGAC 2BJWA 2AK2A 5DW3A 1GKYA 5FULA 5HCIA 5HKOA 1SCUB 3W3AD 1RBQA 2AUMA 4BU1A 3KLOA 3AI3A 5I9TA 4L6AA 3VKHA 4C4XA 5I48A 3AYZB 2ZRBA 3GC6A 1L7XA 2C83A 1WBDA 1KRWA 2AWOA 1KO1A 4KXWA 2YVKA 1RM1B 3COYA 1G98A 2JGDA 3IVMA 1YL6A 1I3LA 4JB3A 4A10A 5BRAA 4F9FA 2WLLB 1KAEA 3D5QA 2I67A 1NRIA 1E1QA 1U3GA 4JHLA 4YRBA 2LJ2A 4M3NA 5MGBA 2Q27A 5CG1A 2JFFA 1QYVA 4TMFA 5CIQA 3LUPA 3AVXA 1P2DA 3SIRA 4OK6A 4X3MA 4FDVA 1NQVA 1AJQA 3NNSA 4DAEA 1IE3A 1XBLA 1VSVA 3V8VA 4DLVA 4YFVA 4MQEA 3W5CA 1Z2GA 1GN3A 1ZGHA 3H9VA 1Q44A 4MR7A 1OB5A 4GYWA 4HQFA 3D81A 3H5RA 1OREA 5FHRA 3C43A 5CLFA 3STLC 2Q3LA 2CJYA 1PJ4A 4EL5A 1UFIA 3ECAA 2FWJA 4C89A 1MHPA 4Y1FA 4RTRA 3VZPA 2OCBA 4I14A 1F38A 3MJRA 1L7QA 1BDIA 2P9GA 2VNHA 1IEVA 4Z4GA 4RK4A 2YTZA 4OB7A 1J2RA 2Y6VA 2ZB2A 3ED1A 4UXHA 1ZCZA 3BY6A 4RZQA 2VP9A 2GH1A 4RO2A 4TT3A 3DVLA 5AOAA 4WCFA 2YWFA 3EZXA 3BSYA 1AJEA 1CRPA 1G9XA 3Q7PA 1JEYB 2WUDA 4LF4O 2PRYA 4B73A 4JV5O 3QNUA 4ZYVA 4OLAA 1I4WA 3GIDA 1KFKB 5CEFA 5E1DA 4XLLA 3U4MA 3ZP4A 3GDHA 4U7JA 3TLAA 5EKXA 1UM9B 4AX8A 5CVUA 3VI3B 1VIMA 4R5MA 4WWHA 4MVUA 1YR3A 3E5HA 3RJZA 4OGGA 1AURA 1UKYA 4U00A 5LNK1 3LUFA 1XB2A 4WFGA 1SUBA 1KP3A 1BRTA 2R2GA 2DBRA 2EG9A 1VJRA 4X1KA 3I9MA 3G1WA 1ZW6A 1XE3A 1OWPA 4JI6B 5AICA 3NDJA 5AW5A 4ZVRA 2EKQA 1G5PA 3QE2A 3UJAA 4PCVA 3ZV6A 4DQVA 1N5LA 1JA0A 1TUIA 5IH7A 3FYUC 4UM9B 2PUGA 1DK1A 2P9CA 3NC1C 3OU2A 4HWPA 2IIBA 5E8RA 3B9QA 2PVCA 1EUCA 1PR9A 1R8SA 5GM2A 5CGZA 4YXWG 2OHJA 5DM4A 3K6SA 1T0PA 1EFTA 1AS2A 4Z3OA 2FDCA 4EB0A 2AEMA 4OHWA 2OCIA 3FKQA 1T9GR 5E7IA 4EBBA 2BGKA 2V7GA 4YEDA 5FH9A 4CMAA 3T6KA 4O4IF 2JDIA 4NCIA 4EHHA 2EJCA 3KEOA 4Q1FA 1QGYA 3DF9A 2QVYX 1VP7A 2OG1A 2TRSB 3ETLA 1W36C 3LP6A 5KOJA 3DE6X 3MELA 2Z83A 1D6JA 3E03A 3JYNA 2HY7A 4EGAA 1Z0IA 3QBEA 2FZVA 2J31A 5AM4A 3GRZA 4PPYA 3RCBA 1LZKA 3CW2A 1UFOA 2LCQA 1M54A 2ZTSA 2QZSA 2OFPA 1JSLA 3IEVA 3ICEA 1RLGA 3OAAG 3GX1A 2QN9A 5FADA 4C4TA 5EPOA 3U3MA 4PYJA 3SCZA 4E5PA 4ZRMA 1JG1A 4C7BA 2DQ3A 3ZHCA 1L5SA 4EW1A 2PXAA 4R41A 3VGPA 4L3OA 4Q4HA 1C1DB 1VQ5F 2DPGA 1E1QG 2ZJAA 3DGEC 2JLCA 2WINI 2AC2A 2CXPA 3R44A 5KNDA 2YMPA 3WHIA 1CZNA 3VJMA 1NYLA 2CT8A 2ZE7A 3FNIA 1QHHA 2GZHA 3HB0A 1NN3A 4LCEA 5B1NA 2WTMA 4KYUA 1SHUX 3C0KA 1GYQA 4P0QB 4KYTA 1G8HA 4GR5A 4Y3UA 3TN7A 4ENSA 3NX4A 4BO0A 2XNHA 2OHGA 2IDJA 3WJ7A 2SNIE 4US1R 2VDNB 1WETA 2E0IA 5FTWA 5B55A 1ZD4A 3SGLA 1QHIA 3CPEA 3A6LA 1WHTA 2V8BA 2DFLA 4HQNA 3FOFC 3ZZMA 5TJ9A 3BMQB 4HDSA 3IP1A 3JR3A 2XH8A 5ARDA 3NBFA 1N25A 3KPWA 3BHJA 1NVKA 1YUMA 1LNZA 5A4KA 1YTLA 2BF4A 1Y1TA 3GT0A 4B62A 3A8TA 3U3XA 4M0LA 3I9V1 4GE3A 3KJZA 1AI5A 4HEQA 4PCLA 1HEUA 3TEFA 3UJDA 2BH9A 3WLEA 1R3LC 1YKFA 1KSFX 2HSEA 2JCXA 3P0ZA 2ADFA 1NZJA 3TI7A 4GX2A 3F3SA 2ZTUA 1R6KA 2H8EA 3INRA 1STOA 1R1BA 2NPFA 1ARZA 4Z9XA 2PX4A 3OVMA 2CLSA 3D8BA 3OQHA 2HWKA 2BHTA 5AOCA 4FQ8A 1VL1A 4XSVA 2JS7A 4MVYA 4WKCA 2KB0A 3UK6A 3QVVA 2D3OW 3DTUB 4TQ9A 4TM7A 2CFOA 2YWGA 2QTMA 5JZ9A 1QO0A 1UQTA 1P2TA 3AT1A 3HVUA 2HRBA 3IHWA 5K1PA 3EIXA 3ZRWB 3OSUA 2O3JA 4ZOLB 4WJZA 4OYYA 3IAUA 2DMRA 5B66Z 1XZNA 5L9AA 3CINA 4NSNA 4ARUA 4HGZA 1Y1PA 3MILA 2ZUFA 2QTNA 2I1QA 3NBZC 2QG4A 2EIXA 3LCVB 3ICWA 3AR4A 3UMGA 3HKEA 4UHHA 1R8QA 2FZCA 3K2QA 2DBVO 3UYKA 2JDIG 2ZUUA 2OESA 4M9RA 1KECA 3N53A 4GLXA 4ZVOA 1W94A 5EY5B 1RZVA 2V98A 1U8EA 4R7TA 3UJCA 5FL3A 4CG0A 4M0PA 4YC7A 4MCAA 3RSQA 4G4JA 4QXMA 3FFQA 3F8TA 2G76A 3PPYA 5FJIA 1XLWA 2CK3A 1ZWLA 5T57A 4G0UA 2AMJA 1LB1B 1JMVA 1I10A 4B9AA 2IC5A 4YI5A 2H51A 3B5IA 2K5UA 1YB7A 1D4OA 1J49A 4WA8A 1XTIA 3JYLA 2HDNB 1GNRA 3OPQA 1IBSA 1DB3A 2CAZC 4MCIA 4ZC8A 3VO8A 3UHAA 1R6TA 4G86A 1UKCA 2FQXA 4FWIB 1DXHA 3GJ3A 3QBDA 5KYYB 2ZRCA 2WWYA 2YW2A 1OX5A 1TCCA 1Q5PA 4QG3A 1RJGA 1TUGA 3B6EA 1DKRA 1HO3A 1L7VC 4QRDA 2DWUA 2MR5A 3A70A 1FSPA 1FTQA 1XRQA 3TRJA 2VWKA 1BFKA 2Q9BA 1FQOA 4HAZA 3UOWA 3TXYA 2IYTA 4RMIA 3NHUA 1NW9B 1XCGB 3G13A 4XEUA 4UJ3A 5EXPA 4FZRA 1N8TA 3K73O 3ZBPA 3JPWA 3JATA 5KVAA 3BRWA 2J6CA 4HYYA 1PZXA 4HQKA 4UFOA 1BC5A 5DHPA 1D2CA 4OFZA 1YD7A 3CG0A 6ABPA 3DBIA 2WI8A 4NBKA 1I6KA 3UV6A 4H16A 3ZCVA 2KTUA 1JOYA 5GJBA 3E6AA 3I62A 2A59A 4U9UA 1MXHA 2YXYA 4YASA 1KTVA 2ZREA 1YQDA 3ORSA 1Y9EA 2HEGA 3A6GA 4ZEWA 2QJ1A 4CUJA 3BE4A 3CKLA 3IEXA 1XCOA 3PLAC 3NU1A 2ZRAA 2GN1A 1E3WA 4MR9A 3EJ6A 4TLCA 1U31A 2JGNA 3EASA 1WU7A 2O06A 3K12A 2IPOA 4QYMA 1W48A 3F7OA 2QEQA 5IFLA 4RAIA 1WV1A 4YUYA 3D9QX 3PHIA 4CIWA 4KHPB 2QTGA 4JK3A 4XLZA 3HL4A 2ORED 3K8YA 1YJ9F 3A28A 3T5TA 4IXDA 2W48A 3QU2A 1XDBA 3WWZA 4IM7A 4HYQA 2G63A 5GONB 1U6IA 2FF5A 2LGJA 3MJCA 2DPHA 5CVVA 5I7EA 3MOIA 4Z6KA 4ESVA 1EDEA 1YHYA 4FFRA 3OQIA 3OCZA 1V3QE 3GZ4A 1YZ3A 1XHLA 5DWDA 5GOZA 4Z0HO 2WLIA 2RHTA 4YQEA 4P9OA 1E9AA 2ZODA 1T5BA 1L5FA 2QTLA 5KSYA 4FW8A 2V65A 3UOAB 2C58A 3LNTA 4BXOA 2W4IA 2WPNA 5CFPA 3V1TC 4AY6A 5EMKA 3DCJA 1TMKA 2Q0HA 5EK0A 2IU6A 1AHIA 3QNEA 2C9ZA 4YX9A 2Y0CA 4E21A 3L1VA 3I28A 4X71A 3L7YA 3V97A 3QVJA 1M2FA 1N34O 1TJ4A 2JFWA 4Y2JA 2FP4B 1KIFA 2GNPA 4K6HA 3RREA 1XMXA 2XITA 3NYRA 4BMCA 2G25A 4LOIA 5TS3A 3GV0A 5CNJA 3UAZA 2VDWA 2O8EA 3DLHA 2JI7A 5LGUA 4QUAA 2WTXA 3MCUA 1G5FA 4JASB 1QVVA 1QFZA 3FRHA 3ISVA 1LLQA 1PHPA 2F2TA 1AF4A 1ZZEA 4WX2B 4O4HA 1DVRA 2BF7A 5FNZA 2KB1A 4FKMA 3NZEA 4KFTA 3QUCA 4OFWA 4MS1B 4F5DA 4XD2A 5CVTA 5EIAA 3V1NA 3O95A 4C0BA 2PGOA 3RNOA 4DCTA 3ZHYA 2LVBA 3VC2A 2JBAA 3P2IA 1XV2A 1AGXA 4HNHA 2OG2A 4WFIA 1UH5A 4LIPD 2Z8YM 1J70A 1K3EA 2WWTA 3ILXA 3I04A 4FDMA 4L27A 3QLVA 3GFSA 4F6CA 1AKVA 2FZLA 2OV2A 4RETA 2K7FA 2HX0A 4AQ7A 5LP6A 2PA3A 3W8NA 3BX1A 1XDGA 1KJ9A 1QOZA 5DHFA 3Q3CA 2V58A 1IK6A 2UXCO 3OM3B 5T6BA 1RWBA 1JJAA 1KSHA 4EA8A 2X0FA 1W9HA 3RYHA 4AURA 2P9ZA 4AJKA 4BP3A 1DJOA 1TA0A 1KSGA 4XRRA 4NKRA 1OLXA 2A5YB 3KV3O 3AI7A 3H65A 1ZM9A 3T95A 4ZZ2A 3UJ3X 3DCNA 2PUBA 3E9YA 4CIBA 3C39A 3KQNA 2PZAA 4W5HA 4K9MA 3EXEA 4DRZA 1RCFA 4Q00A 3WZLA 1JU3A 1RI2A 3SM3A 1ODLA 3X1JA 2OP0A 4ZVSA 4IR7A 5C32A 4LGVA 5FPTA 4MGZR 3DULA 4MGHA 4E5VA 1X25A 4GQIA 1JDTA 4G09A 3LUDA 3MBIA 4AQYB 5B6JA 1DBWA 2ZETA 4OB8A 5EESA 2ZYSA 4PHZA 1TAHA 3GEGA 5DTRA 5AK6A 1V9PA 2LTAA 4I1RA 3KHTA 3LWRC 3BL8A 4CM8A 3DFKA 1U2GC 1MB0A 4PO8A 2DUUA 4K87A 3ICXA 4YLGA 1YTUA 4BNKA 4J29A 3NATA 2WW8A 4JIGA 3S8EA 2Q8NA 4X1OA 2H1VA 3EDQA 1WUJS 1FXSA 2OZVA 1OZFA 2XNDG 1CDEA 4G2NA 4G8CA 2QUIA 1QVFF 3MGGA 4J7JA 4G0XA 3WGVA 4J9YB 2AC7A 2VDOB 2LBTA 4F4IA 4EKDA 4JEIA 4EG4A 2YIAA 4DR2B 1P7YA 3LNCA 1XYGA 1NNI1 2R79A 5FRDA 4R2JA 2IT1A 2PBFA 3I4FA 4LBZA 4HC4A 4HTAA 4FGJA 4PI0A 1IPAA 4GUNA 5C7OO 5AW2A 3JAMM 4C4ZA 4KQKA 2H9IA 2PK3A 1I1QB 4JY7A 4P0TA 4FJCC 3E9DA 3OZTA 1E2LA 5HG0A 5CXSA 1DF5A 3LRTA 3TIVA 2LIVA 3RSCA 1KJNA 2J9FA 3HA3A 4KJZA 3FPEA 1M66A 1NE2A 4Q3DA 3VV2A 2CFIA 3EVNA 2FG7C 3SYCA 4GICA 4UCFA 1TVMA 1XBIA 4GMDA 1IWBB 3ZCCA 1ULBA 2ZB3A 3EXIB 3ZN0A 1NV9A 3SPXA 2BTUA 3BN3A 1HT2E 1XPJA 4UV9A 4ZDKA 4I9HA 2AF3C 3M9XA 2ATXA 1LPPA 2XUQA 5PGMA 1CQPA 5DASA 1I33A 4HFNA 3EWSA 2FG5A 2HG5C 4IT5A 1U8AA 5CLQA 3IDAA 1GGNA 3X3HA 4UM9D 2IY8A 2WYVA 2GK3A 3PJGA 1NUUA 4Q1DA 4L8LA 1B8NA 1YB4A 4BNZA 4FLZA 3EY9A 3K08A 2VOJA 1KI4A 4PM4A 5JJBA 2PX5A 4C03A 1QR9A 4MQEB 4E30A 1CE8A 1AP6A 3K72B 1MAHA 1WX1A 1JQKA 1GX1A 2DHCA 1U28A 5NULA 4GOXA 4OYLA 2QN1A 3P0RA 1DL5A 4O1MA 4B6EA 2HIMA 3PYXA 3CU5A 1D1PA 2CD7A 2CNLA 2H08A 4JJ4A 3PGXA 1VQPV 3WJAA 5L3FA 4LJSA 1RRGA 3ZWKA 1MDBA 3DOCA 3EFOB 1RZUA 1AHNA 2AIFA 4QLOA 2Q6OA 4W8GA 4LFCB 2CYCA 4YJ3A 1GCUA 4JT9A 1J1UA 2IWHA 2OHFA 5EMHA 1U6JA 2RC5A 4HGQA 3EGVA 1X42A 1HG1A 3G2NA 3UB4A 2YHUA 1PJQA 1U9JA 4MWSA 4YP0A 1JD1A 1L5LA 1QNMA 1ZD8A 2ZGVA 4MRPA 3L8FA 2YS8A 2FC3A 3K06A 1KP2A 3PRKE 2RH8A 2HO5A 2AZ2A 5JYDA 4JAVA 3W5HA 2V45A 4MI9A 2DYRB 1NXVA 3MPOA 4OB6A 2Q5CA 1RA4A 2K87A 3SS9X 4QO8A 3FGZA 4E7PA 2GETA 1TYDE 1HL3A 2ZRNA 5EA2A 3H3FA 4C2UA 1YZVA 1MABG 3OZ7A 1IHOA 1EXMA 4CR6A 3LUGA 1PK8A 5ENDA 4WDQA 3P97A 4TVKA 4MUEA 4W7SA 3ZMUA 5T8KA 2YJ5A 4JOQA 3KKMA 4JX9A 1L8XA 1T2VA 2QYOA 5DIFA 4NWOB 2E89A 3HN2A 3BMNA 1U8ZA 2G9IA 1L1RA 1GTSA 2BRUA 2HBQA 3LJKA 4DLNA 4Q6BA 2FR8C 2MSKA 3D6MA 1N3BA 1Q50A 3K6SB 2FWNA 4GPZA 3ANSA 4NZNA 3TLZA 1NVGA 2ECQA 3B36A 2X9VA 3T3EA 1FU8A 1LJLA 4WKOA 1OBHA 2WLJA 3CFYA 3VR5H 1VRWA 2FFAA 3BJRA 3AIIA 5A2QA 1UT6A 2N47A 3HPLC 3FUVA 5A3QA 1KJQA 1I2MA 4BOYA 2EQ5A 1EE2A 3L6UA 3IIMA 4ZQFA 1GUAA 4YMUA 3E2PA 4G1VA 3ONDA 2FCAA 3HO1A 4ZANA 2VPIA 1YDXA 1THZA 1YXBA 2R6GA 5E9JA 5SV2A 3ZLVA 2H3OA 3P8ZA 1H5NA 4QFBA 3IAM6 1T9CA 3CRZA 1Z28A 4UHBA 1YDWA 1DKMA 3V7NA 1NLFA 2C2WA 3ZHZA 4PAGA 4KDEA 1SC4A 1PFVA 1FFCA 3RFRA 2JI9A 1O0BA 3KT0A 1SVMA 4QIHA 1WCIB 3RA5A 3I9OA 4UQLA 3D3QA 1US6A 5DTQA 1P6QA 1NZ6A 3CLSD 3TOXA 2X8WA 3QX7A 4ER6A 1QHHB 5IJ9B 1ZUIA 2ZKOA 1SH7A 3OO0A 4YCSA 4G1UC 1HBJA 4O2LA 3PYMA 5C5DA 3QVOA 4UVHA 1J5PA 4RGVA 3AZQA 3MRSA 4NWIA 4BGDA 3OU6A 2UYQA 1FP2A 3OM0A 1W5EA 4KK3A 3PNKA 2HV9A 1Y8RA 3B6NA 4KQ6A 3A27A 1H0KA 1SZJG 4UVDA 3R4CA 1M1KH 1CJKC 2WTUA 2XHEA 2YHAA 1EU1A 1BE3H 3ZDFA 3CUUA 1HNWB 4CI0B 2IUEA 4V0QA 1UXJA 2H2HA 5JZSA 4GNRA 1XRNA 2ZATA 3KTAB 3KUXA 4HDSB 4C08A 4ZCMA 5I9NA 2QYHA 1AMOA 4QXOA 3PHBE 2HHAA 5TNXA 3E61A 3K5HA 3VZDA 4X88A 3KEGA 8MHTA 4JJKA 1NJ8A 1II9A 1GNLA 1MAWA 1RZRA 2H1WA 2N46A 2CZWA 4LSWA 4EB6A 4EKGA 5K0LA 2ZT7A 1LV8A 4HOYA 4Y9RA 5FBLB 5FV4A 1OCOC 5H70A 3EXHC 1KQPA 3FVVA 1GCIA 3TOSA 3KBOA 4G36A 1Q2UA 2WIFA 2I54A 4MRSA 1ZC4A 4Y1EA 3HGTA 3Q9SA 4KP7A 1CR2A 4G37A 2K4MA 3OJLA 1QYRA 5EUMA 1PJZA 4WNAA 1Q22A 4GWKA 1A8PA 2A7QA 4GPBA 4XOUA 4F3RA 2FVXA 3GJRA 3AG3C 4B6OA 2G6TA 2KWIA 3N39C 4EI2A 4JP3A 4WCVA 1HDJA 3NEPX 4RV4A 3SPIA 3IUMA 2GF2A 1X13A 2I62A 3LIIA 4B8YA 4X66B 4URXR 3QHAA 5H5JA 3EVFA 3DHEA 1PM9A 2FZ4A 4X64O 4RDHA 4X5OA 2HRUA 1A04A 4H17A 4NCNA 4UE6A 1BQ3A 1KYYA 3KXPA 2WIAA 1DO2A 2B3DA 3SPGA 5HY0A 3IB3A 3QVWA 2XGSA 3JWIA 2C57A 3KZXA 3WBBA 1KO8A 2D7JA 1R6NA 3TH5A 1GRRA 1TO6A 3IESA 3NGXA 3HKEB 1K27A 2W6QA 3MN1A 3CYQA 5K2OA 2OCGA 2DLCX 3RFUA 1VPDA 4LHZA 5C8YF 3AEKA 3BMCB 2A5LA 1Z6TA 3DHVA 2IV2X 2ZOSA 1J8VA 2Z1DA 4MH0R 2O1EA 3U61B 5L3CA 3QNWA 2EINB 3L7CA 3AEUA 1NC3A 4HWGA 4LMBA 2ZIMA 3NH9A 2JA2A 3KKLA 3I9LA 4PX9A 1DLBA 3O47A 1NC1A 2VT6A 1H9CA 1X19A 1W0JA 1FXKA 2F1HA 1Z8HA 4U2GA 1J21A 3IHLA 1UCFA 1C4WA 4QQRA 1ZL0A 3SBOA 4AL4A 4PSKA 4DV3O 1DKNA 3FPHA 2QD2A 2FFBA 2IYYA 3I6YA 4DGSA 1V43A 2ZU0C 4BC0A 1ZP6A 2H6EA 4CT4B 3LC7O 4RQBA 4C4AA 4MPTA 1BHO1 1RHQA 1EK1A 4QUHA 721PA 1ESDA 5HDQA 3L4BC 1LI4A 2R8XA 2C4NA 1QWOA 2Q46A 4S1WA 3Q15C 3LK6A 2HADA 4OHZA 2EWCA 5AW7A 4QJFB 5LBIA 4PWYA 3BDIA 1KDZA 5BNFA 2OKGA 2H4JA 4KWIA 5ITVA 1SKYE 1EWVA 3MS7A 3HB7A 4TZKA 5E4YA 4NNPA 4A9AA 1ZK3A 2YOFA 4UU8A 2C2GA 3KB1A 1TYCA 3IOMA 5D84A 3DFZA 3LT2A 4M9XA 1KAGA 4RPKA 3PGVA 2QMUA 1JX6A 3W0LB 3M3DA 5E8JA 3HU2A 4H6WA 1R3DA 3I55V 1E3WB 3HI6A 4MR9B 1EA7A 3QQPA 3IUSA 6CHYA 1G3RA 4KW7A 4I9NA 5K8LA 3MG9A 1VKHA 1GP2A 1RZ3A 4ZTZB 1FS6A 1H8ED 2NO0A 1XHEA 3A4VA 3MIIA 3CPQA 2DTDA 4DWJA 5CFMA 1GY8A 3HU1A 2YUTA 1W35A 1Z5OA 4B45A 1CZOA 1W5TA 3ZE9A 4WOBA 1E64A 5G0UA 2YICA 3IPLA 3NTVA 5CM8B 4XWWA 4MVJM 4LN1A 3PFNA 3DMFA 3SHFA 3EHEA 2C5HA 3M82A 1BKDR 3PTZA 2OBMA 3TE6A 3TQCA 1LLUA 4II7A 4AS1A 1YR1A 3T9AA 1L5WA 3OQIB 1SKQA 1L4LA 4KOAA 3HM2A 1SBYA 4N7MA 2WLIB 1CY2A 3H2IA 3WS7A 8GPBA 4X7MA 1TCVA 3VAYA 2AOXA 3P45A 4JWTA 1BA2A 1A9PA 4BXOB 4U4AA 2QW8A 3CNEA 4Q93A 1PDOA 2EZUA 4C78A 2P2DA 3GJ8A 5AHKA 3FCAA 3M4NA 2HLPA 2PZMA 5A9SA 2WQZA 4RCZA 1H1LA 2L2QA 4Q19A 4ZZIA 2BUAA 4P32A 4UCXA 3LQYA 1T15A 2ZNIA 1S01A 2IYXA 1YJ8A 5KCMA 1V55C 4YFYA 5C8VA 3CY6A 4G1BA 2XZLA 3EUWA 4UFZA 3GJSA 4ARSA 1MDFA 3T06B 2G04A 4AVYA 1G1XB 1XKXA 2XKBA 5G40A 2YXZA 3IXLA 1GAQA 1H9AA 2VDWB 4GKKB 1ZMBA 3G5MA 4OFBA 2ZTHA 2BGWA 3VH2A 1UC9A 3F0DA 3ADBA 1M1ZA 4JF3A 2J5BA 3KQTA 3A1TA 2GZSA 3JTEA 2IBTA 1X8KA 1EVIA 1PG2A 4O4HB 2BFPA 5L4SA 1GZDA 1HG0A 1GQQA 2VQ6A 1QJCA 4FYXA 1NI4A 1PJSA 2JCBA 3PJFA 1Y3BE 4HAXA 4Q4JB 3V4RA 3ZMZA 4P36A 1OLUA 3BA8A 1MPTA 1DJMA 1N75A 2JBAB 3U9TA 2O8NA 3HBAA 4RVGA 5CA1B 5JNRA 2HJ9A 1CULC 3IIKA 1RLIA 2COEA 4ENUA 2D5CA 4XFKA 2HSGA 3SKYA 2JAUA 3W4JA 1R4ZA 1LUWA 4ARVA 4QWWA 3WLAA 1L5RA 1YBMA 4D9BA 1JFFA 3WSWA 5AI5A 4HNUA 3C3DA 3K59A 2VHVA 2R6AA 4MW8A 1DWPA 4PSUA 2P3LA 2JIPA 4RYDA 4ASUD 4KFCA 3FTNA 3ZCQA 5TEVA 2J9RA 4KYIB 2AZTA 5LR6A 3DXFA 3U60B 1GM9A 1Y1KE 3I05A 3I2JA 3TW4A 3M6LA 4DT1B 1TLTA 1U0RA 1LPMA 2BKEA 4FLVA 4MKHA 4MEAA 2JIDA 3L4EA 1XP5A 2M2IA 4AJ1A 1QHFA 4JVMA 4AQDA 1E2IA 3MVEA 3Q2OA 2Z30A 2SECE 5FIUA 3ET4A 1SOMA 3VHQA 4E3WA 4M83A 2YXDA 3UJ9A 4C81A 3GLHA 1SMKA 1KMIY 4MX8A 2OCHA 2VP6A 2H5EA 2YJ3A 5DVZA 4CCAA 1GPJA 3I32A 4BV8A 2PT6A 4DWOA 3TUJC 3GZNA 3OWHA 1MAVA 5ELMA 2BFBA 1FYJA 1A71A 2I4IA 1MEJA 5B5EZ 2C7OA 2RARA 1OXBB 2AMTA 4ZOLF 3ZWAA 4OUDB 4EYKA 1X1DA 5EP3A 5DK6A 3OUUA 1DTWB 4IIDA 1RE1A 3VAAA 3OM1A 4D9HA 2LKCA 3P10A 2WNSA 4DUYO 4CM8B 2AFHA 1XGKA 2WD8A 3JQDA 4Q4CA 4TSFG 3OBIA 1VQ4V 2ATKC 3OMAB 4ROTA 1QHGA 1A1SA 2FN8A 3B6KA 2GCEA 2PLRA 2G5CA 1T5HX 1WB8A 4H1VA 2VRCD 2QWRB 4CM3A 1CD5A 3SK0A 4P8RA 4DE5A 4TLBA 3EISA 4Q1BA 1TVKA 2QMHA 3HZRA 3ZH2A 2R0QC 4WINA 4PDLA 1I5OA 1QMGA 1QIKA 3GELA 3V8EA 2PZKA 3ON1A 1LDBA 3ZZ0A 1U0SY 5D3KA 3GGJA 1DCKA 1KH3A 2IYNA 5EUBA 4OQEA 4R1LA 2XMPA 1N8NA 4MGYR 2ZRFA 4QJ5A 2HGSA 2EBWA 1Z17A 4QYWA 2FW9A 4K03A 3R3YA 4R84A 1U3LA 1I36A 2YY5A 4QAJA 4BP1A 4Y2UA 3V00A 4OHKA 2P6PA 3HB4X 2IAFA 1HUQA 2J9FB 2FW0A 3ZTYA 4LP8A 5KAIZ 2HA7A 1JKJA 1T5OA 1XX6A 4IXNA 2CVLA 1N0JA 4QULA 2LRHA 1A8IA 5I5GA 4WXHA 1USIA 2GN6A 3ETCA 5C9ZA 4PF1A 2DFNA 2OBYA 4NU5A 1GK9A 3NRBA 3FSGD 3TGWA 1NVTA 4ZARA 2RONA 4JOCA 3J81k 4RMHA 2BZ1A 4TWKA 5BR1A 1UWKA 3ICCA 3X44A 3VO9A 1W75A 4IGGA 3FVQA 3RTCA 3QRWA 1F1JA 3B82A 1H3EA 2AEEA 4MUBA 4NV1A 3C8DA 1YBFA 3B85A 5E1MA 3HCRA 4B4OA 1SJ9A 1T2EA 3AP2A 3B3JA 4LWOA 1C7ZA 4MTFA 3RBZA 1N2CE 2YINC 3QXHA 2JGKA 3R75A 3JQPA 4G3XA 4DLXA 4W6QA 5EN4A 2HCFA 4DZZA 2YXEA 4OLBA 4CC6A 2AVDA 2RQ6A 5FWDA 1HRDA 5TQ2B 3IYLW 3SF8A 2WHXA 1CE8B 2AG1A 4FGWA 2QD1A 1YHQV 1NW5A 4TMXA 3A36A 4AP9A 5JE8A 4PHCA 4PZLA 4H7IA 3OAAA 2P1DA 5AW9A 4Z7JA 3ZVLA 3UBTA 2OZLB 5C80A 3CNOA 1RAHA 2YWCA 4CLRB 4I1YA 5KC9A 1UK8A 3P52A 1A98A 3L7OA 2UXDO 4YJ3B 4PG4A 1H9BA 4IJVA 5AK4A 4EG8A 1CXZA 3G5UA 2Q67A 1SXJD 2EFYA 5KYTA 1H6DA 5GONF 2F4VO 1KD1W 2VJQA 4WADA 5BYBA 4PLGA 4FBLA 1P7GA 4NEGA 1XU9A 3UV7A 3GO4A 3T0GA 3NVKE 3EQ8A 2PH1A 3GCXA 4EGCB 1ZM7A 3L9WA 4RFLA 1NFFA 4NXNO 5HQJA 2DP4E 3CX4A 2G17A 2JI8A 3IAYA 2XA1A 3DV2A 2ZFUA 2QQGA 2Q3MA 1ULAA 1KZ6A 4CMEC 3T1TA 3M9WA 3CX7A 3DYVA 4D0LB 5KHIA 3RRBA 1D6NA 3ROPA 3VNQA 4Z53A 3T4PA 3L05A 1W0KA 3M49A 2UZHA 1FMFA 4DA6A 3EUEA 1ZD2P 3A1DA 3EWNA 4GZRB 5BWOA 2V5AA 3NHLA 5AVWA 3BMNB 4BIZA 2GWHA 1SIWA 4AF6A 3JQFC 3SR2C 3BVPA 3WBFA 4P22A 4X6XA 3H6HA 5LMUB 2BGLA 2CTWA 3USZA 1PWEA 4MRAA 3MB5A 1G2PA 2ATEA 4XR9A 2VF4X 2Q6VA 2V7UA 3OHSX 4WI1A 1O95D 2QROA 4DCCA 1OTYA 4OXXA 3RTBA 3HCOA 5AKEA 1VMDA 4U2BA 3C3AA 1A4XA 1N1GA 2WSSD 2ZJ1A 1D2RA 4PAMA 1Z2NX 4XDYA 1SKYB 2CLLB 3IT1A 5GJVC 4ZVMA 1MX1A 1NVPB 4J7ZA 5DLPA 2R9RB 4F1JA 1U5AA 4P98A 2RHWA 4UAJA 2YJNA 1G8FA 1QF6A 1IBMB 2GSDA 3HFGA 2IBZH 2AFHE 2OCCB 1K8AW 4D56A 3G2IA 3C9UA 1WIWA 4TL8A 4PHFA 5IT9M 2O5CA 2AOTB 3I34X 3OF3A 4GPD1 1VSUA 3KP1A 2Y4UA 2JEYA 3W5BA 4BS9A 3W78A 3GVIA 1HL7A 4FMCF 4AWAA 5CURA 3Q7IA 3WJRA 4GUDA 4NY1A 2X7HA 1ZI9A 5JAOA 2HJHA 3IP6A 2Y1OA 3AMVA 3STZC 1C0IA 4H08A 3NC4A 3PSAA 4IPTA 4OK5A 5C53B 2H4FA 1I30A 1FXVA 4L0MA 2IW5A 5E6RB 2REBA 2RK6A 2R3SA 2B5VA 2QAJA 2RHGB 4UVGA 3F7YC 1SCQA 4AN1A 6YASA 3ZU3A 5FUVA 4DV1B 3ZZUA 4HDNB 2HEIA 1AU9A 2X5XA 2E1RA 4DCGA 4I1OA 1JDBC 5GZ3A 3AESB 4JI7O 2HU7A 1OXSC 4UEOA 3L07A 1B6RA 3I45A 4NB5A 5KTTA 1T3TA 3I2KA 3HCCA 3CC8A 4TXLA 2ITCC 1S9HA 4HXGA 1YE3A 1NJIH 4EF4A 2PX2A 2CMKA 4IJWA 3FFAA 3D8HA 3NK7A 4KNWA 4BKQA 5E4FA 3AVOA 2XVMA 1TQ8A 3W06A 1FZTA 1NR7A 4NK5A 1NX9A 4QPKA 4IICA 3H1FA 1M33A 4YRSA 3V1LA 3FI9A 2EBUA 4EB6B 3OEHA 2QY6A 5DNWA 4UCUA 3SX2A 3E8BA 3GZTB 5K1ZA 1ZM4A 4DV5B 4EHNA 5TV2A 4G1MB 5CM9C 1QP0A 3CR3C 2I2WA 3O65A 1GD1O 3RIEA 2Z2IA 3NHKA 2IHJA 3ZRXA 4EATA 4IOMA 1M0EA 1BDHA 2C95A 4BMXA 2D74A 4HNGA 4WNAB 4KX3A 3ZMSA 4F60A 3CX6A 3GCGA 2BUCA 4CIDA 5EC2C 1LR1A 5HZMA 3NH6A 2XCSB 3AM1A 4LYEA 4QFCA 4ARAA 1H93A 1P91A 4ZQGA 1W0KG 1SXIA 2F1RA 5DH9A 3KKKA 4BTLA 1N6OA 1VDMA 4DV6B 4L76A 2H7CA 5KNBA 1OFTA 5IT0A 3CCSF 1UQUA 3U39A 4IP0A 4PTLA 4KFUA 4R40B 1N9GA 3IAXA 3WLMA 5KNDH 1DNPA 4ZU3A 3HNRA 4KBGA 4KQMA 1P2BA 1M1NA 5JXIA 1AKWA 2AHZA 2Q0QA 4EI9A 3IR6A 5AI8A 2HRCA 2F8TA 2C42A 1KKUA 1KU0A 1ISHA 1AUXA 4IIUA 2QRKA 2PAAA 1VJ5A 1FNSA 3D01A 3VTKA 4NX2A 4KXNA 1VQ6F 5ICSA 1S2OA 3ZGVA 1J0AA 2F55A 1V8DA 1DRWA 2QR3A 1ZHFA 5KTYA 3WYDA 2QJFA 4TYYA 3AEKB 2BEKA 1JHOA 1PXWA 1JEAA 4Q3OA 3HYNA 2OBXA 2PYLA 1EG2A 1T2AA 5GZ6A 2OWEA 1J33A 5CHEA 4P82A 2NN3C 2ZI7A 4DUZB 4KSCA 3VQXA 3ZCTA 4YCLA 4TGLA 3CCJF 1N0VC 4IZHA 3TSWA 5CA0A 3C5HA 2BVNA 5IM4A 1I6WA 3L75H 4F3NA 1CJVC 5CT9A 1N8KA 2I4LA 4HNRA 3USES 3KXLA 5BW4A 3P9XA 1UPUA 5K99A 4TQDA 4HH1A 3MQ2A 4MA0A 5KNBH 4ESOA 1G41A 4RESA 5ER9A 1SU6A 4G8DA 4IY1A 4C5BA 3GLGA 2G1PA 1HWYA 2F1MA 5AOBA 1JECA 1CEZA 4MB0A 1RYNA 4XUDA 1I7FA 1JLSA 2C98A 2C7GA 3NXKA 2C4MA 1R0CA 2H16A 5TX7A 4UEWA 4ACAA 4HUJA 4O4LF 3LFHA 2ZIFA 5BXYA 1BWRA 1KZ1A 3M4JA 4N0EA 3FKJA 2F95B 3SX4A 1KAMA 3BORA 1YV9A 1KTIA 2BPOA 3FB8C 2P65A 4DXDA 4IFBA 1HYQA 3AP1A 2JNWA 2HLHA 3KYJB 1FK8A 4NG5A 4J9VA 2KLHA 4CIVA 1U04A 4DF3A 2XUJA 5KKCA 3F49S 3I6MA 1Q3EA 2AXNA 1XO1A 4BFYA 3P27A 4DZTA 3KBBA 3J80N 4NYJR 3LLSA 5CK5A 2X4IA 2VAXA 1R0XA 1YEWA 2I80A 2V9CA 1XNQO 1XOIA 3LO8A 4JI1O 2NVUA 5AVKA 3B9PA 2BOVA 2O2IA 4BEJA 1SF9A 1ORRA 1YRBA 2E82A 2HFEC 3C6QA 2JFPA 1U5BA 3AERA 4NYIR 1PKEA 3DE7X 3QUBA 2E5LO 2WVAA 1BAPA 1EK5A 1JBKA 4L8FA 3U5ZB 3TIGA 3OEHG 2WMNB 4I7EA 1EZVH 1XF1A 3ICOA 3PVCA 3LVFO 1XQVA 4OYRA 3KPJA 3U10A 2CJPA 1XQWA 4J9UE 4DBLC 1VCNA 1ORVA 1K86A 2GOYA 4CF3A 1WSAA 1XQ6A 3JWPA 5G1PA 3CW9A 2XYQA 3W2GA 4DV4O 2VP5A 3W7XA 3K05A 2NLOA 5FA8A 2OCPA 3CXCU 1ODCA 4KCGA 4KLCA 3VZCA 1HYHA 3ZE2B 1OCZB 4ZHQA 1NOKA 2PL1A 2EERA 2CLKB 3D6JA 3RGBA 4HNQA 2RIRA 5E1BA 1GTMA 3ZWYA 1QTRA 4UATA 1UADA 4PI2A 1IULA 4EF6A 4NYMQ 1L5VA 4XVHA 1GPBA 4QYTA 3KOYA 1I7SB 2J32A 4D41A 4EJ2A 1N2CB 2HBYA 5C1DA 3A7DA 1RC1A 3EPRA 1B0UA 3KXDA 5A9SB 2QP4A 2ZYHA 2JFBA 5TISZ 1KL7A 5WRFA 5BR8B 2YEVB 2ZITA 4H1HA 3OIVA 2YVQA 3LVQE 5TT0A 1UEIA 5KQPA 1FFBA 3RTAA 4B40A 3ILVA 4DJJA 1A9XA 4HLUC 4BVTA 3KOMA 3OC6A 1SVIA 5A4DA 3KR9A 3KZ1E 3SOZA 4F4LA 5B3AA 5JRJA 2ZZMA 3CCQV 1IN1A 4DR4B 2JAHA 3K0CA 2VAPA 4ZAXA 1IK4A 2XNDA 3RJTA 3PHLA 1N33O 4X7PA 1T1RA 2PGJA 3PV0A 5IUJC 1TYAE 3K9NA 3TJMA 3AVTA 4XB1A 3H18A 2OFWA 4RH0A 2QEXF 3H17A 1T3LA 3AONB 3V1KA 4DLTA 3WGQA 5HSGA 2OV1A 3KDPA 1GNSA 2C00A 1OLUB 4IIXA 5ALVA 1IJBA 1OFUA 2OPBA 5E9AA 3O94A 3MJHA 5ECGC 2DFDA 3DZCA 4P2ZA 3O1JC 1AKYA 3H19A 3ZHOA 3SICE 3WSVA 3FPLA 2Z8XA 3NS7A 4FDUA 1UI9A 3DNFA 1FDSA 1FDTA 1JFFB 2C2BA 3MCTA 5J5CA 1X8XA 3NRCA 1AKUA 4DSOA 2KHZA 1TGOA 2RG7A 3CJHB 1O94C 2E4AA 1UMKA 1O96A 1ZUQA 4KRYA 1VIDA 4Z1VA 2I78A 3KZOA 3LT1A 3AZPA 3A2MA 2DYSB 4B46A 2PY5A 1XVTA 2DECA 1YQNA 3FUTA 2F3PA 1XFDA 3LL7A 4GOOD 1PQPA 1W49A 1D1QA 4RC9A 1TK3A 2YDXA 2XMZA 1N77A 2WZDA 3CRAA 2A86A 2V5UA 3TD9A 2MTBA 5ESDA 4Z0NA 4FCTA 1VTKA 4TXNA 1FX0B 3P19A 1DO8A 1L5KA 5FOSA 4H7PA 4AWBA 4LJ7A 2PS1A 2XYGA 3GJ5A 4ENTA 3GLGE 1XMQO 1JZSA 4EOGA 2R84A 2OV3A 2X1VA 1LTHR 2E18A 5IDJA 2PLNA 1NGSA 4CZ2A 4D92A 1VHWA 4GI5A 1Z9BA 4MVXA 2H94A 3RIXA 2I34A 3R7FA 1NL3A 1COZA 4ZCTA 3IBGA 2ID8A 2AFHB 3M84A 3G8BA 2ZJ6A 4UCRA 3P26A 5ALPA 3ND7A 4A5SA 3H1HH 4ILKA 1EDOA 2W4MA 3VYRB 1TA8A 5BN1A 2TMGA 5KI6A 4YCJA 3BK2A 3O0DA 1WXHA 4HJXA 3OJEA 3H97A 3SBDA 3NW9A 821PA 1TM4E 2N48A 4L8VA 4WKPA 4ZPXA 4NOKA 4TYPA 1RDFA 1S2DA 3LYUA 2F8SA 2A3NA 5EBMC 2IBMA 1AMUA 2FRDC 2GHQA 1J20A 4I1UA 4PSDA 1ZN7A 3VZSA 2JI4A 3K70B 3EVGA 3LZ6A 3QFHA 2ZQYA 5EHIA 3I1FA 4PAQA 3F7TA 1U9ZA 1E6LA 2WM8A 2QORA 3DE3X 3MTDA 3P9RA 4K05A 4CG1A 3JQ9C 3O7WA 3CF2A 1YFLA 3VTAA 2R1UA 4CH3A 2VNKA 1RHUA 1LU9A 2OGWA 3AR2A 3RLFA 4B3CA 4XDKA 4E5NA 3QOXA 4D3XA 4J41A 3BA6A 1KKCA 1MABA 3PTLA 5J1SB 3OC0A 5E3HA 1JKJB 2BMWA 3RM3A 3DMNA 1TXGA 2NWQA 4H60A 3CNQS 3GJ7A 2ZBRA 4EHDA 4LOJA 3NVIB 2KG7A 3VR5D 3A3YA 5E4TA 1B15A 2CXSA 3OCUA 5DTMA 3H2JA 1JB1A 1SR8A 3VC3A 3F2IA 2Q6KA 2V7VA 3DFIA 1Z6QA 4YUWA 3W6ZA 4IDCA 1HK7A 4M6WA 3IBSA 4F1WA 4BE4A 4BIUA 1A8UA 1YO6A 3H9GA 2Q6AA 1XRMA 3U19A 3TOVA 4JOSA 4UMFA 4NK4A 3NR7A 4CZZA 5DFAA 1EP1B 1PJAA 5D3QA 3B3GA 4OQDA 5ERYA 2GPWA 1J0EA 5CMUA 2Z98A 1B76A 3T3IA 4D9GA 3WAGA 4RF3A 1TC2A 2PTHA 4KQGA 1CR6A 4LMRA 4F86A 4H33A 3IDZA 3KB6A 1M34A 4ND7A 5PNTA 4AKSA 5JJLA 1W85B 4RW0A 4UM7A 5KREA 3E81A 4YRFA 1KI6B 1ZJZA 4WESA 1W41A 1H7MA 2JD0A 4PNPA 5B1SA 1KHHA 1G9TA 2NV2B 3UAWA 1M6NA 2JGFA 3SF8B 4IDEA 4OJTA 2NUAA 4BIOA 1YQXA 4D9FA 4MARA 4N5MA 3TQHA 1HSOA 3NHYA 4B4VA 2PGNA 5KVSA 4PHTA 3UHPA 2VQFB 4HBGA 4GBGA 2OV4A 4AMYA 3ZI0A 1NVPD 2EJRA 3NP9A 4UQPA 2P4QA 4OA5A 2FQYA 1YZTA 2JGDB 1R0RE 3R3JA 1RFLA 4C1BA 3AB7A 4RX1A 1UJMA 2RHHA 1JSCA 4K0KB 1SC6A 1ADFA 4UCWA 2O3SA 1Z83A 4K6OA 5F4BA 2VXBA 4XQCA 3KZNA 5JCOC 1VL2A 3CXUA 1QRAA 1XJ5A 2B9ZA 3LKVA 3QE4A 4MQFA 1XSEA 1VP3A 4EL0A 3HU5A 2G06A 1MOQA 1FFAA 3R0QA 2RGBA 3OE5A 1NASA 4MR7B 1HXHA 1YTFB 4C2AA 4TS4A 3G17A 3I8OA 5BY1A 1C2TA 3GP8A 2D7CA 5KCZA 5IHPA 1A7KA 4ZCPA 3T1YO 2O54A 1Q0SA 1FFXA 1Y33E 2HW8A 3EIQA 1D4FA 3OHPA 1I2AA 1Y37A 4A03A 4HB4A 4ALIA 3N0WA 1U7OA 2BSKA 1LPSA 4ZFNA 3OR7C 3H84A 5FOWA 3LQ4A 2QRHA 1Z6AA 3C87A 4IS2A 1WL8A 3S1SA 5IVKA 3EIFA 3DNMA 1K8RA 1SCAA 5M34A 2J3JA 5HDBB 1A2OA 2ADQB 4E12A 3NKLA 5KTRA 1DEOA 1J1IA 4WCFB 1Q8RA 1XNJA 2V59A 3MWDA 4EEXA 1X7YA 2AR0A 2I4NA 1ZXBA 1KMQA 1T6NA 2X9GA 3I3OA 2J3EA 2P9EA 2P27A 5EZYA 4IIFA 4DG5A 2BKAA 3QBJA 1ISRA 5FUYA 3PXAA 4BFZA 5CPBA 4GRDA 1A95A 1I13A 1SEPA 4LJLA 2WD7A 1YSCA 4DO2A 1TZ2A 3U7JA 2XE6A 3LUHA 2PH7A 4XASA 2LW1A 1IPEA 4OBWA 1L5YA 2BR4A 4X1KB 5GTHZ 1V1JA 1EP3B 2CKMA 3EDOA 2CTQA 2I3ZA 4YV1A 3BT7A 4O0MA 2ADMA 4HAUA 5ESXA 1H3FA 2HIGA 4XWAA 1NBOA 3S0JA 1EUCB 3P9IA 3NGLA 1XZMA 1M6EX 2HJRA 4DBVO 1IXBA 3U26A 4FOSA 4EELA 2OYQA 1SERA 3SS8A 3RUAA 2WJWA 3VPCA 4EITA 4GWGA 1WN7A 3I09A 1ZBDA 1G7CA 3B5JA 2I3BA 4OBXA 5AKHA 1APBA 1B6TA 1QPBA 5JLJA 3FE2A 2P7IA 3EXG2 3JCUZ 1T9KA 3O9VA 3GXOA 2HFJA 5KOJB 1S4MA 1MEEA 1XD2A 1OBCA 3VDQA 4MB6A 3BWCA 2WMDA 1C80A 3FWNA 5AK0A 1KIAA 1E9RA 1F51A 1XZHA 1EINA 4NJOA 2ZAIA 2ABWA 4FS8A 4YO8A 4YI3A 2A9JA 1MOFA 4DR2O 2D0OB 2A5FA 5IC5A 2XUKA 4B3SB 3UTCA 5SY9A 4XWKA 1HEYA 1QCYA 3ZDBA 1RT9A 4OK3A 1BQZA 3HLYA 5THQA 4F5ZA 4IG9A 4C43A 1VMEA 1TJYA 1WW3A 2XOKD 3PNLA 1Y8QA 1SWVA 1U7TA 1VPEA 4M1MA 3K09A 2HLDG 1WXFA 3SYLA 4PRYA 4KQIA 1PQ4A 1H0SA 1WXDA 4LI0A 4Q4HB 3RTGA 3VX3A 1GZ3A 3UO8B 1KZYC 4NOJA 2W6PA 3A1NA 2O0LA 3O9ZA 2HWYA 3OKAA 2AN4A 4PLVA 1C1YA 1P60A 3BJZA 3X43A 2F1KA 4P9PA 1QORA 2CZGA 5IU6A 4WEOA 2GAOA 4UTRA 4X94A 2J8ZA 2LIPA 3ZJTA 4P92A 1QU9A 1ND5A 2VQ3A 3KCXA 1ZJYA 3OF2A 3IIEA 3RG8A 521PA 3AOGA 3P9KA 3TTUA 2G3YA 5DYNA 2A79B 1E94E 2XZOA 3PWKA 1M34E 4A0QA 1QG6A 3RC1A 4I1VA 3R8XA 1JA1A 1FFWA 1WHTB 1HPLA 2JVJA 3I64A 2EVWX 2AE1A 3FNQA 3D8UA 2PSHA 2FJPA 1NVWQ 4FFKA 3REQA 4L5CA 1O0CA 5CFNA 1OIVA 3U31A 2ZDIC 2RH9B 4F12A 1CUCA 2C07A 3G2HA 4R9UC 2F17A 3V34A 2GAFA 5I4BA 4NZPA 4YWJA 2P62A 1M83A 3TPZA 3TKAA 2OO5A 1W52X 2XGMA 2B1QA 4B6SA 1OR8A 4JI2B 3AJEA 4KIFA 3BFVA 3O4JA 1M76A 5F2NA 1N8RH 3GNTA 1C7FA 1VQ5V 4FZ5A 2QAGA 4J2TA 2GJ8A 4E09A 4Q16A 4AW9A 4M9CA 2PYJA 4YY3O 3DPIA 5JMPA 4K8OA 4HGYA 2CJXA 4GOLD 2IYWA 1Q3HA 1GU0A 3KELA 4C9BA 1EP9A 2JJMA 1F8XA 1P0FA 1ZQ9A 3ZU5A 3F5FA 1HFKA 1R8JA 1BE0A 1LPNA 3UG7A 2JATA 1N7HA 4DHEA 4DSAA 2QUKA 3UXEA 2RAFA 4BB5A 4DVGA 2R8EA 1YVUA 1R2QA 2QTSA 2IPXA 3ZD7A 2PR7A 3AEQA 2PGGA 4AO6A 4ITVA 2ZVDA 5T5QA 1X8LA 2IP4A 2W71A 4K9DA 4CH5A 2EDCA 1CKEA 4D9JA 1YS6A 5AKGA 2XB4A 4RPJA 3G2OA 4N5HX 3N9IA 1Q1GA 5KUMA 4YAKA 4OTZA 2XUDA 3LBHA 3AFMA 3GLGB 3CRMA 4RQFA 1JA8A 1VJCA 1NHGA 1ADYA 4NFYA 4M9QA 3HKCA 4G1CA 5KWIA 1WAZA 2VK1A 2FOXA 5D01A 4TUYA 2QPLA 1QJ4A 1UFVA 2XI4A 1RRMA 6LDHA 3EG9A 4FC6A 1KJZA 2BKLA 1RC8A 3LSUA 4AJIA 1NM5A 3PLNA 4WJLA 1VQ6V 1L4BA 4B3FX 1HOXA 5ALYA 5KYUA 1HY3A 1PS9A 1XZAA 3DM5A 4A6PA 2FW7A 2RGNA 5G0TA 1U1GA 1ULHA 2IDKA 4ETWA 2HHCA 3L84A 3OCXA 4BNIA 3QOWA 1E66A 2QX9A 3IUEA 2PDAA 3COSA 3Q6NA 2HDWA 4DN6A 1Y9DA 5EWRA 3L1HA 3LPMA 1ZESA 4D7AA 1HZZC 2NVUB 2G4VA 4CTKA 4WXPA 1NRWA 2EC5A 4GRAA 2Q7XA 3ODPA 1JAIA 2GPTA 2J5XA 3GUYA 4Z9FA 1W19A 3L1KA 1I1NA 1IQPA 4BMDA 3H83A 3TRIA 2RHBA 3X1MA 1RWWA 4GW3A 3B89A 4OCZA 4YRCA 1CG6A 3PDHA 2VH1A 3FB4A 3CXHF 3LWOC 2AJTA 1HMYA 3LTNC 1Q17A 4PBRA 4EY3A 4U7WA 4G67A 1CPYA 2XF8A 4W4LA 1GPUA 1XFAA 4ZDWA 3UB2A 3E2MA 4JEMA 1JT9A 2GN2A 3JATB 3CLRC 3LDHA 4ONEA 5AIAA 2ETVA 2XIJA 4B9EA 1BE8A 2BKVA 1Q7TA 2ZD9A 5CT6A 3VTZA 1G8KA 2ZRJA 4KXMA 4KXFB 1QRSA 1CC1S 1YVWA 2WMYA 4PW0A 3L41A 1R9NA 2O9JA 4G41A 4WMLA 2IYQA 1DU4A 2F7SA 1AMNA 4HFRA 1SQQH 1BQ0A 3VJKA 2VDVE 4A8JC 3HO8A 1EVKA 4F1KA 2BKXA 3SDSA 2AT1A 5DP2A 1P73A 3L8EA 3D4LA 4IHJA 3FWKA 4JQCA 4EHFA 2AW3A 1RWMA 4N4AA 5HIJA 3U9LA 4ZO9A 3UUGA 2AEJA 3ETEA 3HTXA 2CXUA 2DBYA 2B4YA 3KZVA 1RMQA 2QM3A 3GDGA 4H6VA 4P5DA 3AHHA 4P58A 4UNSA 1QYCA 3WGGA 4RPLA 3MNFA 3L49A 1RLTA 4I9UA 1EWYA 3RU3A 1NYRA 3UC9A 1LGYA 1TEHA 2XSZD 4DXWA 3EZLA 1AI6A 1VBFA 5CCEA 2WC1A 3LQ1A 2ZR8A 4GYKA 2GJKA 3V42A 3ENQA 4ZO6A 4TSFA 1YJBA 4ZJYA 2OUKA 2QG9A 1J97A 1LPBB 2G5PA 1X59A 1CP2A 4QM7A 1WDTA 2H7YA 5KKAA 1KYOF 1Z6ZA 4EW3A 3PPWA 4NCHA 3RTDA 3TZKA 2LBXA 5K0FA 4LSMA 4MVQA 5KWVA 5JRZA 1XF9A 2R9IA 4WK6A 3KFXA 1UPBA 2X2EA 3U3DA 1G6Q1 4F2PA 3FIUA 4FXPA 4HAIA 2GTIA 4YQYA 1F7YA 5HF6A 2YWBA 1GCAA 4BLOA 3O92A 2G67A 2QV0A 5A0VA 1N5RA 1K8QA 2PSDA 1LBQA 1SUIA 3FF1A 1ESMA 4FQ7A 3RW9A 3R0PA 2YZ2A 3F1KA 4OI0A 3KUUA 4JR1A 4B8WA 5ALQA 3A0UA 3TKLA 3INYA 1GLVA 5HFJA 5BSFA 4X3CA 1QE5A 3FLAA 3KETA 1CUFA 2VH5R 3RR2A 2NP6A 3GEPA 2DWOA 4GKAA 5J4HA 3K70D 2IYLD 1JKMA 4UHEA 4GYJA 4M1SA 5DN9A 5AKLA 4JYAO 5H68A 2O8EB 4YP7A 5DN6D 3RIGA 2GBFA 1CQIA 4CQLA 2Q4RA 2R97A 1YJ9V 4MS4A 4CV0A 4R1PA 2CLCX 3L2OB 4DY4A 2Y69C 1JXAA 4PY2A 5AR1A 3AYXB 1ONSA 4V3BA 1MV5A 5JV5A 2MSWA 3JD1A 4X1YA 4RHEA 3DL4A 1XTUA 1L4FA 3LHDA 4Y2VA 2VK4A 2Y71A 4C76A 4PCAA 3KCNA 5GANK 2HB6A 1RYDA 5JOQA 4C5CA 2ZUTA 4CU5A 5HIIA 3NOVA 4I9WA 3CEJA 1IC6A 2P9HA 2COUA 4LF6O 3KEFA 4D6XA 1Z34A 4Y6SA 2EFJA 3LCCA 2I1LA 2KSQA 3RS9A 5DM60 4RGYA 4UEKA 4MLCA 2ZU6A 3WGZA 2VQEB 5F73A 3ESYA 4GI2A 4BMSA 4JZKA 1XCPA 1O7JA 1N5JA 1KJJA 1SNYA 4CLOA 3ZP7A 4FUQA 4YXWD 1ZN8A 3NNDA 1H66A 2D6FA 5LP6B 3OX3A 3BABA 4FEAA 2BM1A 1GQOA 2WLMA 4JL6A 3K5MA 2NG1A 2QP3A 4V03A 5EJIA 3HCWA 1D5AA 3GCDA 2GD2A 3RYHB 4RD2A 3GQBA 4D8XA 4KXLA 2HRZA 1NVFA 4BVKA 4LCKA 1AQYA 2FOIA 5AHOA 5L40A 2H11A 4X62B 1OLXB 4U6NA 2OC4A 3C9SA 2PS3A 4RVUA 3MC1A 4YIPA 4A2WA 3F98A 4MRMA 5AKZA 4KFRA 1E9SA 1KR2A 2LP7A 4ZCSA 3CTMA 1D1TA 3EXEB 1OQAA 3FCUB 3TETA 2B61A 2TS1A 1Q20A 4N3CA 1O54A 4DC1A 4G0YA 2BCJQ 3HXMA 2H4ZA 2VPXA 4Q4AA 1WG8A 2HBRA 4YJKA 1RHKA 2Q1UA 2Z4SA 3KQMA 4JQYA 3P0JA 5F5NA 1E92A 2AWNA 3KWLA 2E87A 1G2IA 4Q6GA 5LZ8A 4IQ0A 2MYPA 1E1QD 1MEOA 2VPTA 2XASA 4QNHB 4YLYA 4PG6A 3OT7A 5BOSA 2YWHA 5ICCA 4JU8A 1GGJA 2YHSA 2X5KO 1MABB 4DIBA 4S35A 3HWUA 3WLQA 1QH1A 1J23A 5KHKA 3B6IA 4FT2A 4MT8A 3LG2A 4ER3A 4HEHA 1YRQA 4EBFA 3OGIB 1QX4A 2E7ZA 5B1BB 4C06A 3L1JA 1GG2A 1VARA 2IZ0A 1W57A 2X4DA 1K7EB 2KG7B 3LW7A 4H4EA 2YIBA 2B9EA 4P9NA 4H44B 2HPZA 1N0NA 1YTFD 4XIGS 3OZRA 3SDLA 3W04A 5I8WA 2X4GA 3OI7A 4AZWA 1FUKA 2VO1A 3W9UA 5JTTA 1N7IA 4M6WB 3E48A 1JIKA 2ECOA 3UJHA 3M3HA 4BAZA 2ECPA 3ORFA 1Q5OA 4RSHA 2VNAA 2BE7A 4DL9A 2Z2KA 5CAEA 3HDJA 3QITA 2HF8A 1PK9A 4G28B 2O20A 1ZLYA 4JGSA 4RDCA 1CWUA 4D6YA 1M34B 3DTVA 4TT3D 1NLUA 5B7QA 1T1IA 1GN4A 2PL9A 2LKDA 3JVVA 2OIEA 1SVKA 4WESB 5AVTA 4C0LA 3HVHA 1VCOA 5ALUA 5ER6A 4LWQA 4Z7NB 5JS7A 1YOBA 3SJBA 1K06A 4KMRA 1U0GA 1EFLA 2G0AA 3D4IA 1WOMA 2FSSA 1SS3A 1Q7YW 4AJ2A 5TRTA 1RACA 4MV9A 1F3LA 5IDYA 1RXVA 4R9VA 2NAPA 2WJVA 3S3WA 4ZXPA 1RADA 1EVEA 4PFKA 1IBLB 2YNMA 5CD9A 4MKGA 1DAPA 4OSEA 1S77D 1H2WA 4AJLA 1QM5A 3F6SA 3FYTA 4XDGA 2BEJA 2PUSA 1JR3A 4NESA 1I2ZA 5JDIC 2I6XA 2PT9A 4KU4A 1ZOPA 3JQCA 1CY7A 4MQFB 3AINA 1D09A 3G71F 4FILA 3CH4B 4B3XA 3DE0X 3UWDA 4L15A 1SZCA 4GQAA 4ZGWA 1FSSA 1OZAA 4XJVA 5IDXA 2VZLA 121PA 5KJFA 1JE0A 2JDID 3AG1B 3PR2B 4MHOA 2Z4TA 3LMEA 4OYHA 3T54A 1R18A 3S06A 2QYTA 4RPGA 4UVEA 1G19A 10MHA 4FSXA 3VBBA 3KAPA 1P18A 3H75A 2A9OA 2CE4A 4JKYA 4AG6A 5CEJA 5IC4A 2Q4OA 4ETIA 3L8YA 5KHHA 5JR3A 1DIBA 2O57A 2BSKB 4UBLA 1GGEA 4KXYA 1KI7A 3EGIA 3SEZA 1PGJA 2EZPA 4NNJA 3M8AA 5G3ZA 5MN5A 3H16A 2XR1A 3SXJA 4PLFA 5KQGA 4TTAA 5KB3A 2LPMA 2C1ZA 3ZJ5A 3A05A 3O74A 2FEMA 1U96A 4Q4DA 3MWDB 3C5EA 3ETJA 2R8YA 1OJLA 1V5WA 1X7YB 4RTLA 1XRLA 2E74B 4DMFA 1G5TA 5C8DA 3K5IA 3OX2A 5EZYB 2VSFA 3CV3A 2BCCH 2XLCA 2QKSA 5KNDD 1MKYA 3NVAA 1Y4MA 2JRCA 4EVSA 4WT7A 2WD7B 1E2JA 4BW9A 1UPAA 3ZRVA 1RI3A 4JGIA 3QY0A 4MW5A 1EFAA 1C9KA 1P81A 2CFSA 4UVAA 2C59A 3HFJA 1A77A 1ONIA 2G7ZA 4JTDB 1I0IA 2SICE 3A14A 3IA2A 2QX7A 1OH7A 1SC1A 1JG3A 1IJKA 1AG9A 1DBIA 4ZJPA 3GUZA 3UWSA 4QECA 3DM9B 4ZK7A 1PEKE 4ND8A 4OSPA 1E5DA 3E15A 4KO1S 4XR4A 3N5CA 1NPDA 5CDGA 2OM6A 4DV2O 2VS0A 5KTOA 2QMQA 5K6RA 1XMVA 2W2TA 3ZDXB 4C0AC 4JUFA 1YIJF 3GGPA 3BE8A 5AUQA 3AOEA 2QGNA 3GLHE 3QH4A 4K3VA 2CUKA 1CW2B 2EZOA 1PTJC 3EFFK 3NIFB 4PNHA 2AVNA 4LNHA 5HYVA 4UARA 1T9ZA 4F4JA 3KLPX 1CQZA 3ROTA 3IOBA 3WR5A 2JGRA 2QUZA 1A69A 1XD2B 1P2VA 2B8WA 3IURA 1BSVA 4QJ4A 1SHLA 3KL4A 3JAKA 2VDKB 5F2KA 4G2TA 1B43A 1ZA2A 3K0HA 1AC5A 3B2QA 1KEVA 5EIBC 3MF4A 1WPBA 3MTQA 3CD6F 1W7AA 3I6ZA 5DSTA 4MUAA 1R5NA 4FBMA 1ONBA 1V47A 2C4VA 3A06A 3KHKA 1ROPA 4OHRA 1KC8H 2VT2A 3PGLA 1OROA 1Y8QB 2NXNA 3VR4A 1XRSB 2HR1A 1QO0D 1LK7A 2OCLA 3MAQA 3AEZA 4BNGA 2LE0A 4HS4A 3HRHA 4ME6A 2GMWA 3HJHA 1QAMA 1VK3A 3B4SA 3I6IA 5B5SA 4LQCA 3M81A 3RAEC 4LRTB 1KQNA 3RS0A 4CS3A 1N2JA 5IKMA 5BNZA 3T4ZA 3V2IA 4PG5A 4J9ZB 2FSHA 1QYIA 4Q66C 1I01A 2I2DA 3BVOA 2LDBA 1Q0TA 2PSSA 1Z4PX 1QVGF 1W29A 3WGKA 1Y8RB 2C7QA 2BGNA 5JC1A 3L04A 4BO1A 2EJUA 3GLFA 3EOAI 5DX0A 1QB8A 3TCUA 2JW5A 3A6HA 2I2XB 4P3PA 3V7WA 1KJIA 2GM3A 2W6IA 2DWPA 2F43A 4NONA 3HXOA 3REQB 2L35A 1PZGA 2I9KA 4DMHA 4FR0A 1N2XA 2Z09A 4CIAA 5AVZA 1JDZA 2CK3D 3FZGA 3BXZA 4B34A 4A2CA 2GM4A 3SIXA 5B58T 3VYSB 3FYHA 3EPJA 4EJSC 1C4KA 3QXGA 1B6QA 1HGXA 3M5PA 3WGTA 2VFAA 3HKDA 4IV0A 2IYFA 3RF7A 3PZRA 4C3ZA 1OYVA 3D2AA 3H11A 1Z16A 3EGCA 2VP0A 1DFGA 3RS5A 3TCKA 1YCDA 4QQ8A 4H7JA 5BMVA 1G63A 5EMNA 1M56B 2XKKA 1Z45A 4TQGA 1Z0UA 5KDLA 1EUYA 3THSA 5FL7A 2WA1A 5EP4A 2IPAB 1OH8A 1NW8A 3EQZA 1IUKA 5IF3A 3O21A 3SSOA 4P84A 1C9MA 4GDFA 1UINA 1ORWA 3SJCA 3PGA1 4NBRA 4C7JA 4LNAA 1D6MA 4LC0A 4IDBA 5D85A 2BE3A 1EAMA 5AO9A 4ZQCB 2A3RA 4KQCA 1VRCA 5KVCA 3BRWD 4QA9A 2W2VA 3EIWA 3K58A 4RS4A 2FHSA 3ZJVA 3PFFA 4P4SA 1EPUA 4MVRA 3UXHA 3GI1A 2VGMA 1M5RA 2Q49A 2XY4A 2J7KA 1GA4A 3ASVA 2GZRA 2KX7A 3HYCA 1KMHA 5L53A 3GVPA 3SFTA 3HKCB 4RHYA 2PT7A 2K6GA 1QS0A 4TYNA 3F4BA 1XVAA 3LE8A 3NAQA 4XPZA 4AD8A 1XQXA 4QREA 5LQKA 5LPNA 3ZJ4A 4JT8A 5D87A 5CJPA 3ZWOA 1PFYA 4B7UA 3L1IA 1R0ZA 4W5JA 3QGMA 3FUWA 3HN6A 3RAPR 2EYQA 3M6MD 2HXYA 5KOYA 5IJWA 1XJQA 1V35A 2NU7A 2QL9A 3KFVA 3M1IA 5KYUB 1LSSA 1GSAA 2J3MA 5F78A 3HP4A 3N8GA 1G2OA 3AEUB 3LYHA 1OCRC 2YDYA 3OJXA 3N70A 1AP5A 1C9NA 2WB4A 1AOXA 4I7ZB 3C45A 3M4XA 3ZWVA 5DYWA 3E9MA 3VR1A 2JS5A 2WWFA 4OHUA 1FXKB 3FYDA 2VYQA 4LK2A 5B3SC 4HR7A 1Z2OX 2P4EA 1G4YB 2JHFA 3E23A 1NKSA 1QZZA 5AI9A 1Z0DA 1ZWKA 3TGUH 1Q1NA 3GVMA 1U8CB 4ZGGA 3L7IA 4MTGA 1E1NA 3GDFA 3WQQA 2YIVX 1JPNA 1G3IA 5HJ5A 3WY9A 1YGYA 4CTNA 2FX3A 2MJLA 3NFRA 1I6MA 3I1JA 1Y3AA 5EJ8A 3UA3A 4LY0A 3QHDA 4JI6O 3AKDA 3S2GA 3NFYA 4W9NC 5ELLA 1D2EA 2B78A 1L4UA 1U3WA 3LWVC 3L0CA 3I72A 2ID7A 1Q12A 2R4UA 2HK7A 2OCYC 4ZIRA 3ICQB 2CUTA 1H2BA 2Z0MA 2Q4TA 2ZR9A 5TMEA 1HE3A 1HT0A 1WSDA 3A6DA 1W2BF 3TTTA 1RIFA 3RFCA 4LQ4A 4DARA 4ZEOA 1DCTA 3EW7A 3MJSA 1TM5E 1FTWA 3TSCA 5GIPE 4B4KA 3JD3A 3KVRA 4HN4B 1H48A 2WG1A 1Q1ZA 2W6IG 1IHDA 1TFRA 2QBYA 1EK0A 2ZUEA 2F43G 2NIPA 4IJ6A 4JYZA 3GMIA 4TMZA 1CNFA 4IIVA 1XMOB 5EE3A 2MINA 1NOJA 3BPZA 2O5EA 2MYNA 3UGQA 4HUTA 4IHJB 4JJFA 4JJIA 4UBKA 4BMNA 3DH0A 1CUGA 5HK8A 1GHTA 4RE6A 4WXYB 3N2KA 4DV1O 1TUEA 1BA3A 3FYUA 2DAPA 3O2JA 5E38A 3FA2A 4D3DA 2GV9A 1EIZA 1EZJA 2VRWA 3E5RA 5H81A 5FPSA 4H35A 5EC1C 4QPPA 5DYGA 1BS9A 1XZDA 4R71A 1COWA 2EWVA 1T10A 4PGHA 4US0R 2VCYA 2RN9A 2CDBA 5FL7G 1K4MA 2YBDA 2ZVJA 8ATCA 8OHMA 3MQFA 3I7TA 3DLAA 1HF3A 5EWJA 5EJ9A 3H1TA 3NYIA 1PHRA 1RHMA 1U02A 2WTAA 2P9YA 1Y7HA 2Q45A 2X76A 3WXBA 3R23A 2X1LA 3REGA 2CUZA 3IR7A 4L51A 4DV5O 1H4QA 4H7KA 3LZCA 4ZA2A 5IY5B 4I08A 1QH8A 3HYRA 4MTXA 2HHHB 1A4IA 5SZJA 1U3UA 3T9EA 2TECE 1OZHA 3FOAA 1R12A 3S99A 4UFNA 5EKDA 3NM6B 1VZ2A 1U0LA 1WUKS 5GV7A 3NWOA 2XXJA 1H1LB 1UIMA 2O52A 4CIXA 3WKAA 4EQ6A 5HIMA 4F9TA 4IUDS 5DKFA 2QI9C 3CMEF 1P4GA 2X58A 4QWMA 2OHXA 1V9SA 2DFVA 5KNCA 4LV5B 3MW8A 1CLIA 3DGEA 3FDXA 4DR6B 1P49A 2QQ0A 4F3YA 3RTEA 5E95A 4IDGA 5KU1A 4Q4LA 3I76A 1AD2A 1VHDA 1OCCB 4V0MA 3UMCA 1CQIB 3CSDA 4CQLB 3CUTA 2GYUA 5CCDA 3SZGA 3QJGA 3C5CA 2UYGA 1XD8A 1KO4A 3L8MA 3C3YA 1Y89A 1F8YA 4OMCA 1FTYA 3GPLA 1ZRNA 3EZFA 1EWKA 5AD1A 1JTEA 1XQ1A 2RHMA 4NU6A 3ASOB 2Z9CA 3I01M 1VI6A 3WQBA 2PTMA 1NI4B 1NW7A 3KNZA 1Z18A 2PSJA 4IIJA 4NFLA 2BZGA 4MRRA 5HXUA 4NR0A 4FEGA 5DI9A 3N0VA 4PZAA 5DI3A 5ESRA 1M2NA 1FOEB 3DQQA 3MLEA 4XQ9A 5GY7A 2G9QA 2CE2X 3M5WA 2A57A 4L22A 2NQ2C 3EPKA 3WC4A 3W5IA 4IWXA 4GSLA 1NF3A 4RMJA 1QV7A 3L0DA 3DP7A 3KSAC 3K1TA 4BNMA 2EZ4A 5A05A 4DMUB 3EQ6A 2ZSJA 3CCVF 3F9CA 3G8AA 5H83A 1QG0A 5KNCH 5FPOA 1SVOA 2FWMX 2ONJA 1GM7A 4XWYA 4F72A 1ECBA 2JEOA 1GU1A 2PWAA 3LVRE 3TLCA 2C5LA 4KPGA 2C29D 3VPHA 3H1EA 4LHYA 3IC9A 1ILEA 1DBSA 2I0FA 4NBSA 5HBRA 4PRZA 2CHVA 3WDKA 1E32A 2PNJA 5LD2C 4IQ8A 1XI2A 1CN7A 4QDUA 4BPBA 3QU9A 2NPIA 3TJZA 1W8DA 3IXMA 5T64A 2XAQA 5IYDO 4NOLA 2V7WA 5ALEA 3TCXB 4JD5A 4URUR 1AS3A 3T3MB 3H8SA 3LWPC 3HJGA 1CRQA 2I8LA 1SXHA 3GLHB 1JQ3A 1M6VA 4G5GA 4NBLA 1SRYA 4LHVA 4D6TH 3GZNB 3SXUA 5KAFZ 1QONA 1F9AA 4TKMA 2BFBB 2YWRA 2ZUWA 4UJ5A 2MDTA 4FCWA 3ZUPA 2B36A 1B0ZA 1O3YA 3FPCA 2Z1NA 3GH3A 3L6CA 4FNOA 4F93B 2ZJFA 4UTPA 3MD0A 5JSQA 3HEMA 4ZZ0A 2OWDA 4UMEA 1GPAA 5KJCA 2OLJA 1KY3A 3VX4A 1COWG 5BOSB 3K0BA 3DLTA 3P9PA 1H6CA 1E2PA 4QGSA 1XZBA 2IOFK 1BHBA 1VL5A 4I9GA 4Q9JA 3D3IA 1Z13A 5FLXN 1KDRA 4C7OA 5IARA 1XL1A 2JA1A 3ZCSA 1YE8A 5GJWC 4HWSA 1N4CA 1TZMA 1PE0A 3QLUA 1T5IA 3ABLB 3T9BA 4BO4A 2DHRA 2GCNA 4BU0A 1GSHA 3FI0A 1TVKB 4JBIA 2E2WA 3BH6A 1L4KA 3DEAA 5I7AA 5F7OA 4ZVVA 4PA9A 1JI0A 3PI7A 1G5HA 3TINA 5FYQA 5B1OA 2RB5A 1ABEA 1BDBA 1TX4B 1P1FA 3KR2A 2R7KA 2VP3A 5DEIA 4KE6A 5FWAA 1P9LA 5CEEA 4TTTS 3V3KA 5C2JB 4ZKDA 3A0HZ 4Q82A 4PWZA 3N8DA 4CDGA 3L0SA 2VHCA 3U4GA 5KQRA 1TUBA 4RKYA 4D45A 3U48A 3PC8C 3D43A 1XDSA 3NCHA 5EXXA 1E9FA 2ZBGA 3UT5A 1SPXA 1MPXA 1L1FA 4BFTA 4AJHA 2HNAA 2JCYA 3PT9A 1PJTA 2IIQA 3FNGA 3WL4A 1QUEA 4K8RB 1DBPA 1A7AA 3QX9A 3DLPX 1ESNA 1M2EA 3B53X 5BR8O 1OW3B 1ZVQA 3LF2A 2VR1A 1DX9A 4L3VA 1UFRA 1U7ZA 3MTEA 1HDXA 3SP1A 4U7PB 4KHPO 3B8MA 1ZNYA 4QT4A 2PS9A 3G8DA 1NQ5A 4QODA 3WZMA 1NVVR 3CURA 4K46A 5AVYA 4A6DA 1JWAB 3S3XA 5BV1A 4JEUA 5ANRB 2EIKB 5BT9A 2QLLA 4M1TA 3FRIA 2VF2A 2FQWA 3K96A 4DR4O 2C8JA 3OFNA 1D9XA 3KZKA 1DCFA 1USWA 5EE1A 4KHZA 2R6ZA 3E0QA 1NVBA 3OW2F 3MOGA 2H8KA 4PC6A 1Z4JA 5LBTA 4YRNA 1K9SA 1T2FA 5BRJA 3CUSA 2LGWA 4BTVA 1RLUA 1TQ2A 2ZE5A 2QN7A 1C3LA 5JWRA 1L9KA 2RBKA 4BBZA 3U40A 4IW3B 5CXXA 2P6MA 4B7AA 4CMGA 2KBFA 1XILA 3KQLA 2FETA 3UA4A 3OJOA 2QSAA 4V0ME 3A7EA 4AT1A 2O2EA 2YVLA 3WG7B 3F90A 4EYSA 5IAGA 3PE6A 1IAQA 3A9UA 4IO0A 1IEWA 2HLDA 5FFNA 1LWNA 2F3QA 4L9SA 2JAQA 5REQA 4QXQA 4A1FA 4Y7DA 2Q5HA 1CXZB 1CY0A 4IO1A 4F92B 2E3JA 1E6UA 2CEKA 1E9CA 2DJVA 3JQRA 3Q8LA 4LKRA 3OKFA 5DX1A 1T2NA 2PMCA 2BFFA 5MFZA 2B0CA 1ZKDA 2UYHA 3VZRA 3NJ8A 1NQXA 1BKYA 5KSZA 2QRNA 3DO6A 3ICPA 4B3IA 3TLKA 1MRSA 4BVAA 4HMOA 5L3EA 3E3AA 3VPFA 4D9EA 4AICA 1ID8A 1T0IA 2GD0A 4GLOA 1DAKA 1BXKA 1RJDA 2X0DA 3O93A 1UMBA 3FB7C 1VMIA 1H6AA 2DCMA 4GC5A 4KXQA 3N28A 5T41A 2H4WA 2JVKA 2WHYA 4LX0A 1TADA 2EX0A 4MPJA 5JATA 3T5MA 2PL5A 5ALRA 3K15A 4Q1EA 3W4IA 3RG2A 1QDUA 3D5TA 5CDUA 4ND8B 1A5TA 1BXRA 1ACLA 3CVWA 1SOVA 4MPRA 4DW0A 2EX3A 1MZFA 2GS9A 4QJBA 3BQ9A 3OP4A 4G9BA 2BGTA 1HE8B 4O4HF 1UBHS 3M99B 4GP6A 2H48A 2AA3A 5JPIA 1XALA 1RZRD 2EU8A 4J1NA 3EXFA 4FZ3A 1NU1H 1P1HA 4FHCA 3M1YA 4CKWA 4F97A 2HMUA 5FKJA 4FM2A 1BX0A 2CFTA 5K0ZA 3SVZA 1EI9A 5CA1F 2EW8A 2C5GA 5AJVB 3T5CA 1I80A 2AW9A 4E5MA 5KSWB 4AQYO 3EMDA 4HUQA 1LPOA 4F46A 3GAMA 2EIJC 3H0KA 3T99A 5LP6F 3PJSK 3B2NA 2ZLBA 1DARA 2L42A 4G4XA 3JVIA 3QVTA 3E9QA 4BYMA 2IYRA 4LQDA 2B7BA 1Z0KA 3PNSA 1ID1A 4F5YA 5TMDA 1FDIA 2J67A 5DTIA 3F0TA 5KHOC 1M7BA 2JIBA 3OFNG 5DTJA 2JLBA 3IDSA 4ZDIA 3GN1A 4Y6OA 3WNVA 3SZUA 4M87A 1JUDA 3GARA 3OZAA 5DGCA 4MEJA 3QWFA 5K0TA 1QQ5A 3NVKI 4ZCRA 2GLTA 1V7ZA 4KQJA 2ZRPA 1ENZA 2C99A 3FCSB 2BOCC 3BWBA 1NXSA 3WVNA 2XT0A 1UZNA 4BECA 1RXEA 1Z0JA 4H3SA 1M10A 1U2GA 3LUBA 3JWEA 5JISA 2F43B 3A6FA 3CEHA 4X65B 3B9RA 3S55A 1TA9A 2QN2A 1NMUB 3KCQA 1MU0A 4MAFA 1TYZA 1NTOA 1TYEB 4PHHA 2B6NA 1PJLA 5HCUA 2FMLA 1HDOA 3TXQA 4NUTA 3DVSX 4YO7A 2ODNA 1N6HA 4GIBA 3RYTC 1W0JD 1NLYA 4C01A 4ALLA 1YB6A 2WKSA 1MGOA 1OXXK 1F8GA 1Q0LA 1C41A 1S8NA 4P4LA 4RK6A 1O89A 1K9MW 4D4IA 5IT5A 1XN1A 3H11B 1MJGM 4JUAA 5JY1A 2XB2A 1UBOS 4WLVA 4Y0VA 5BMVB 4JGBA 2EX4A 3NHFA 4PZZA 4D25A 3A10A 4K0RA 2I9PA 3L06A 4MVZA 3ZXIA 1NG9A 1VJDA 1MW8X 4JL8A 5LZ5A 5FLKA 4E5YA 5I4CA 1WA5A 3RJ9A 2EOAA 4ENWA 2RAPA 3PFCA 1FXUA 2Q3JA 2TMDA 2Q2NA 4DR7B 4HPXB 1DS6A 4N8EA 1GN8A 5IW8A 2ZB4A 4QTZA 5I51A 3F8WA 1N9GB 2FEPA 1SY7A 1PGOA 5I9MA 3VNRA 2OYSA 3ZS8C 2DG2A 1DFIA 1M1NB 3HEAA 1U81A 1KMHB 2JRLA 2IHKA 1GZ4A 4RSMA 5BSKA 2G70A 4E7OA 4NP6A 4RE5A 1D4AA 1SBTA 1UXIA 1DKPA 1W93A 3LWNA 2W00A 2WYIA 2J3DA 2XNJA 3WLNA 1E4OA 4GZ5A 3MCQA 1YQGA 4LFCO 1TCUA 3ELCA 4IX1A 3LDEA 3DMPA 4RTJA 1TKAA 4N5LA 3B09A 4OGQB 5CCXA 1FJXA 2UUOA 2VK8A 5K0CA 5H9CA 1SOAA 3SKXA 1KNKA 3CC4F 1E77A 4PVCA 3FKSG 5CA0B 3HCAA 4JR2A 1BFUA 1ZUD1 3K8QA 3U7QA 3EDYA 2YJ6A 4Z0TA 1TZJA 3N0RA 1VE9A 2XGJA 4KLRA 4Q9LA 1OV4A 3PPIA 5NLLA 2IUUA 4R7CA 1P29A 5COAA 1RTTA 3P9SA 4B7EA 2YFQA 3NJ4A 3ADKA 1V4BA 3U09A 2KKWA 3CCSV 4MW1A 4FB5A 1XVVA 6NULA 5FEUA 1KQSF 1LZLA 1CB0A 4D9NA 4QQNA 4JI8B 3UK7A 3EPHA 2V0NA 3GRYA 1TT7A 3ZXXA 3MJ4A 3C1TA 2P0EA 1WCYA 4N23A 3IV6A 2CDYA 1P0QA 4BNUA 1FAFA 4NMWA 3PZBA 2GHTA 3OOHA 3EX7C 1Q82W 5A3SA 1L3BA 4YJ3F 4H0LB 1P9WA 2DHQA 4ER0A 3LKDA 5FOUA 2VPYA 4YH1A 1RKBA 1MAAA 2XCUA 4ZOAA 4UM8B 2WVGA 3EZGA 1X39A 4XGIA 1JDSA 3MWEA 1Q83A 4ECEA 3E4DA 3NJRA