3HKDB

Tubulin-tn16 : rb3 stathmin-like domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkdB01
4U3JA 5EIBD 1JFFA 4KWEA 5C8YB 3ZBQA 4O4JB 3HKBA 5JCOA 5LP6A 4B46A 1FFXB 4EB6A 4IIJA 3RYIB 5ITZA 5LXTA 4FFBA 5IJ9A 4O4LB 3HKEA 2RHLA 4DXDA 5GONB 5LYJB 3JARA 5IJ0A 5EYPA 1W5AA 4I4TA 3RYFB 3WGKA 4O4IB 5LOVB 3N2GB 1W5BA 2VXYA 4X20B 4O4HA 3M8KA 3HKCB 5JQGA 5MN5A 4XCQA 1TVKB 3RYCB 5C8YA 4LNUA 4YJ3A 4F6RA 1FFXA 3C8LA 5KX5A 4EI8A 3JAWB 4U39A 5JCOC 5LP6C 1RQ7A 4EI9A 5GONA 2VAPA 5BMVA 4O2AB 3JASA 3HKDB 4I55B 4IHJB 5CA0B 1FSZA 4O2BB 5MN4A 4X20A 3ZIDA 3V3TA 4WBNB 2R751 3WGJA 5CA1B 1Z5WA 3HKCA 3N2KA 1TUBB 3JATB 5EZYA 5J2UB 5JVDB 3RYHA 4I50A 4HNAA 2BTOA 5FNVA 4YJ2A 4ZI7B 3M89A 2Q1YA 4X1YB 4EI7A 2RHOA 2VAWA 3VO9A 4ZOLB 5J2TA 5EIBC 3RB8A 3E22B 4I55A 3HKDA 4O4JA 4O2BA 4E6EA 3UT5B 1Z5VA 4WBNA 5IYZB 3JAKB 5MN6A 3RYIA 1TUBA 4O4LA 2Q1XA 5LYJA 2BTQB 3JALB 3VO8A 3RYFA 4O4IA 5LOVA 3N2GA 3VOAA 4TV8B 5JH7B 3ZBPA 5CB4B 1OFUA 4ZOLA 3VOBA 1JFFB 4ZHQB 1TVKA 3HKBB 3RYCA 5J2TB 3VPAA 4EB6B 1W59A 4IIJB 3WGMA 5LXTB 4FFBB 5IJ9B 1RQ2A 3JAWA 2XKBA 5KMGB 1W5FA 2VAMA 4I4TB 2BTQA 4TV9B 4O2AA 4DRXB 3CB2A 4IHJA 5CA0A 2RHJA 5LA6B 2XKAA 5CA1A 4X1IB 5CB4A 5JVDA 5J2UA 3JATA 4M8IA 4ZHQA 4TUYB 4LNUB 4YJ3B 4F6RB 4ZI7A 5KX5B 2RHHA 4X1YA 1SA0B 1W581 5M7EA 1RLUA 4X1KB 5KMGA 4U3JB 5BMVB 3JASB 4TV9A 3E22A 5LP6B 2GVIA 4DRXA 3WGLA 3UT5A 5LA6A 3N2KB 5ITZB 5IYZA 5EZYB 2R6R1 3JAKA 3RYHB 4X1IA 1W5EA 4I50B 4HNAB 3HKEB 4YJ2B 4TUYA 5FNVB 3JARB 5IJ0B 5EYPB 3JALA 1SA0A 4O4HB 3R4VA 3WGNA 4TV8A 5JQGB 4X1KA 5JH7A 4B45A
chains in the Genus database with same CATH superfamily
5D01A 2ZWVA 3I1JA 1OBCA 3THRA 2PVCA 5L4NA 2FL4A 1HTWA 2GQ0A 5L3QA 3ASNC 5G1NA 4E08A 3L18A 4FOTA 3KR9A 4WEQA 2B9VA 2ZKOA 3PP8A 3EXHB 3G2PA 4L57A 5A1TA 5ALIA 1PJ4A 2VP2A 2G5CA 1P1KA 3HU3A 4HWSA 5LQRA 5HE8A 1E4OA 2D7DA 3AUUA 3RPEA 2VQEO 4XFKA 2VFAA 1UBKS 2R6CA 2VDQB 1WXEA 3OLCX 4XDLA 1KNJA 1RYDA 1MIHA 2G28A 1OI7A 1B14A 3W90A 1J0CA 2F9LA 1QAOA 3AM5A 3TSAA 2PSFA 1Z83A 3D6AA 1BS3A 2F8LA 1M8FA 3DOEA 1GNSA 2PX4A 3IA2A 4YO7A 5K0LA 3BGWA 5DV9A 4C0KA 3TVYA 4Q4DA 2CYCA 4JP3A 1T2FA 2OHFA 2IEBA 4D0NA 3KRTA 4DQDA 3A1WA 3RSGA 1RJ9B 1I2AA 1E8DA 1XJCA 4FEAA 3JQDA 2BD0A 1J99A 3MOSA 2LKDA 3F9IA 2CXRA 2VF8A 4CLOA 2BF4A 3L82B 3WLIA 1OXUA 5K0TA 2B7CA 2A9FA 2WVGA 2RJ3A 2MW2B 4KMMA 2ZB7A 2CH7B 4WOCA 2GZAA 3BJIC 2CMKA 3U3JA 2CZWA 4QE7A 2W42A 1AKVA 1T0PA 2IVZA 4LF5O 2YQ4A 5K0NA 1C3XA 5FOSA 5KYWB 1HPLA 2J8ZA 4IDQA 2F59A 1YB2A 2AQIA 3CWCA 4XKJA 5T4EA 1QYWA 4ZT7A 5FO1A 4G24A 5K3OA 5L3QB 1A0OA 1QBZA 5CG1A 3GZTB 2OBFA 5LQJA 3O91A 5EAZA 2DF8A 2HHCA 3E0QA 3DE2X 1MH1A 2HXSA 2R9RB 1G9TA 3FZEA 1P62B 1HE2A 1Q6YA 3JVUA 5G0UA 2PFGA 3PZBA 4PAMA 1CB7A 3F96A 2C7RA 1V0JA 3TSCA 1WZ2A 1L5RA 1T6YA 3WLTA 5KYKA 2W70A 3ZX5A 3SJBC 2W6JD 1XU7A 4DY4A 2JFWA 5SYAA 3ND6A 4DM4A 1RHQA 4OAQA 4R8VA 2ZB2A 4IKOA 3NHZA 2PA3A 4J1QA 2AOTA 4Q6WA 2DHCA 2X0DA 2PA0A 5D00A 3D3WA 1JR4A 5DBEX 3ELCA 2I87A 3AFOA 3OHSX 4IQGA 1G16A 1EFVB 1DRWA 1ZGZA 3UJ6A 4G1EB 3OQNA 1LUAA 1UANA 3ICOA 3LM8A 4MUYA 3BH7A 2ASVA 4KRYA 5A7HA 3QKRA 2OP0A 4BX8A 4ESHA 1H47A 2DR3A 1IBSA 2HJFC 5I7WA 1V5GA 3PDCA 2RGWA 3M33A 1M1UA 1E5XA 5IF3A 3AW8A 1B43A 3F1LA 3KYIB 4NENA 3F0DA 3IV6A 2JDIG 4PV7A 2J67A 1N8RW 3TVTA 5CNJA 3CX3A 4B3MO 1JJ7A 5DM6V 2CTPA 5FV7A 1W5BA 4FGJA 4XOIA 2V7BA 2VJOA 1X1BA 4US2R 1BS2A 1JEYB 2KX7A 1WB4A 1U2RA 4Q6GA 3MLBA 4KP7A 1ZGCA 3UXYA 5F98A 1J06A 3BWCA 1I0HA 1NH2B 3ES9A 3RJMA 4ZYVA 2WTUA 4FXPA 4Z3DA 1WZEA 4QBIA 1TD1A 1N0IA 1L5VA 2CD9A 2R7MA 4YUVA 5HF6A 4MSUA 5GONF 3OQJA 4TN5A 3X1YA 3D8HA 4G0VA 4B3BA 1ISJA 2J32A 2WKWA 1XGKA 2Z5UA 3BG5A 4ZRNA 4M1WA 5FWXA 3K79A 3PL1A 4PDRA 4M98A 4LXHA 1RWNA 5DGCA 2ZJ5A 4IFBA 5JNLA 4X5OA 4IS3A 1MX1A 2GEFA 4PGAA 3P5SA 1ZTEA 4TKVA 2MU1A 3VHXA 2JFPA 3HUTA 3D3WB 3E1GA 2C20A 5E3IA 2W2NA 2RH5A 4BXOB 1XX6A 2J4FA 1MNAA 4QPPA 3QKRB 3UEOA 3OX4A 1NFQA 3PPWA 1AK2A 5CFPA 4BIOA 1GNRA 3K0GA 4BKQA 3VNUA 1LJLA 2F95B 1EJ0A 2CE7A 3BH6A 5FOUA 3ED5A 1KYOF 5KU1A 4NENB 4RELA 2ONCA 3KKKA 2LBTA 1MO5A 1L4GA 3HI6A 2BHSA 4YEDA 3OF3A 4LXQA 1QX4A 5FBWB 5LZ2A 1AROP 1W34A 5EIXA 3EIOA 3KOZA 3V7QA 4M8IA 5CVEA 3MFQA 3ZWDA 3ZHVA 1ZK2A 4EGFA 2HOQA 2YZ2A 2DTEA 1K73H 1R7RA 3DFMA 1BD3A 3W8FA 1QG4A 5EPEA 4HP8A 3UNXA 4E21A 4PC1A 3ORQA 5L3DA 1DIRA 4BCCA 2A1TR 4UHBA 3LUBA 1Y8RB 1TFUA 5KVCA 5AVRA 2HNBA 2B8EA 1SKUA 4UTNA 1HDEA 3IMCA 1SU7A 3SS7X 1SZXA 1F0NA 1WP7A 2I3AA 2PKQP 2J3IA 2HKIA 1NJ6A 1S2NA 3UJNA 2YDYA 3QW4B 2XRFA 4GLFA 4OOEA 2R5WA 1FBNA 3JTMA 1ZWIC 5KWVA 2KTVA 2W6JA 4LQCA 3CVUA 2ZK7A 2YXDA 5TISZ 1PR2A 5E1DA 2B8JA 1WXWA 2I34A 3IVAA 1BVRA 3ZXUB 1AUXA 1F2UA 2EF1A 2KM1A 1I9GA 3CIOA 4TKVB 1SBZA 4FFDA 3VHXB 1Z2CA 2W2MA 5I9TA 1K9SA 5KIAA 3W34A 2H2DA 1L4YA 1E1CB 1FP2A 5DBFA 3INTA 1WVIA 3DBRA 1RXWA 2JVDA 5IYCO 4D3FA 3JSLA 2YXBA 3L77A 3CE6A 4CV3A 4LRUA 3ZMTA 4TVBA 3EFHA 3C3SA 4JL5A 4AIRA 1WD7A 2HSDA 4M0KA 1ZOPA 2C9ZA 1B73A 2XDQA 2Z30A 4KV9A 2Y1CA 2DPMA 1KH1A 3FKJA 5ERYA 3KZKA 3QO5A 3KKPA 3GP8A 4KKXB 4AILC 4CIWA 2FZKA 2D3WA 1IHUA 1JXMA 3FD9A 2Z1EA 4KQKA 4YDSA 3OX1A 2K87A 1VLMA 2BJVA 4JSRA 1IZYA 4N5LA 5FORA 1ZUHA 2VDUE 3UGKA 4UARA 2L18A 5DT2A 3NYRA 1NLFA 4NEGA 3HADA 1BJTA 3OKCA 4UATA 5ES4B 1RJWA 4QUEA 4W1PA 1DEOA 3A04A 3TINA 4IOJA 2FKXA 4Y0VA 1P9RA 2HNKA 3H7AA 3C3AA 5KCMA 2CXUA 3FPEA 4ZANA 4IJKA 5A3RA 3A6JA 1SZPA 5DPMA 1W52X 1UP6A 4TLLB 4JGIA 4RETA 5DSZA 4K5QA 4BV9A 2AKAB 5HNKA 4HAIA 4L9WA 1O96A 3I56V 3MG9A 3QX9A 2IUEA 4GBJA 1R4AA 4HQRA 4L22A 4G36A 4BKPA 2WD7A 1TMOA 1F2UB 3SDBA 1FAFA 4PZAA 3EASA 2ATIA 1U2QA 2VPWA 4LWOA 5CGQB 2QK4A 1D5AA 1GZ7A 4R5HA 5ESRA 3KWLA 3QKTA 3MXOA 2W43A 1P0FA 4U9IS 2MYUA 3HB3B 1ZGJA 3VJKA 2RG7A 3ANMA 4IIDA 2IIPA 1MFZA 5H3LA 2G1PA 4V0RA 3R8XA 1IURA 4MZXA 4EHFA 1XTIA 2AQHA 1R1DA 1RJDA 3D3KA 2V7VA 4FLZA 1V26A 4U7FA 4MV4A 3SJUA 1B1AA 3X1MA 2XDQB 3LOUA 1DINA 2JBHA 4HWTA 1GFWA 5TQVA 4CH5A 3I6BA 5HIAA 3QE3A 2IKQA 1LI7A 4UOQA 1GADO 2OB2A 1GGEA 5I7RA 1EGMB 1LLUA 4IOKA 2JCVA 1LI4A 2HWXA 1UL1X 5SZHB 1NMUB 1GR0A 4ZBMA 2VT6A 1YITF 2EIMB 3COZA 3TR5A 4OGFA 4MRAA 3SM3A 4D9JA 3TZCA 1Q86H 5M34A 1B0UA 4AJJA 1H5NA 1G8PA 1PG5A 4TQGA 4L5CA 3ZR4B 2AMYA 3R9IA 3DWIA 3HBJA 3ZV3A 4L9AA 4ZHWA 4LBZA 4B8WA 2HI0A 1NFFA 2VQ3A 4QYMA 5AKHA 4GMDA 4KNVA 1O96B 2OO5C 1IUKA 4KPEC 4YONB 2WD7B 3PUYA 1KPIA 4QYWA 4DLSA 5LZ5A 1DV2A 2OHWA 4B5KA 4F2PA 3OEHG 4WK6A 1UXIA 3I39X 1H2ZA 1G1XB 2FSGA 1R0XA 1ACLA 5K8LA 2HX0A 1VE5A 3Q87B 4FI3C 1UH5A 3U3KA 4EARA 4Q16A 4TKMA 3Q2KA 2RGUA 1NBMG 4M6WB 4C2BA 2Z9BA 4R1TA 2WZBA 4P9OA 2M32A 4CT0A 3T7RA 3Q40A 1CQJB 221PA 4DJTA 1KZHA 5U4QA 1B8NA 4N4AA 3HYRA 4X7BA 2BGRA 1VSVA 4IFEA 2ZRHA 4J3FA 2OIEA 2QJTA 2QW1A 4U2CA 4C7OA 3WYNA 4BU0A 5ALMA 4TS4A 1RYYA 4CUJA 2QMQA 4ZHVA 1AB5A 1MKYA 2BPOA 1A8IA 3I6ZA 2W6NA 3ABSB 3G7UA 3E3LA 2WLNA 1B15A 2BELA 5B12A 2HRUA 3TL6A 1P5HA 4ZDJA 4M99A 2PMDA 5IBPA 3JD3A 2BKXA 5LYJA 4OL0A 4G5FA 2JJ1G 2B92A 3TI9A 5H80A 1XBTA 2YMMA 3A2LA 4G41A 4HQFA 4XQ9A 1W59A 4PHZA 4BWYA 1CXZA 5MGNA 4Q1VA 4N3GA 1UI9A 2PIAA 5JZSA 2XAHA 3JD1A 1I4OA 1G5PA 3DUFA 4G4SP 3H4VA 4ME6A 2HK9A 3KLNA 3E22A 3HCNA 3K2XA 2EFEB 2LCAA 1E77A 1LQUA 2X8JA 1Y5MA 5DW3A 3T2MA 2UYQA 1FJXA 1LZLA 1UZMA 3N2IA 3T1VA 2E5LB 2O05A 4JAVA 2BBTA 3MJHA 4XDKA 2D1RA 4GSKA 3NDBB 3SZLA 1O5TA 1RJFA 3MAQA 3JZMA 1U1EA 1V9LA 5IDYA 1GY8A 4BNFA 3OWHA 2EX3A 4RYDA 1IY8A 3IERA 2IPNA 1S1MA 4EFLA 1I8TA 4A4DA 2F66C 2IWRA 2WJPA 1N6NA 4I99A 1NI5A 3ETJA 1KZ7B 1CR4A 1RBYA 2OV1A 3IGFA 1P18A 1N9GA 3EXHC 4XDGA 4K8ZA 3BVPA 1OFTA 2ZAUA 4DR1B 1COMA 5EWMB 5DXAA 4YT4A 2YIBD 4URHA 4I36A 2I6DA 1TDJA 3Q98A 3AUJB 3WTCA 2A5LA 4IBOA 1SQVH 3AOEC 4C7OB 4TYMA 4LMPA 3B09A 2CK3D 3PFHA 1J2YA 1QZUA 3ZD7A 1U3TA 1SU6A 3IBCA 4MS1B 1Q2XA 1UAAA 1I6LA 1E3JA 3C1OA 3SSNA 4UTOA 5LYJB 1TI7A 3D4PA 3H9VA 5TSDA 5JATA 1SKQA 4OVKA 3VYTC 2ID4A 3G2LA 1UOOA 1T2DA 3WGYA 4GWGA 5KX5A 1D8TA 2ZZKA 1HSZA 4IGFA 1F3OA 3QFRA 3SPCA 2J3KA 4IMIB 2ZUTA 1Q1BA 4LF8O 1C4WA 3DUFB 1WO8A 4CN9A 1OCZB 3ZJVA 3E22B 5FUVA 1S2OA 1TM1E 3DDHA 3DQZA 2W9XA 2NUTB 2I54A 1NMQA 2X8JB 2VHJA 4I8XA 2VJYA 4P58A 1YIJV 5TDHA 4RZHA 2ONZA 3LWVC 1YV9A 4MUFA 1SWVA 4G56A 3ZWOA 2COUA 2VDWA 1XPOA 3H1PA 5CW2A 3LT5A 4J0HA 3BREA 3J81k 4JT2A 1NVFA 1CULC 3A2FA 1KMMA 2KW5A 3CLTC 4MRVA 4Y1RA 4RJTA 2FMKA 4FJ1A 1PZHA 1EP2B 2Q3FA 1JAXA 1NQXA 1XI2A 3RVOA 3I09A 1XL6A 1N9GB 4TRNA 4HLNA 3CVYA 5FD8A 1BDBA 3FGOA 1H4SA 3PXCX 1H5UA 1X2BA 2B2NA 2JIOA 2W2OA 1BDIA 1NI3A 5HZKA 2IYQA 5ALPA 2GF0A 1V5EA 4CU5A 1GCGA 2VOEA 2EJRA 1L4BA 1VG8A 4JI4B 1A8HA 2XUHA 3N3AC 4J49A 1EA5A 2Q2NA 4M1QA 4JQCA 3IS3A 2VUUA 1T1RA 1JJ2F 1XQVA 2H92A 4JLSA 3DMTC 5CXQA 4MIKA 1VIAA 1Z0UA 3L8FA 3I2JA 4Q00A 5EHGA 4BIZA 3ZVMA 4CYMA 2Y6UA 1CLIA 1FP6A 3KOMA 3WK8A 3ZWYA 1VHTA 5JXHA 4TLDA 3II6X 2IE8A 4M0FA 5KX5B 3LP8A 3SGIA 2PRKA 2QX4A 4MR7A 1Y4DE 2Q0OC 1E96A 1XTSA 3W5BA 4AJ9A 3ME5A 2P2YA 3REGA 1Q5PA 1JSZA 1H6CA 2FF5A 1TM7E 3NS7A 3X0DA 5JH7A 3DOHA 5LP6A 4LJLA 2OLKA 1RC1A 3VO2A 2QD5A 3NKFA 1T5HX 4MARA 3A0BZ 3SQLA 1C7QA 3DMNA 3MT7A 3W6OA 1RWVA 1H3FA 2EDCA 2IOFK 3ZIDA 3FETA 3ZQUA 1O95C 1PLJA 5TGTA 4BC1A 2VDWB 1N36B 4IOMA 2VHXA 4C7VA 3C2QA 3FNHA 2NU6A 5CFLA 4DDVA 4WZAA 4ESEA 1QD9A 2EARA 1E18A 4Y1RB 3IB6A 4ZJYA 4OJQA 2ZBDA 3NHUA 3DQQA 3OT1A 3KD3A 2PE5A 4Z4QA 2QT9A 2ZRIA 3D6VA 3VQWA 3MERA 2YHUA 1E3DA 2WJHA 5LIPA 2YIBA 3V7FA 4LQLA 5KYUB 4WZAE 1MZPA 4AZTA 1TCCA 3B1YA 2HTEA 4N47A 3NRCA 4BWGA 3OEEG 4WXMA 2RB9A 3P2IA 2CK3A 2V3CC 4JTDB 2B1GA 4F21A 3ZGYA 1GGNA 1SVLA 3OE7A 4PEVA 3JQRA 3KLPX 3QPWA 2MMGA 1T8PA 2B69A 5I5GA 1DKQA 2PCJA 4MR7B 1MC5A 1SQPH 2Q5ZA 3STHA 3S2GA 2G38A 2ZATA 1VG9B 1FXKB 4PYLA 1W36B 1JBQA 1I0ZA 2ERXA 3AKZA 1CJVC 5JH7B 4PYIA 1GRNA 4FFKA 3AUKA 2FOIA 3JRWA 3ZS8C 3STZC 4XWOA 2YFKA 2LV8A 5I8ZA 2XAUA 3T80A 3ETHA 3LW8A 3U6BA 3AVVA 2Q27A 3LVBA 3G8BA 3E9QA 2BSAA 3MWJA 5FPRA 2WJAA 1GRRA 4BJHB 3I9NA 4E2LA 5DLPA 2Z57A 4JKYA 3LHKA 3TBHA 2YVKA 3OQMA 1RFLA 3KAJA 4HN9A 2NU6B 2ZXWC 1G9XA 5C4GB 3VTZA 2HA7A 4X84A 3VKHA 1X6VA 5FWDA 4I2NA 1P4AA 1RAEA 1UBNA 4KH0A 3C6MA 5DBIA 2AC4A 4FOSA 4PAOA 4AJ1A 1A8QA 3A1FA 1GLVA 2G71A 3KT8A 5IFLA 1W88B 3L0SA 2YJ5A 3UMBA 1L4HA 2QLNA 3DMRA 4R1PA 4D3SA 4CMIB 2W8BB 1TO2E 2FPWA 5DIZA 3I0ZA 2BFDB 2KB0A 3CCJF 1C3VA 4OM7A 5K20A 1PTJC 3IEQA 2DULA 4GYJA 4YLYA 1G7SA 4ZAFA 3N2NA 3NC0C 4JJ8A 1AKTA 4IQ0A 2O8BA 5G1OA 1SDSA 4BTLA 1JDUA 4BNUA 3IT1A 1H42A 1VL6A 2QROA 4PN3A 1SNYA 1QR6A 1DAMA 5JLJA 4AO7A 3RTDA 2EKQA 1YHQF 5A5DA 1R9NA 2UZ1A 2CEAA 4HFMA 3MD0A 4O8ZA 3QU2A 3SZUA 4ENWA 1W4RA 3D6TB 1AQ6A 4Q34A 3VPBA 3A6PC 1TMYA 3QUQA 4AX8A 4PYKA 2IJIA 3TZ6A 3CRZA 5AK3A 2PUEA 1GG5A 4R6XA 3SLKA 3PLAC 4KUMA 1RQ7A 3MCQA 4LFCO 3JX9A 3WGQA 5DASA 4MI3A 5KNDH 1HE4A 2IH4A 1AZTA 5BUQA 1OFUX 4BJ5A 3B82A 4RNCA 1SVKA 3ASNB 1GA4A 4KRGA 3FZQA 2GWRA 3GG9A 4L8FA 3VR4H 1NJ8A 2OYQA 1H85A 4D9HA 2NUBA 3BMQA 2G9RA 2WLIB 3BERA 5LP1A 3C4QA 3DPSA 4ZK7A 1AILA 2PUWA 3JW8A 2AXEA 3KB8A 5JCPA 4H35A 3TFQA 4M1KA 4QGBA 3ZWBA 2DFTA 3SJBA 1W75A 2GI4A 1MJNA 5T6BA 1E3WA 1TEVA 1QNLA 1UPBA 4QKQA 3GEHA 5GOTA 1C9EA 1F1BA 1FMJA 2ZE5A 5JCZA 1PDWA 4NU5A 4JUBA 3P0HA 3WDLA 5A6SB 3UPUA 4BEVA 1MAVA 4LS3A 3OAAG 3C8LA 4RD3A 5EB1B 2O8BB 3ZCVA 3H6KA 1OKKD 4N3AA 5J23A 2V9PA 1EBFA 2TRSB 5TGDA 3QFSA 4QUHA 1ZR4A 1NVGA 4WVFA 4HLUC 4LWZA 4ALKA 2O2YA 1DCTA 4RSMA 1S89A 2XTJA 1U5BB 1JN0A 4ZWNA 2ONJA 4NULA 2EILB 4GE3A 4MGYR 4A8PA 4JVNA 1EXNA 3I2IA 4M9CA 2GN8A 3KQUA 5KHKA 3EZ7A 1T6ZA 3HUEA 4BFCA 3O1HB 2FPGA 4YCBA 2CHEA 3QI7A 3CC4V 1HXHA 3WG9A 5L51A 1TKRA 4MW0A 2DTXA 1YBVA 4HDKA 5ECDA 2ADOA 4U7PB 5KYTA 2ATEA 1LB1B 4P3KA 1YJWF 3IVCA 1ZG3A 5B7GA 1XL4A 1LPSA 4YBZA 3FFWA 3ZBQA 3ZK8A 4CHTA 2AT1A 2FI1A 4M1SA 4Z7NB 3CLUC 4ZT4A 3PYXA 3B36A 1XEAA 2G17A 1ZMTA 4HNHA 3BMQB 1G6Q1 1DC5A 1QYIA 2DQYA 3GARA 1YS1X 4MYSA 3H6GA 3T1NA 3FUVA 3RUCA 2H7CA 3VPSA 4HZGA 4P4NA 4NE2A 4KLRA 1JU9A 2JGJA 4RGQA 5IFKA 4HLQB 1GCAA 4MV6A 4RGYA 4HR7A 3GJYA 4Q9NA 1E3WB 1RI5A 2FWNA 2AMLA 4EYKA 4P54A 3UENA 1CZHA 1A5ZA 4P0TA 1QJ4A 4PWTA 4CTJA 4JBGA 3GIDA 1PYOA 2RHHA 4KXUA 3LCVB 4I55F 5AOCA 3CC8A 1USKA 3SZOA 5HIKA 2CCKA 1OCOC 2CLCX 4E2XA 1WCV1 1T8TA 1KK3A 1FVOA 3DLTA 1DEHA 4JYMA 5A06A 1P7BA 3E1KA 1XCJA 4L02A 5G3YA 2VLIA 4EI2A 3LY5A 2WAXA 2JS7A 3RVYA 3I32A 4JITA 2G06A 3H2KA 3MWEA 3DDOA 2GYWA 2KS6A 4MUHA 3OCUA 2E3JA 4LOHA 3RYHA 2YWGA 2LCFA 2Q49A 3MXTA 4XSVA 3O93A 2ZIEA 2RBKA 3RQSA 4ZAZA 5FOQA 4GC5A 3GHHA 1JDTA 3EVFA 2CZCA 2QYHA 5K8JB 2Q5HA 1RNLA 1IVSA 1G1AA 3OM8A 5SICE 4UMFA 5HP7A 2PMEA 2W2TA 4L8WB 1YC5A 5KAMA 4RW0A 3C7CB 4WK4B 3AMVA 4NXMO 5DHFA 1SBYA 2QRGA 3L8EA 1RWOA 4ICIA 4UBNA 3FY4A 5JMOA 5BQOA 4AECA 1P77A 5ILQA 2OSBA 1T91A 4F92B 1RYZA 2UKDA 1Q82H 2YBEA 2WPNA 3B3GA 5IJ0A 2QXYA 2FCRA 4HRAA 4C4OA 3PUXA 2OKCA 4E03A 5C1IA 3TIVA 5JCOC 2OWOA 1TT7A 1CUWA 1YUMA 1CJTC 3ITDA 4GI3A 2R7AA 3EA5A 4ZVPA 2W2KA 4JLVA 1LGYA 3L8MA 1RMYA 1TZCA 1WA5A 5T5QA 3R3YA 3CLVA 3O4JA 1RP7A 5AVVA 1OKKA 3VU8A 2QDKA 3WL8A 2NADA 2AR9A 3L0DA 1A7AA 1BEEA 1NRXA 1UF9A 2X4IA 1L4KA 5CK4A 3GO4A 4NVPA 5FEUA 3CS3A 2QAGB 1FB5A 1H7MA 4JTAB 2X6CA 2B1IA 1E20A 4D6XA 4X3MA 4TMYA 2OFOA 4LZPA 3MWEB 2WWVD 4J7ZA 5A1JA 3RYHB 5GAJA 3MINA 1I94O 3VGJA 1ZEJA 1S9DA 3CX7A 1OH8A 2FX2A 4MEJA 1AN9A 3HC7A 4P83A 2VT2A 4J76A 1RVDA 4UEWA 3CPSA 3CY6A 5ADWA 2GZMA 2O5VA 4BU1A 3PFFA 1FSSA 2PU7A 2FJ0A 3FMVA 3IP6A 1U0BB 4ESVA 1GARA 2IH1C 4AAYA 1THZA 4DCCA 4NOMA 4RMIA 1G8MA 1CVIA 3STWA 4NF2A 3KTAA 2BHTA 5H5NA 3FTDA 3OA0A 3BA6A 1HA3A 5EY5B 1SVSA 2P91A 3EORA 3QO7A 2B21A 3F97A 4BLOA 1RACA 1QQBA 5ALYA 1JBEA 5C8YF 2GJ9A 2JKVA 1RQ2A 1UEIA 4EKNB 2ZSDA 3G6BA 1UJ4A 2CB0A 3SQDA 3LUAA 4EECA 3PB3A 3C6QA 1OCZC 3PHCA 1GM8A 3VUEA 3W6NA 1TPZA 3AG7A 1KYWA 4YCCA 4OHRA 1ISIA 2XDYA 1TU4A 1FMTA 5D6OA 3JQGB 2VIIA 4HEA1 5DGDA 3UWDA 2QTCA 3C48A 5GAPK 3RWRD 4D9CA 3L4JA 3IAM1 4ZI2A 1I6WA 5TXGA 1ZD4A 4YR7A 4NCBA 5C8DA 1O8CA 4LZLA 5DF1A 5JASA 3HKCA 1S5JA 2MWMA 5DX1A 3D36C 1OILA 4HY3A 2CW4A 5K4GA 2R87A 1EFRG 4DBVO 3K03A 3BXPA 3QM1A 1JWLA 2J0UB 1ZL0A 4E46A 1C9MA 1V7CA 3MDOA 1PTKA 2ZIXA 3Q7SA 3BILA 3GPBA 2IW3A 1AKYA 1QCZA 1AI6A 5L6LB 4XGIA 4PO1A 3G2IA 4DLNA 2ANCA 3OU6A 1P1RA 5FA8A 3S8YA 2XY4A 2IU4A 4S3MA 4G0OA 4P98A 3DKKA 5HY0A 2P9YA 3H4TA 2Q3HA 4PHHA 3KDSE 3GWKC 1A2KC 1QRSA 3T06B 2Q0QA 1DI0A 4X6LA 1GZ0A 3EAQA 2YW2A 1OE0A 4J91A 2GNPA 1PGJA 4EG5A 1U4NA 2CBXA 3HB9A 2WTAA 2OO5A 3TN7A 1U1CA 1UEJA 3WA6A 4HB3A 3VC7A 1GGVA 3CLTD 1ZVKA 3MDSA 1BQEA 3LVQE 1NI4A 3QPVA 4BVTA 1Q3HA 1GKUB 3LHSA 3P9NA 4A2PA 2HQOA 1FNKA 2JKYA 4PPQA 1A1SA 3A1CA 4L3OA 5FDFA 3D2AA 2KTUA 5AW4A 4KAFA 1NMZA 5EA2A 2GETA 4RK1A 4KL8S 4EK9A 4J75A 2RGYA 1R15A 4F86A 2FAXA 1EWQA 4CMCA 2OGZA 2ZPUA 2JC3A 5B30A 4Z3OA 3RS2A 5AICA 2Q6VA 5L3VA 2R0QC 3R3WA 3FKSG 3EDRA 2YZ7A 1T8SA 4N21A 3VSCA 3V34A 2WJ6A 3INGA 3O4HA 2YJ3A 2OENG 5JHGB 2GAJA 9ABPA 2C9YA 4RXTA 4IHKA 1O87A 2PYZA 2YUTA 4KN5A 4ZTBA 1QP4A 3CC2F 4D4GA 2ZBFA 3K7EA 1UCFA 4WI1A 4E5PA 5EEGA 3NBZC 3AG3C 3WLFA 4NQRA 2P3OA 2NMUA 3PDHA 2XE7A 2P4SA 1P7VA 1ORIA 1ONBA 2BM9A 5CLQA 1CEYA 3T4DA 4TYPA 5AOBA 3HWWA 3RAEC 1E0DA 2BUCA 3DE0X 5TR9A 1MT3A 1R0LA 4YQYA 4JB0A 3LDDA 3AFGA 5IYBO 2FB5A 2AEFA 1SC1A 2HV8A 2ZBRA 2WJZB 2K5UA 1YJNF 1EJ2A 1FXKC 3N87A 1W36C 5CD9A 4QNRA 2N04A 2WB2A 1O95D 1MEEA 3CVOA 3CZCA 3I2YX 4GKKO 3AYZB 3G02A 2VWJA 1X74A 2EKDA 4E31A 1BKSB 3EHDA 5ER6A 4UCWA 4N0QA 1NI4B 4B6JA 1GDHA 4I4CA 3N2ZB 5G3ZA 5KNLA 3ZDRA 5J9PC 1M6WA 3H2HA 4GGPA 4B6SA 2P77A 3MTQA 4RTOA 3FTCA 3VX4A 1NH2D 1YL7A 2FZEA 3EXHA 3P8ZA 3HRKA 2JFGA 3JYPA 2VG8A 1HOTA 4ZIBA 4BNNA 5CYOA 1IBRA 3X2QC 1N2BA 2GM4A 5B7PA 3GJRA 3FGZA 1RMQA 2VK8A 2NZJA 3EIFA 2AXNA 5AKKA 2VDPB 4HDMB 1NURA 3KQSA 1TJ5A 3AOEA 3U44B 1KR2A 3DMYA 3IBYA 4OFWA 2Q0XA 1U3WA 1C5KA 3FCUB 3R65A 1NPTO 4DR4B 1BCCH 2W8BC 3GMTA 4EHBA 5T6MA 3M83A 3C43A 2XCLA 4Y0NA 3H2BA 3HPLC 4JP5A 2H1RA 4MW6A 1YRQA 2ZUBA 4NMXB 4H4CA 3DOUA 1MA0A 4PQRA 3K1YA 1U3CA 3D8RA 4IIXA 1U7ZA 2P6NA 2ORWA 1Z2GA 2ZR0A 1I1OA 4ZQHA 4ZO4A 2ODEA 4U7NA 3EGCA 4RM2A 3P7MA 3OJCA 1M1NB 3BHPA 3ML0A 1P9OA 4E7PA 1TQ4A 2Z4SA 1T8UA 2BEWA 5CT8A 2V7PA 1MJGM 4IQ4A 4NICA 4PR3A 4ENRA 4QO8A 3PGKA 4BMPB 4O4HF 2N75A 2VSQA 3RYFA 1L7XA 4QULA 4Z9FA 3U3MA 1D2RA 3TCNA 1H6DA 3O21A 2WU4A 1PJRA 1KQSF 3O2QB 3UHAA 2GEDA 3GFGA 2OQIA 3DEAA 2VPIA 1GZ4A 3KK0A 1VF7A 1E7MA 3KQQA 4UVHA 3STTA 5KOHA 3T1YB 4KE9A 1HEIA 5JOQA 1FC0A 1TGVA 2QN3A 5DK4A 1VHWA 2VPTA 4YUXA 4Q3KA 4WAUA 3AF3A 3M9XA 3ISVA 1CY7A 2CLSA 5BORA 2OBNA 3WGZA 1U6IA 3CQ9A 3L7OA 1BH2A 2PS3A 2AN1A 2QWRB 1DIHA 3DL7A 3CUWA 5FTJA 1NE2A 3RVZA 4KCGA 3GUZA 5IP5A 2A59A 3PX7A 3DMTA 1H2KA 3DZGA 3N0RA 2XF2A 4YHHB 4QTYA 3CM0A 4XA8A 4DQUA 3VYTB 2PNFA 4HNRA 1FX1A 2XPCA 4U3FH 3QBVA 1CRLA 4GNRA 5F9MA 2I6XA 3A4YA 2XUIA 1YZHA 1KARA 1OHHD 4V38A 3O0TA 4ZGBA 3DL4A 2J6HA 1EFVA 4J90A 1Y1SA 2PG3A 4FWBA 3D81A 5JPIA 3IDOA 3AQIA 3FOAA 3LO8A 4XX1A 3KKYA 2EILC 3RNOA 4KP4A 3EGEA 4MTCA 4B34A 4TSFD 3ABRB 2O2HA 3TQHA 2NN3C 2APJA 4D4HA 2BEWB 1U9CA 1ULBA 3UOWA 3MB8A 4W1SA 4I4TA 3RYFB 1O95A 3OPXA 5FJ4C 2WUGA 5HIJA 3SI7A 5EVCA 4QASA 2IYFA 1K8YB 3TPZA 2PUFA 5TQ2A 5AW9A 5AIBA 1EK6A 1QIKA 4I3HA 3HFRA 5F3WB 4YFVA 2Z2YA 3B5JA 1MNGA 5KOHB 1JEYA 2FMFA 3LL4A 4QHTA 1I24A 2HW8A 3SSOA 5AVOA 1Q19A 3R09A 2JA1A 3IELA 2IXAA 2YQZA 4R83A 3D0RA 4HGQA 4BUCA 3LC7O 3W2TA 3O3OB 3KZMA 2ZYUX 5EZYF 3V4VB 1QHGA 5JAUA 2DH5A 5K9ZA 4TQ9A 2OZKA 3CC7F 3BYQA 5JU6A 3EGWA 3MBMA 1NZ6A 1HMYA 3VQTA 1VQ4F 3UB3A 2QWQB 3IP8A 4RZ2A 1W73A 2C1XA 4O2LA 1B93A 1W6UA 1RLIA 1JDSA 5IWCA 1R74A 4DCNA 1G4UR 4PG8A 2ZSKA 5IU6A 3CW9A 1W57A 4AJ2A 4YJHB 4ONEA 4DW8A 4BXOA 5IG2A 4MQ6A 1ZXBA 4AZVA 3B6NA 1XF9A 3ZS8A 5KTNA 4MTFA 3GLKA 4IV0A 1E2IA 10MHA 2PJZA 5EESA 2JEZA 2AN5A 1RKXA 2JJ2D 5TV2A 4GOLD 4MW4A 3CLUD 5H68A 3NETA 4D9NA 2FNAA 2J4DA 5IVDA 4I4TB 3ND8A 4BS9A 4DUZO 1EINA 2QSZA 4UXJA 1G1MA 4LSWA 3KEGA 2JFFA 2TMKA 5TQ2B 3HQ4O 1C50A 3ZK9A 4JI6B 1V11A 4XYBA 1DJNA 4Q3NA 2J3HA 4EGAA 4TRJA 2DPYA 2ZIFA 6Q21A 2WLHA 4DMGA 3RGBA 1PJCA 1W25A 4M0MA 4MRNA 5BQ3A 4FGSA 4CH3A 2PVPA 2GYYA 4TLCA 4CNQA 1Y7LA 2FFAA 1VJ5A 2EOAA 1XMXA 3WGKA 4BBZA 4K0KB 3AKYA 1QORA 1Y8RA 4D5EA 4HNSA 4IEFB 5KTPA 3NBAA 1OH5A 2EFJA 2Y1WA 2DYSB 1DIOB 3UGJA 3BRWD 2JJYA 1PTJA 4EDHA 4D4JA 3KIZA 3RWMB 3WK5A 5CFRA 4HX5A 3TD2A 2ZT6A 2GSDA 1T3LA 3UJ7A 2XA9A 4JYPA 4G4VA 2P06A 1E7YA 1LNSA 5FADA 3MSCA 2O8FB 4Q4HB 3AFIA 1THGA 5G0VA 3KCQA 1YJXA 1USUA 3GH1A 3C9TA 3DS8A 2E6KA 3W3ZB 4TZ0A 1OHHA 1E1CA 1D1QA 3VCZA 3LG2A 5EHZA 4FHGA 3OPMA 2HS0A 1S8OA 3JQEA 1UBEA 4EUFA 2FEKA 4P34A 4CEHB 4OQPA 1G3IA 1M1YA 4X85A 5JAOA 2QAGC 2WA2A 1JTEA 2IF2A 4L5JA 3X1JA 4RHEA 4TSFA 5KA6A 1JEQB 4DKJA 2J9XB 5CYGA 5LZ9A 1FBTA 1PEAA 2YV3A 5H4GA 4UMDA 2ZXWB 5EIBC 2Q7XA 3KWJA 3SPXA 1V11B 3IKFA 3J80A 3CNOA 3KFVA 3PLAE 3EX7C 1WAZA 1QCCA 3FYSA 3T1HO 3IODA 3IEXA 3AR9A 1H94A 4Q66C 3OE4A 5FLKA 1PLKA 1FTWA 5A0FA 2BHRA 1G8KA 4N41A 3HKEB 4E5YA 3SF0A 5EIFA 4HPXB 3UC5A 4NJOA 5DYNA 1OYWA 4GL4A 3QYPA 3K6SA 3CZQA 4UXHA 4JYAO 1S8NA 4CKEA 3W5SA 4Q02A 1GTMA 3GHZA 5CB4F 4DHWA 3M6MD 2X9VA 1JMKC 4HLUA 1G8FA 3R5SA 4M9XA 1G7TA 5EMHA 2M6KA 2ZANA 2OHGA 3ICCA 3BFXA 4BNXA 2BE9A 2QTWB 1A27A 3GL9A 3FB4A 5ILGA 1JVNA 2CLDX 5F33A 4QZVA 1FMCA 2B1JA 5BNIA 3UICA 4NYIR 2XIJA 3HBLA 1MA1A 1M1YB 4EGJA 1A4UA 2EJTA 4V02A 2QRPA 4WLEA 2YWRA 3KL4A 4R1SA 4QU8A 4UTPA 1QHSA 2JJ2A 1BH6A 1C80A 2XQJA 2WHXA 2H06A 3M2TA 3D4OA 3BY6A 1FY2A 3BXEA 3LUFA 2WIGA 1PJ2A 1WBBA 3DTVD 5A4AA 4FUQA 3Q3EA 3LK7A 2UYGA 3RVLA 3WK6A 2ODBA 5HTKA 4IVNA 1ILEA 2IYXA 1LPPA 4EQ6A 2JLUA 2Y3IA 3HE3A 4R8KA 6ABPA 1FK8A 5ALKA 4YIHA 4DSNA 2EINC 3ZE2B 2GTPA 3SWWA 3PXDA 1IY9A 2GEVA 1H6AA 1YDMA 1XHEA 4WKBA 2FW7A 3ACDA 3O65A 4HOYA 1YHZA 2RHRA 2Q8NA 5ITWA 4UD6A 1G6KA 2GBPA 3BRWA 4D25A 2FFBA 3AY0A 2RJOA 3IAEA 2YZGA 1P0CA 3A6DA 4CMHA 5B2EA 3K6SB 2P62A 4CKEB 3HGTA 4A0HA 3EGXB 3J81M 2XQGA 3T5BA 3P2MA 5BWNA 5J2TF 4OP3A 1X7WA 3HZOA 3UTCA 4W4KA 4WGGA 4UFZA 4JI2B 3W79A 1OIVA 5JRZA 2WHYA 1WN7A 4X3CA 2OP1A 4AT1A 3WB9A 5CBHA 3EMVA 4UMVA 3EVGA 4M6WA 3T3HA 3NHWA 4HYEA 5D3KA 1VQ7F 1CQJA 2Z9DA 5K03A 1C7ZA 4EJ0A 3HCDA 2VNKA 4F9FA 4Q7LA 4YY3O 2DUUA 3SCZA 4NAUA 3R5HA 4LHVA 4LHWA 3LRTA 2LFRA 1XILA 1WCIB 2IOFA 3PDJA 1QZXA 3DAGA 5HP4A 3TK1A 5CHYA 3WLLA 3FFMA 1GP2A 3KPJA 1IN8A 2R1VA 1YB1A 4Q03A 3H2IA 1JI3A 1GPYA 4MWDA 2Z3WA 1NYQA 4YHBA 4PDMA 5E1MA 3ODPA 1T9BA 1K5PA 4EQ6B 1L5KA 4FQ5A 1R6VA 3ZZTA 4GOMD 2UU9O 4MYHA 4AXXA 1KAMA 5CT5A 4YUZA 1TA0A 3KHKA 2C4HA 3BAZA 4IDDA 5JCOA 4ROTA 2OCKA 2ZNIA 3CUVA 2PIDA 1V9CA 1P91A 1T9AA 5C0OE 2PUCA 5IBQA 5KTRA 1H66A 2Q3DA 1GU1A 1OCOB 3EEOA 1UBCA 5FNVA 2XBMA 1Q6IA 4NZOA 1NSYA 5KHIA 4J2OA 1X7WB 3DZDA 2CVOA 1E94E 3UUWA 4HB0A 4LNHA 2QE7G 1VE6A 4KN8A 2ADQB 4UPVA 4FBGA 4ZDIA 1WQ4A 2Y93A 1MTOA 1WXHA 2ZWAA 2Q5IA 2OBBA 2J5RA 4CM7A 3VYVA 3D8NA 4Z4HA 2V9ZA 5FLXM 1HKHA 3V2UA 1GUAA 2IPAB 2Q2VA 2WF9A 1UK7A 3TXYA 2JS3A 1Y5RA 3H7IA 5EK0A 4EPXA 5EWMA 4D4KA 3AJ9A 4I08A 3BHJA 3HNPA 2B3DA 2CLOB 3F5FA 4JBWA 2IHZA 4MX8A 1TF2A 3RC8A 2IP4A 1U7XA 4DBLC 5JMPA 2JH3A 3TNLA 3DTVA 1QTRA 4ML3A 4MS1A 2R1VB 2X1VA 2ZQMA 4RVGA 1HY3A 3N8GA 2CVZA 2P2LA 1U5AA 3DA8A 4QOEA 4HNTA 1CPYA 2JIDA 1OX5A 3VSBA 5L6MB 3RVSA 5CYPA 3PKJA 1DXQA 5COAA 1QHTA 1W36D 3RRFA 2GOYA 2YWCA 1VFNA 2VRZA 5GZ6A 4IP0A 2BTQB 1Z4LA 3UUFA 3T0IA 1KRHA 3R3VA 4AQYO 5CBFA 2VL7A 3B5IA 2NUTA 2VZ8A 1BROA 2ATXA 2NUAA 1H2WA 2R25B 2C3PA 5LBUA 3QV1A 1GKLA 2J3EA 1MVNA 3K0HA 3QWIA 2ID7A 3GWGA 2HK7A 4B85A 4KQ2A 1QOPB 5FNVB 5IC6A 2O2DA 2CL6X 2Q5QA 3CG0A 1U40A 5FQOA 3SHVA 2OM2A 4LF9O 4Y9DA 2DUWA 1V5FA 3K70B 1E64A 3G6EV 3GDHA 2XH8A 3D36A 4PC6A 2HKOA 3ZEDA 4QPKA 1UOPA 2AGAA 1HNWB 1M76A 2FYTA 2J9FA 2RKBA 1B04A 3PGLA 2FLKA 4U7TB 2XQKA 5TMDA 3JAMM 2OOKA 3O4GA 1ONIA 3KVNA 5K8UA 1XVAA 4JOQA 5HDQA 3RE1A 2OCBA 5EHQA 1H5QA 4EMBA 2OQVA 1VG1A 1PV0A 1VJGA 2HVJC 2H54A 2Y48A 3QNWA 4YRIA 3DTVB 3QMPA 1MQ8B 3K8OE 3KKOA 1DARA 5B4UA 5BWLA 2FWBA 2GDJA 2VRCD 4BZWA 7GPBA 4MQFB 4JUAA 4QDOA 2VZ9A 2J9ZB 3K31A 1KQSU 1L5SA 1KR5A 3U0BA 1G59A 2P8JA 3MWKA 1ZN9A 3QHAA 4QHYA 4IRMA 1AB3A 4LHSA 4AJNA 3U3XA 1Z6QA 2ZJ7A 3ESCA 1J00A 1KVTA 4WEOA 3FDIA 1CUHA 2ERCA 5L9AA 2NUAB 3OM0A 2GZDA 4HFJA 3GR6A 3SJQC 3FLMA 4OOFA 2ZYDA 3UGTA 1PE0A 1IM8A 5KZMB 2MSWA 4MVXA 3VXKA 3FH0A 3T1CA 4WKGA 2Q8VA 4H08A 2ZUVA 3GEEA 1KMNA 1L7DA 4DCJA 4WRRA 3VOAA 3KZNA 4ZQGA 2YIVX 3PUIA 3NDJA 3C39A 3BRSA 4NIMA 3OZXA 1HNZB 2R00C 3HYTA 2OWEA 1MZEA 2O2IA 4B7ZA 3ZE1B 2J9FB 2EZOA 1ZNQO 1YI8A 1XREA 1K1EA 3G0GA 1SUCA 3L0ZA 2HO5A 5JQGB 3DVSX 4NV0A 4L87A 2X5JO 3AC0A 3PKZA 5KYUA 3R9KA 1BZYA 4XBFA 4P3OA 2QQEA 4B87A 1TAQA 2CLLB 2FWMX 4MVJD 4F4LA 3BD6A 1H2XA 1XNRO 3EVEA 3Q5DA 1E0JA 4AJIA 1KI6B 4RF5A 3H8WA 1K6MA 5IWAB 4HD8A 5LNK6 3OMAB 1XZNA 2HWWA 2B83A 4NZNA 1TL7C 1FXWF 1EIWA 5K0GA 2BFOA 1BE0A 5HWSA 3CONA 3KQMA 4Z7JA 4NESA 4JENA 4R2XA 5IAKA 1G8SA 2PNJA 3QJYA 2WC1A 5KQRA 1KP2A 1II8A 3BHNA 1FXKA 1TJNA 4QVGA 2AZTA 1GU0A 1TPYA 2HB6A 1XTJA 3N8NA 3SHFA 3C3EA 4CIVA 1P2GA 2CXXA 1YA8A 2FVXA 4U8GA 3RUFA 4A2QA 4AKIA 5JWRA 3SQXA 3H2JA 5A4IS 4YR9A 4C7UA 2EJ7A 3TGLA 3ZHSA 3EQ7A 3L05A 3T3IA 4D0LB 4QNNA 3R75A 3K9CA 1NBWB 1FL9A 1RCFA 2ZI5A 3SR4A 1CF9A 1XMPA 3DZFA 4Y1GA 3OETA 4GBMA 1LWOA 2CHQA 1IK4A 4OQNA 3IUBA 3KQPA 1AJPA 5HRCA 1N2ZA 1CK2A 4BOYA 3RRJA 1WUKS 2DWUA 3LKDA 3MQ2A 4L5YA 2QYOA 3D3EA 4TXMA 2QMZA 1OOEA 4FMCB 1KQNA 1K3FA 2R5FA 2V9YA 1W88A 1PNLA 3SC6A 1G8HA 2FX5A 3TDMA 1GU7A 3PE4A 2A33A 3RD5A 4RV5A 4CMIA 2W8BA 2ZSIA 5JC1A 2WKQA 2DYSC 2V59A 2BFDA 2ZWPA 1EFHA 4RZUA 2OEPA 1KK1A 4GOKA 2OGSA 2PXCA 1AQJA 1CY8A 5ALNA 3AG3B 1KKDA 3V6MA 2BV3A 3BICA 3OUFA 4OG2A 4G9GA 2DERA 1P2TA 4BO7A 3PHHA 2MSDB 3AGPA 1SOAA 1U8YA 1BS1A 3DR3A 2Y2UA 2XASA 3ID6C 1AK1A 1P4HA 5ENVA 4FDTA 1JJBA 2VRCA 5IW8A 4ZCQA 3TUIC 2VPXA 3ROMA 3CRQA 2ITDC 4JT9A 1II8B 4AJPA 3RS5A 4DUGD 2YWFA 3A6HA 4JJIA 3VH3A 4I6EA 4MP6A 4BEJA 3IVGA 1O0SA 3BEHA 1NG9A 1Q22A 3TNYA 3EZLA 1APBA 1FQWA 3LC1O 1J9GA 1K9MW 3TDNA 2QUBA 5YASA 2VEDA 2HZ7A 1M57C 1WW3A 2RGEA 1O4VA 5T4BA 3M8AA 3FBAA 3GEBA 4CKXA 1MZFA 1XU4A 3K4HA 3NMUC 3EVDA 2BYTA 1M2EA 4K1LA 4TXNA 4XVUA 3OY7A 4OP2A 2VDMB 1XN1A 1VECA 3QA9A 3CO5A 1CVRA 3X2QB 2P0YA 2VTEA 2WLIA 3IR5A 5KQMA 1RADA 3AK3A 3T3NA 1YI0A 1E79D 4DTIA 1J2EA 3KHNA 1QZZA 2PUJA 1RP3B 4WJKB 4C0HA 1E2MA 4YRPA 2YYSA 3ZLTA 2XCSB 1DUIA 3P9YA 3H1LH 4FJ2A 4F4FA 4I0WB 5FBZA 4JC8A 4EL0A 1K8AH 5J4LA 2C2HA 4JVLA 5TS2A 3FPLA 4FOOA 2E87A 4JI0B 4YMTA 1KY3A 4UCFA 1TZJA 4DC1A 4L8GA 5A6SA 3FN4A 4R2WA 2Y69C 2IEYA 1G3UA 4MQMA 2EEPA 4Y2YA 5CB8A 4MVJA 5DN9A 3IQGX 3QGMA 3MD9A 3B78A 2ACEA 3COPA 2WWWA 1QR8A 3TZQA 2PQMA 3QTCA 4X41A 9ATCA 1CLUA 4IXNA 1ADGA 2CGOA 5AJWA 1U5BA 5BURA 2AYZA 1EZZA 2JEUA 2AZ2A 5I4BA 2OM6A 3MT8A 1DQRA 1U4OA 3BXGA 4KK4A 1ZIXA 1U0LA 4FDLA 2I7XA 3C5EA 3WK4A 2DE0X 4PI0A 4M0DA 2GZ2A 3ZD9A 2H2FA 1AHPA 4HMPA 5HS6A 3GMDA 1BFUA 4MVJE 3V00A 5C35A 4PJ0Z 2E5WA 4B7CA 3AWDA 3VI6A 3HNRA 5EIBD 5LL6P 4NJMA 3AERA 1KPHA 5FAKA 2VP9A 4UULA 2EATA 5AM2A 3OQIA 5DYTA 3JZFA 4BQEA 3RVDA 1L3BA 4MA0A 2ZREA 5JY6A 1UWLA 4X94A 3K1TA 3AHHA 1RR6A 3UMSA 3UZUA 4D57A 4XOUA 2ZIWB 1T0IA 3V1TC 4E5SA 3GFSA 1RM5A 1C14A 2XW6A 2A94A 5LOVA 4AW9A 3TD5A 4BLVA 2V6GA 4ZK6A 2JANA 3ONEA 5DVZA 3UKMA 3EWSA 4JI8B 2ZYHA 2VPZA 4NZZA 5H0IA 3E7DA 3TW4A 2FLVA 4Q19A 3VNRA 5LQNA 5JCXA 3ON5A 4F6EA 2XDWA 4EPTA 3P0FA 3FLBA 4YXFA 3S2FA 2X8LA 3OF2A 2H65A 3B70A 2BT4A 1BHO1 4BVJA 2BJWA 3Q7EA 5EKUA 2XXAB 1ZUNA 3S0YA 3UMCA 1RQXA 4ID3A 3MHHC 2G8NA 1HETA 3MWLA 5KO2A 2QAJA 3OBBA 2A0FA 5AW2A 4XPIB 1YIAA 3X1DA 2AG6A 2ZDIC 2P4KA 1JMYA 4Y3UA 5IE9A 1ZCAA 1ATZA 2E4WA 1ZNYA 3VBCA 3EPJA 4TWZA 3RVQA 3HJGA 3O4IA 4DUGA 3KQNA 3AKEA 3R6DA 4TPKA 4FHZA 3TOXA 3T3MB 4ZAWA 2PL5A 4KITB 1XP5A 3LH5A 4NJMB 3AERB 5EP2A 5HJ2A 1P5RA 5F2OA 3U4CA 5CW1A 2JARA 3OQIB 1Q7RA 4L0CA 1KFCB 1MABA 1MB2A 2F6RA 3I1IA 3NBMA 1HFWA 2EZTA 3OOJA 4PQEA 2B2XA 3RW0A 1F48A 1HX7A 4PSKA 4O2BF 1BS9A 1Q1ZA 2V8OA 3GJTA 4MYDA 3UUGA 4EG7A 4UXIA 3Q9LA 3E82A 3TQIA 1W2HA 4E15A 2G08A 4MRMA 3V2IA 3JALA 4BFXA 4IXWA 1XD2B 1Z15A 2ZJ4A 3RDPA 2BP7B 1VE7A 1L0BA 3BHMA 3T3DA 1E79A 5LOVB 1PUJA 2B78A 3VYUB 1YJ9V 1L8XA 1WW2A 1R0YA 2POCA 3EGOA 3SX2A 4N5DA 1ROPA 1HG0A 4Q24A 4FHCA 2QJOA 4D8VA 1LTQA 1Y4AE 4CU2A 3UV6A 4RORA 4IYJA 2HLDG 3LWQC 4U9HS 4FD2A 4GRAA 1IWPB 1S6YA 3BF8A 2QWPB 1YFJA 1KL7A 4ZEVA 3K5HA 3RIHA 1RCTE 4FE7A 1H2HA 3GRRA 4H7FA 3KPUA 4UNQA 1ZUNB 2ZSEA 1BHSA 3QYAA 2EW1A 4YAWA 3Q7QA 5CB6A 2YL2A 1N2OA 2BMAA 3QUCA 1ZYUA 2HEGA 3WX0A 4TL7A 1WVGA 2XUPA 4TQUS 2IXGA 1Q7YH 2BTEA 2IS4A 4MUIA 5CA1A 2YRFA 3DULA 2ZVYA 4FEEA 2ZSUA 1AS0A 5LMNB 5DEOA 3RIYA 5BPFA 3V2GA 4IXDA 1ORRA 2QAGA 3CEAA 1DKNA 4DV6B 3NYIA 3UB2A 3FYDA 3C5HA 2R8OA 1U9ZA 2IOHA 2Q4BA 3EWIA 5BSFA 3CURA 1J5PA 2WKRA 1KBHA 5E95A 1A04A 1QP8A 4IFTA 1IN4A 5CMLA 2XNHA 1VJCA 1YQ9A 1NXOA 2O0KA 2VGNA 1NOIA 2D1QA 5IC4A 5EBWC 3AVXA 4OPMA 4K9SA 1D4FA 4JD5A 1MABB 3TL3A 3TSZA 3EOAI 3O8DA 3AK4A 3N3BC 1YONA 1FP4A 3LWDA 2YOHA 2C8JA 1YZLA 3LQFA 4MRMB 3JALB 3BE8A 1OU4A 4OGWA 2DAPA 1BVHA 4DMHA 2ES4A 4UEKA 5BW5A 1AUVA 5TLSA 1R3IC 1XT6A 4LGCA 4R1QA 4N40A 4ZEMA 3TLKA 5HUQA 3RBXA 4F11A 2TMYA 1A5TA 4LFBO 1S7CA 3NIGB 2WWTA 4A2WA 3QXHA 3I58A 3JQFC 4DADA 2HK6A 2N48A 1AU9A 3DOIA 3TLEA 3S27A 3PNPA 3RTAA 2QQGA 4A5UB 3GLHA 3AHEA 4GMGA 2ETNA 1KIFA 4EG8A 3I6IA 1MVOA 3JQGA 3Q1KA 4EW1A 2F67A 3FOBA 2XYRA 3EVNA 2QTAA 1GTOA 1MVLA 2CSLA 4BT4A 3QJGA 5CA1B 1Z6TA 4JYZA 4C14A 4UBJA 4F4IA 2XNCA 4A0QA 1U63A 3AVPA 1CZNA 3O8NA 2JAHA 3K70C 2FPKA 5LXTF 3T9DA 2B25A 5SY6A 4EJ6A 5H70A 3NVKE 1YA6A 4OLFA 1ISGA 5GQSA 1F8UA 2RHDA 2O1SA 4W5JA 3FPBA 3AW9A 3F7VC 3VHLB 4PPNA 1QGAA 3PXXA 5J40A 4EYGA 1JLSA 2J0UA 5EKDA 1T6NA 3PYMA 4X1IB 3NHMA 5CEFA 3ROQA 1W6RA 1C3OA 1QU9A 2PGJA 4FMTA 4RYLA 1V47A 2QZZA 2N46A 3PC8C 1DCMA 2PK3A 4ND8A 2YIAA 1A88A 1FP4B 2IYOA 5EP4A 4GPZA 2WV7A 2FRVA 4BX3A 5AJUA 5MN5A 3W4IA 2IHUA 4FBLA 3NDIA 2GEKA 3WGUA 3AVQA 2B5VA 5FT9A 4PA6A 1I2CA 4DWWA 3D5EA 3RIMA 4FFVA 3N2KA 3C45A 1MO2A 3ADOA 1DMRA 3QTYA 1I9CA 2ZDHA 3L70H 4MUGA 1A2BA 2Q0AA 4RF4A 1VBKA 2C0PA 3L04A 3HCEA 3ULKA 4O4LA 2MT9A 2GO7A 5BVGA 4L3WA 4DG5A 1JAZA 1KJIA 4MAFA 1UJBA 4N3BA 2QPLA 3GLHB 1PV1A 3E8HA 4B17A 3AI1A 4BLUA 2OILA 1QQ5A 2D1FA 3BTUA 1R73A 1O03A 1E2FA 3CGGA 1DHRA 3VOTA 2XWJI 1GPH1 2B4TO 2QN6A 3F5SA 3S7ZA 1NUUA 2R6R1 5JQWA 1U3UA 5DRTA 3ZE7A 5EQFA 1AVTA 3IVXA 1VKOA 3UV7A 3B1KA 3MEQA 1K66A 2VTDA 2R7LA 5EL0A 5LIRA 3O8LA 4O0LA 1GPAA 4KVGA 1HKUA 2GN2A 4NFSA 2PUGA 4AY5A 3CVJA 4R41A 5LQMA 2VAPA 2BMVA 1G5HA 3GA5A 3OLQA 4AMZA 3JWEA 2Y67A 4IOLA 3O73A 4AQ7A 2K1EA 3I61A 3HP4A 5L3RA 2O1XA 5LUBA 2CJYA 1LW6E 2OMEA 5BQ5A 4BDSA 3WDKA 5LYYA 2ATVA 1C3OB 1A5AB 3PEUA 2VVTA 4D4MA 3GD5A 5D84A 4LJAA 1SGWA 4ND8B 2AEJA 3OLXA 4Y2VA 2E48A 4KX5A 2EWVA 3T38A 2EINB 5JXJA 1ECPA 4PX5A 1L5FA 4DV1B 1IJEA 2BEVA 2DEUA 3V8NA 1MOZA 1J1ZA 1XJQA 2RDCA 3QXSA 5BWMA 1X1SA 3N2KB 1VCNA 1QRRA 2I03A 1AGPA 2BFAA 3Q3IA 3BL6A 3ADPA 3W5JA 2Z1TA 3EFBA 4HXEB 4X1OA 3DNMA 4O4LB 1TM4E 3P96A 4JK3A 1IY2A 1DAFA 4QU5A 5BVGB 4M36A 1SVNA 2VBIA 5J58A 2Q28A 3EZ6A 1XQ9A 2QM4A 2VATA 3UYKA 2CBGA 5CHEA 2BUBA 2DUJA 1PWYE 3P3NA 1J2RA 1VMGA 3NWBA 4D4IA 2O50A 1X59A 3FKQA 1XLWA 3OTIA 4NV3A 1NPYA 4KAAA 1WPGA 3KQHA 4LDPA 3C90A 1JPXA 4IHQA 1VIDA 4PFJA 3P9SA 2F8MA 1XROA 5K3BA 5BSEA 3HYLA 1QIFA 4ZT3A 4IMJB 3TZBA 5AI8A 4CF7A 1KZ9A 2PXXA 1TW2A 4LZJA 3KCNA 5BSRA 1VF5B 2KBFA 4TV9B 1WD5A 2I5PO 2I4OA 1DTEA 1JWAB 1N6KA 4RK0A 2C5FA 4FVMA 4HDMA 3U44A 4O1IA 2EIXA 2Q6LA 1XBIA 1EVQA 4BLWA 5JJ5A 1SIUA 4XXHA 4N7BA 4C5AA 4F84A 3IRUA 4DUYB 4TTJA 3GLRA 3WLKX 1K5DA 2XI4A 3T99A 3RWBA 4YRJA 1E2DA 2RARA 3WOHA 3L4KA 2CMGA 2R62A 1VQ6V 2XB2A 1BT8A 1A5SB 4MKZA 5NULA 4TX1A 4KAXA 2E49A 4DBLE 4GQIA 2BEVB 3DHNA 1NR5A 1M2OA 1NUHA 1CG6A 5AKZA 3WE7A 3FWNA 1D0VA 1DXOA 2A4KA 1M1NA 4LYYA 2SNIE 3R5KA 2QKSA 2QLBA 4HB2A 2O7NA 4DHEA 3N8IA 1GG9A 3HM2A 1E1QG 3EZ9A 4Q93A 1M34B 3SEAA 2I2CA 3ZXSA 4D3YA 1KHTA 2NZWA 1CQIA 3A8TA 4UCSA 2X1MA 4FP9A 4DR6O 3C8DA 1T8RA 4DTCA 1N6RA 1E98A 2ZS7A 4ZXFA 5BSWA 1NYTA 3UCFA 1AR4A 2I67A 1LY1A 3RV3A 3D4NA 4RQFA 2F1KA 3U7IA 4ITVA 5DTMA 2P75A 3VM6A 4FWTA 4PQYA 3IFXA 2R5NA 4U00A 3LBNA 1JG3A 1V5WA 3SX4A 1QIMA 3FHJA 3IAHA 4RQBA 3L75H 4QDJA 3CMAF 4B5LA 1DKPA 1L4NA 4DV4O 3MHPA 4QBKA 1KC1A 2F8SA 4ADSG 1OGJA 4N8DA 2AMVA 1WHSB 1KC3A 1IUNA 1Z4JA 2DWCA 1Q7TA 4JQYA 4JP8A 3IEKA 3LPNA 3CT4A 5CVUA 4RKYA 3O9ZA 3NUQA 4LBVA 3HABA 1GFSA 5F77A 3DJYA 3G5UA 3FR7A 4UUOA 3KZVA 3NIDB 4V1CI 1VA4A 1PKXA 2P2ZA 3NASA 1SEPA 3R77A 4B73A 2XODA 1M2OB 4RJKA 2W7TA 3VDXA 1FNCA 1GUYA 1KI9A 1HMPA 4LY0A 5K51A 3OECA 3KEOA 2JHAA 3A4NA 3TAUA 4FLWA 1I5XA 1NJ5A 1NTZH 1U98A 4V0NA 4IDBA 2QL9A 1Y4SA 3I9LA 1CQIB 3AEQA 1QCYA 2XMPA 2JZNA 2JI4A 5FULA 2NU7A 5GOZA 1NRJB 5CP8A 1LPMA 4LY6A 4GPBA 4HXGA 1GV1A 2JI9A 4RVHA 3CCLV 1U0EA 4PNZA 2O6LA 2Z5VA 2B7BA 2R00A 3FCXA 1TRHA 4BE7B 1P8AA 3H1IH 4Z9AA 5K01A 2C59A 4D79A 4EFMA 5K7SA 4EUNA 3G2HA 5K3EA 4LXIA 1Q83A 1LF5A 1COZA 4MYRA 5EXSA 1D5WA 2P3SA 4ZI7A 4RQOA 2QI9C 1XA4A 4WN3A 3R7NA 2BSXA 4ABYA 2IYEA 4ZGWA 4KH1A 3CS5A 3CZMA 1RJGA 3WLNA 3ZQJA 3E81A 1KP3A 1N34B 1H2BA 4H6PA 1WMFA 4TOIA 3ZGXA 4ZO7A 1FNJA 2F3SA 3E5HA 2YY7A 4LOIA 2G9VA 2A5GA 1JLRA 1GUDA 2JFXA 3MMSA 5AKXA 5EMNA 4FYWA 2DYYA 2XTZA 3CGWA 4CH6A 1H1LA 3O47A 1V1JA 4AG5A 4FYIA 2R68A 4D8TA 5BT8A 1ZXLA 4TYNA 2W2LD 3PDIB 3LDUA 5C7OO 5J4KA 4YJHA 4ZOLB 1VPDA 1X7YB 2GVZC 2PD4A 1PP4A 3BULA 4DPLA 1AURA 3LWOC 3PX3A 1T1SA 5B3SC 3TBKA 2ZE7A 1TYBE 3PFWO 1KIAA 3MWGA 1DVRA 4QIWF 4HFRA 5LA6B 1OTXA 1TTTA 4OCZA 1J24A 2P9EA 2FUEA 1XRQA 3I53A 3DP9A 3I30X 3O83A 1L7PA 5DTQA 2O8DA 3AEQB 3GP5A 2NTJA 2A5YB 4AC9A 2NU7B 1NTOA 2X4GA 1TEHA 5MDHA 5CDSA 2IQIA 2AR7A 1J97A 2MYNA 2QSJA 5I7AA 4FSXA 4MH0R 1FU4A 3QLUC 3ZE8A 3AESA 2XBLA 3EXEB 3A6EA 4TZKA 3LXXA 3VMMA 1JHRA 4BB5A 2QKCA 5JT1A 5AHXA 5DHQA 4XRRA 3MTIA 4ZI7B 3FM9A 4B6FA 1M3SA 1J0XO 3WJ7A 1Y42X 3G0IA 4F97A 4GU5A 1Z2EA 1XV2A 3VYUC 1QSGA 4Q37A 4PZCA 4M46A 4DZRA 5JJCA 3QXJA 2CNWD 4AU1A 3MUEA 1XDCA 3MN1A 4LE2A 2FEMA 2JRLA 4A1OA 2RGGA 2ZJ0A 3TQRA 1JKJB 2UUBO 1UK9A 3MYYA 3G2KA 1GPNA 2E9SA 2WI8A 4ZT2A 1LEHA 1SUSA 4RTQA 4X1KB 3EMKA 1H1LB 2O8FA 4HUQA 3A9RA 1K6EA 1GUZA 4Q4HA 2B6HA 1H0RA 3HA7A 1YQDA 2BGKA 5AW8A 5F3DA 4WXHA 2Q4EA 4CMAA 1YHNA 4CR7A 4JDPA 2GJSA 3USES 5KOIA 2PH5A 2VJAA 4CEHA 3B89A 3JD0A 5E7JA 1VQ8F 3FYIB 2PU5A 3DHVA 2OB1A 3LUTB 1P0MA 1PEYA 1JEQA 2Q1YA 2ZU6A 2GJ8A 4DLLA 2CDAA 3BYZA 1FNMA 2O8DB 3P9XA 2RHWA 3UPDA 1A77A 1JJVA 3HCAA 2XAQA 3C14C 1KDVA 3KXPA 2I9KA 2YUIA 4I4LA 1HZZC 2AWNA 4D4LA 1PJZA 5BR8O 2ZRBA 4MRPA 2HHLA 2GHQA 4DY6A 3AESB 3R7DA 4R2JA 3N0WA 2XKAA 3GCWA 3PGA1 1FFTB 1NU1H 1XC7A 3SYCA 4LJ8A 1EE9A 1XYYA 5F2KA 4D3XA 4D9KA 1IQUA 4JB3A 4AIIA 2QXUA 1U8EA 2BAGA 2ZTHA 1SVUA 4F8EA 4HH4A 4OBWA 2YOGA 1KVQA 3R5XA 5EKXA 2GASA 3HKEA 4AUNA 4YAJA 1UWCA 3P5BA 4H4DA 4ER5A 2BTUA 1U7OA 2WTBA 1X7PA 2QEQA 5ERXA 3QPAA 3CUUA 2LDBA 4YROA 2WQZA 1I01A 3SIRA 3RU3A 4P3PA 4RM3A 3X44A 1VA5A 2DSTA 3E9CA 4HUQB 3WL5A 2DLCX 3H83A 1GHTA 2RK6A 4R81A 3PR1A 3G2NA 2W2LA 1PQUA 4J8PA 1XRPA 1KYQA 3N75A 3ZYCA 3I9OA 4BY9D 3WU2Z 5AKEA 3U9TA 2AQ8A 2JVKA 3PQ7A 1NLMA 1QCEA 1UXHA 1XVVA 3NR7A 1TE2A 2CUKA 4EHJA 1WTAA 1ZMRA 2BI7A 1IK6A 5FJIA 4R7ZA 5KPDA 4BFYA 2NUPA 1M57B 4RO2A 4RTLA 3A36A 3G88A 4WLUA 2VWKA 3CX8A 2NG1A 3DDWA 3WBBA 4MWEA 4OK3A 3DFUA 3MWFA 2E3CA 1GMGA 1T0HB 1K6JA 3OSZA 4INPA 2ZU0C 1XMOB 3VKWA 3OJWA 1M1YE 1Z16A 3WPXA 1F7YA 3A06A 1FRFS 2XD9A 1Y8CA 4D6PA 1EX1A 3A1DA 2VF2A 3VZPA 1ESMA 2ZS8A 4OX9B 3DUWA 1EE2A 4ZZ0A 2UXDB 4KBFA 1P29A 4PXYA 3I6QA 4UW9A 4OK5A 5BV1A 4NBTA 4OH1A 2C2XA 2Y69B 1M8JA 1PR5A 3NHFA 5A62A 3DE7X 2MYTA 3IJRA 1IWOA 2CNWA 1H1TA 3ZWVA 3BQMB 2I33A 1IHDA 3UJ3X 1L4UA 1WDKA 1DLJA 1DS6A 2GDZA 3EGXA 4R1LA 1GYRA 2J3JA 3BCRA 4AFNA 2ZDIA 3LUKA 3OBIA 3K70D 5E79Z 3QI2A 4BRWA 1ZH0A 4GSYA 3CCRV 4RQAA 4EY6A 1Q84A 2P4VA 3LUGA 1G7CA 2AG5A 3KPVA 3HG7A 2FMXA 3LUPA 1RI4A 1K97A 4QUBA 3KKMA 1Z5GA 1JQAA 1Z17A 1EZ4A 1Z45A 2X41A 1SQGA 3WLPA 3PLNA 1OLOA 2HHJA 4LZZA 5IUNC 4GXRA 4UNPA 3CNLA 1NXTA 2NUPB 3D1JA 4H44B 1Q0SA 3LX6A 5ED4A 2X6QA 1P9WA 4CDNA 5FRDA 1WCIA 3PNOA 3L1KA 3JWPA 4EMSA 3SHTA 4FWIB 5U1PA 2PKQO 2GHTA 2WUEA 1NN1A 2ZYSA 4MT8A 1LPAB 4KQGA 1N5KA 4ENUA 3IE0A 2GN1A 4YJFB 5C7YA 2VQFO 1M2HA 1OAKA 4D80A 3ENNA 1ZEMA 4YUAA 2CW5A 3OTQA 3M7IA 1PZGA 4IO0A 3JV7A 3K5LA 5HOQA 4I1OA 1UINA 4Y6RA 3UHOA 1LX6A 2QNIA 4Q1DA 4FIDA 4KQ1A 3G5AA 2NYUA 1K5HA 5FPHA 2W6PA 2Z3YA 4LYEA 3I5YA 5EMLA 1AZSC 1QK4A 3O8OB 1D0SA 1COWD 5B6JA 3SS8A 1PJ3A 4E09A 3FB8C 3OW2F 5F1YA 4O63O 5CFMA 3IUYA 1LW7A 4N12A 2Q9LA 3I34X 4BRUA 2BGNA 1JILA 5F21A 1F6BA 4FQ7A 3CXCF 3B13B 1YK0A 3MBKA 4O4JF 1X1QA 3SFTA 5FTKA 4NCIA 4GOND 5AUQA 3R3UA 1T6BY 5CVTA 2O0HA 2VQEB 4TRRA 4UU0A 4EWLA 1E2BA 4MSWC 3O0DA 3BCSA 5CITA 4BB0A 2QA4F 4E5NA 2I55A 3G5MA 3RAJA 1AB6A 1YDWA 1O4WA 4LXXA 1MQSA 3GAZA 4AMVA 3LWZA 1SCIA 2AC7A 4BY9E 4QU9A 3UJAA 2XKJE 2QLLA 1KSFX 2YDXA 3TFWA 2JASA 3GYBA 1EEHA 3TECE 1YKGA 2VDKB 3HCRA 2PMCA 1J0AA 4H60A 1EVYA 4YJ3F 1HT1E 1SZCA 2BF7A 3JQFA 3HXMA 2BTQA 1UFKA 1CDDA 1SZJG 4KXMA 4RDHA 4M87A 4R01A 1CYDA 4R6WA 1QGUA 4K81B 2BCJQ 5DLEA 3CCSF 4BAZA 5AHRA 1FTNA 4FC7A 2CJWA 3A70A 1PT7A 2ECOA 1U8TA 4LF5B 3AJ8A 2JGAA 4H1WA 3SR3A 3TW6A 3ILSA 5L7YA 2VQSA 4CQNA 1TAUA 3D6UA 1FNBA 2BMFA 5DHSA 1TD9A 4M8SA 4E32A 2CZGA 1ORTA 1TAEA 4DXAA 2QA5A 2J1LA 1AS2A 4ALLA 5AW1A 4JHLA 5IVPA 3SSMA 5E4YA 2ZZNA 3ACBA 1JU3A 1X2EA 2E4VA 2JZCA 4WKOA 4I0XA 3GNLA 5EB0A 4LC0A 2VCYA 3F4BA 1Y4UA 2P2GA 3BB3A 1BSMA 3NXKA 1YZFA 4YMIA 4NYMR 4AVYA 3A6KA 1VQ5F 3KEMA 3SYLA 3PJDA 1DAHA 5IKOA 3CCMF 1TF7A 4INOA 1EK2A 1X1CA 3BD7A 4NDZA 2P27A 4UVDA 5K0CA 4D9EA 1LVGA 3PC8A 4RK7A 3W5HA 1U3GA 2LKCA 2EULA 3GXOA 4CCYA 2DFPA 2QENA 5GJVC 2VHYA 1IHXA 3GWZA 4C0AC 4QSMA 4B6QA 2JIPA 2ZBEA 4RWZA 2X3UA 4MQFA 3ZIUA 2Y1OA 1Z5UA 3THOA 3ADKA 2JK0A 3I8XA 4MROA 3VV3A 5A3QA 2H18A 4PIVA 2XTMA 1K6XA 4FVTA 1PV4A 3WLHA 3ZMZA 3RT1A 1QGUB 3CKMA 3FFAA 2NGRA 3HO6A 1GGJA 1Q50A 2C7GA 3NWPA 2YN0A 3KC2A 2CJWB 4OMCA 5FF9A 3K9FC 2IXDA 3PNKA 3G8CA 2DT8A 1V3UA 2O57A 3LDTA 1KYYA 2UUOA 2JF0A 2YMLA 4UZEA 4QUJA 5KMGB 3KB2A 1Z26A 4ZO9A 1Z29A 4NL4H 1SM4A 1ST3A 4IW3B 1COWA 1W4BA 2UYHA 5J47A 3TW0A 4X8AA 2GPNA 4OPAA 1CWUA 4Z9YA 2MSEB 5TQJA 1ND6A 3AB8A 3H4MA 2O2JA 3BCCH 1YB6A 1E5VA 2V4UA 4QXMA 1T3GA 4I0XB 2Q99A 1BQ3A 1PX0A 1LDBA 4PLWA 1A9TA 2FVYA 2NPIA 3NEPX 5K3FA 4PYNA 3QVNA 2JCYA 4ETWA 5JQGA 3QWFA 4Q47A 1IM2A 4X7MA 4ARSA 4BVFA 1RWXA 4Q1AA 1AKNA 1ZBQA 3RHSA 2FPPA 2P4HX 4KIUA 3LYLA 3LPCA 4B74A 3REOA 4CV0A 3ILHA 2G0AA 4BKRA 3JD2A 4TSRA 4OLJA 3S4YA 4CCYB 1KI6A 5HKOA 1KO8A 3PJSK 4RDCA 4J3JA 1U0FA 3G82C 621PA 2BC9A 4NB5A 1RRFA 4QT0A 1V7QA 3C24A 3AETA 4LEIA 2O7RA 4BNHA 5F23A 1CUBA 5HE9A 5DGIA 2C4NA 3TPFA 2XWSA 3JVDA 5IZCC 1FX0A 2HF8A 1JFSA 2Z8XA 4NH0A 1PJ8A 3ZJ5A 1ZM7A 5EHNA 4UC0A 1EWKA 2AV6A 1UP7A 3EDCA 3O2NA 1SURA 1IZ7A 2UUAB 3T15A 1D6SA 1XXLA 1QOQB 5FH9A 1AVMA 4PZ9A 1XTUA 4HV4A 3NEJA 2OTJV 4BN4A 2EIKC 1YOVA 2JI7A 2X5NA 4HXFB 3N0VA 4PZYA 3DAOA 3C85A 3R0XA 1QIIA 3PSAA 1SBHA 2DQ0A 3DEYX 4ZVKA 1XQYA 3GP3A 3CD6V 4RJ2A 2YASA 2DCUA 1HYEA 1Q81W 1KWKA 2WJVA 3WIEA 2Q3CA 3KFXA 1TOAA 5K3FB 4MKRA 5C80A 1Q1AA 4K3AA 2IEIA 1V6AA 3P9ZA 3KT0A 2CF5A 4E5UA 5C4IA 1CY4A 3AY7A 3DNFA 3ZQ4A 2FPPB 4IDHA 4C1NA 5AI4A 4Q39A 2I0FA 1JHMA 1V95A 4U4AA 1UFOA 3QKUA 1X14A 2F7SA 4JBLA 4DGSA 4ZMSA 4FUTA 3ELUA 1Y82A 2GPJA 2JLAA 3WGVA 4G0UA 5I48A 3R41A 3IUJA 3AETB 4L7QA 5A03A 3T41A 3SICE 3HCPA 3BDVA 5LN1A 4Q3AA 3RVKA 1D4AA 1FX0B 3WL7A 1ZL2A 3H9BA 1VPEA 4FILA 1OGYA 4RPCA 1CS4C 4JIGA 4ZDWA 4AJ4A 5DN6G 4XYMA 3CNHA 3Q3HA 4ECAA 3RA5A 4XQCA 6PFKA 3PEEA 4K9DA 4ETMA 5IXYA 1YOVB 3IIJA 2QL7A 3FFBA 1HLGA 2EFHB 2D13A 3SIPA 4ND1A 4J42A 1QGED 1KC8H 3D6FA 1XI1A 3S70A 2QMYA 4QECA 1DZ3A 4IHAA 3VDQA 5SY9A 1IEWA 3D5TA 3WB2A 4NDNE 3ZHOA 3IUSA 3GPLA 4B48A 1PYDA 2HBZA 3NOOA 1UBHS 1Y3FE 3ZMSA 1L7NA 3UAZA 1SRQA 4Q9LA 3IE1A 2I3BA 2QTMA 5LMZA 1I5RA 4MAAA 1ZCFA 2F55A 3PPIA 3X2FA 1F4LA 4G5XA 5JAIA 2PLNA 3DC2A 4L50A 4JQOA 1P9LA 1VPLA 4D74A 2HCJB 2IZZA 2HFJA 4EG6A 1I3MA 4I46A 2ZF8A 2OT5A 2DWQA 5CMUA 3T5MA 1CUDA 1MR3F 2P67A 3IR6A 4G86A 1OXKB 3SFVA 4AF8A 4GKJO 5A4DA 4U7WA 3Q6IA 3LLCA 2A58A 4P4GA 1A7UA 1GN6A 4LP8A 2AMTA 1E59A 4LBYA 3WP0A 3D5QA 1KH2A 2O2EA 2CVFA 2QS9A 5G4LA 1IULA 3ZN1A 4PLGA 5ICSA 3ZJYA 2IP2A 1QB8A 4XUCA 3OQ1A 2HWKA 4WBNB 2XWPA 3MS2A 1X1TA 2RIRA 4UD2A 5DCWA 4EI7A 5GMOA 3A9TA 3ECSA 4UU7A 3I83A 4W7SA 3PXGA 4D96A 3F0GA 3D8SA 1TM3E 3BFVA 3LKBA 1PNKA 4GP9A 3HBAA 3IVRA 1J9ZA 3DMPA 1VDZA 1ZVMA 2PZEA 2H1VA 2ORIA 5TRTA 4LYFA 1C7RA 4B3JA 2AXPA 5TARA 2O2ZA 2YWXA 2JGEA 4CVNA 4COOA 2DM6A 1CUFA 2K6GA 4C81A 1NOJA 5BRNA 1HLDA 4LCJA 5CAEA 1U3FA 2CLKB 2H31A 2FWPA 4IQFA 2HRDA 1EKXA 1HG1A 3WYDA 1EVJA 4NZ9A 1CR6A 2XXAA 3OZFA 1OZAA 3NJ4A 4BZQA 3G68A 2V4DA 3EF1A 2Z2JA 4I66A 5HFAA 4HS9A 2IPOA 2H9IA 1B26A 2GA9A 4XPIA 1EFRD 2P22C 2D1YA 2C99A 1FRQA 2FUKA 2BM8A 3I8SA 1E3SA 3JPWA 1UK6A 1RPNA 1UFQA 3DZJA 3G9QA 3T35A 1DV1A 3GD7A 3SEZA 1H1DA 1DDIA 5ALXA 1M8GA 1U04A 4GZLA 1H2YA 2CJXA 1HDXA 1L9XA 3X3HA 1U1FA 3AXSA 2UXCO 4W1QA 5AVQA 1N7IA 3WYGA 4PG7A 3RIEA 1J49A 5GV8A 1VM6A 1ESCA 1RLTA 5JHHB 2F3TA 1NQTA 1EXMA 3ZLUA 3AY3A 4GI7A 3QLUA 2AUTA 4HN2A 4TLMB 4D9IA 5L3SA 1L7RA 1WL8A 3KQLA 4LDJA 4TQFA 1K4DC 5JS7A 1IY0A 1MX3A 3HJBA 1LBHA 4PRKA 3WJAA 4PSUA 3CCEV 5K6AC 4O29A 1XD2A 1TMGE 1XHOA 2BP7A 1N3BA 1XMQO 5KSZA 3T5TA 1B6SA 1L7QA 2G7MC 3OJFA 2ZETA 2YBDA 4RPLA 5HQ3A 2A0YA 3ZCTA 4QYSA 2QOEA 1HL7A 3A1SA 3DMHA 4P0QB 1A7KA 1PV2A 1T8YA 1ZI6A 3RSHA 1RLGA 5B6PA 5CAEB 1VSQA 3SF8B 3IUMA 1Y6QA 3L8CA 1J6UA 2YWEA 3D0QA 3BGOS 3VFDA 3IMEA 1KY5A 4P31A 1U0RA 1Z28A 1CE8B 2H2WA 3CE9A 5IUJC 2BFPA 5CN0A 2CZQA 4X0EA 3KYDB 1F0KA 3UT6A 4YO8A 3DZBA 1GJRA 3P26A 1FUKA 5B3SB 3GJ7A 4D81A 3K3PA 4ETIA 2ZFUA 3HZRA 4B46A 2X0NA 3LX4A 1JHQA 3KBBA 3HJHA 3O75A 2UZIR 2IW5A 1GG2A 1X80B 4WOPA 4ZHQF 2DW4A 1JG6A 1MRNA 4BECA 5IN5A 2GJKA 4AP6A 4DKXA 5A04A 3RFCA 1WU8A 3IUNA 3RNLA 3CX5F 2Q4TA 1H2MA 2FKAA 3PENA 4O02B 3RSQA 1HZZA 1MNQA 3Q9NA 2ZS9A 2V96A 2ZVDA 3JCMM 4HLCA 3OZTA 3DFFA 4JLPA 3UJPA 5L3SB 3TXQA 2GFQA 4UHJA 1BRTA 3L7MA 1WBDA 3THSA 4B3CA 3HVJA 3PNMA 3ITEA 4JFAA 3CE2A 3G7SA 3QUWA 5K99A 5TF0A 4OBXA 3BFJA 4GM0A 1OV4A 4XD7D 3OW2U 4LF8B 4RS4A 3NVMB 3ABKB 5HQ3B 3CXCU 2F43G 4HMQA 1H69A 2X0RA 4CS3A 4QQRA 3H0CA 2HYDA 4EMUA 3N0XA 2HDOA 3FFXA 4QTXA 1VMEA 1VP3A 2E2WA 3UYLA 1FA9A 2QM3A 4GQBA 3HJFA 2V6JA 2QMOA 3PHJA 4Z1VA 2Y0BA 2ECKA 2FDCA 1HR0O 2OV4A 2L26A 4PC2A 2FEOA 1VG0B 3HPQA 3QMVA 4ERHA 4HVLA 1YRAA 3BWXA 2A9OA 1I2DA 3HB7A 3PQCA 4IYIA 1HE3A 1S8FA 1MUUA 3IAS6 3CRW1 1EFRA 3JQ9C 3FJOA 2QTPA 4TRMA 4ARUA 4KL1A 2G5PA 1HDOA 1RFYA 2PT7A 4MGIR 2Q4DA 1V16A 3KYJB 1H2LA 1IXKA 2BI4A 2K7ZA 5CH5A 1SIOA 3AR2A 4C4WC 1NS1A 3OY2A 1KYTA 1IV1A 3B51X 4X1IA 4R05A 3W06A 2QMUA 1R18A 2HRRA 3ZHTA 2F9ZC 2B0CA 4B3DA 4TS9A 3U3OA 1CETA 1OCEA 4N9WA 1M0WA 3E4DA 2QZPA 2M2IA 1Q6UA 3U60B 2IXTA 1AH2A 1XWWA 2J4CA 3L07A 2NVBA 2HJVA 2V4ZA 1OWOA 1SUFA 4X64O 2PQ2A 5JISA 2ZUFA 1DWQA 4Q7KA 1EB8A 4UUPA 1NZDA 2QWXA