3HKDB

Tubulin-tn16 : rb3 stathmin-like domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 115
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkdB01
4O4JA 3HKBB 4LNUA 4TV8A 5LYJA 3UT5B 5KMGA 2BTQA 3N2KB 4FFBA 4DRXB 5C8YB 3HKCB 4YJ2B 3N2GB 5GONA 1FFXA 5BMVA 3JATB 4X1YB 5JCOC 5EZYA 3RYFB 4I55A 1W581 5LA6A 4O4LA 4WBNB 1TVKA 3HKDB 4X1KB 2GVIA 2RHLA 2VXYA 4ZOLA 5JH7A 5EIBD 4IHJB 5LP6C 3JAWB 5EYPB 5CB4B 3C8LA 3JAKB 5JCOA 1RQ2A 4O2BA 4O2AB 5CA1B 5FNVB 2RHHA 4ZHQB 4TUYA 5IJ0B 4I50B 5CA0A 2R751 3VPAA 5LP6A 4F6RA 5M7EA 5JQGA 5EIBC 3E22B 3RYIA 3RB8A 3R4VA 3UT5A 5KX5B 5LOVB 4ZI7B 3N2KA 1Z5WA 2R6R1 5C8YA 3JALB 5LXTB 4YJ2A 1RQ7A 2Q1YA 5MN4A 3ZBPA 4U39A 4I4TB 4X1YA 4O4IA 3RYFA 4E6EA 5ITZB 3HKDA 4X1KA 4XCQA 4EI9A 4YJ3B 4X20B 4IHJA 3JAWA 5CB4A 3JAKA 4IIJA 3VO8A 5JVDB 3WGKA 3VO9A 1FSZA 4ZHQA 5IYZA 5IJ0A 4B46A 1SA0B 1JFFB 3E22A 4O4HB 5IJ9B 4O4JB 4LNUB 5KMGB 5KX5A 5LYJB 3RYCB 2BTQB 4ZI7A 4FFBB 5LOVA 3HKBA 5LXTA 4DXDA 5MN6A 4DRXA 3M8KA 3HKCA 3N2GA 4HNAB 2RHJA 4I4TA 2VAMA 3WGLA 3ZBQA 2BTOA 3JATA 5LA6B 5ITZA 4ZOLB 4YJ3A 4WBNA 5JH7B 3JARB 4EI8A 4EB6B 1Z5VA 1TUBB 5JVDA 5EYPA 2RHOA 1RLUA 4EI7A 4TUYB 4O2AA 5CA1A 4B45A 5FNVA 5CA0B 5J2TB 4U3JB 5LP6B 1OFUA 3HKEB 4I50A 3RYHB 4TV9B 1SA0A 1JFFA 4X1IB 3JASB 3RYIB 1W5BA 3VOAA 3ZIDA 5J2UB 4KWEA 5IJ9A 3RYCA 4TV8B 1W5AA 3M89A 3JALA 5GONB 2VAWA 4HNAA 1FFXB 4O4IB 5BMVB 5EZYB 4I55B 4O4LB 1TVKB 3WGNA 2Q1XA 3JARA 3WGJA 4EB6A 1W5FA 1TUBA 4IIJB 4X20A 3VOBA 3WGMA 4M8IA 5MN5A 5IYZB 4O2BB 3V3TA 5J2TA 4U3JA 3HKEA 3RYHA 1W5EA 4TV9A 4X1IA 2VAPA 2XKAA 3JASA 4F6RB 3CB2A 5JQGB 5J2UA 1W59A 4O4HA 2XKBA
chains in the Genus database with same CATH superfamily
1ZCZA 2HU7A 1ESZA 4HH3C 4DV2O 2AF4C 4UCFA 3BA6A 4IO0A 3BGVA 1SUAA 2BMFA 4LDZA 1UZUA 1NRIA 1YNSA 2I6GA 3MTQA 2HRDA 4FNOA 1U0BB 1OXXK 3OD4A 4K35A 2FUG1 3AF3A 3PCTA 3UN1A 4K2AA 3ME5A 2ZTVA 4AF6A 4GNKA 3RJMA 1K7FB 3DVRX 3U1BA 5AVOA 4DMFA 4LZWA 2P06A 3QE2A 4JHLA 2YJ5A 1GA6A 2RH9B 3FCAA 5FWXA 4KYVA 2XYQA 1A5SB 2NR5A 4M88A 3AC0A 3K9SA 3KAKA 5LYJF 1Z7EA 3TD4A 5J2UB 1VDMA 4I8XA 3TD9A 4NCNA 3FYTA 4P81A 1KQPA 4IVQA 3U4MA 1QC5B 4UZFA 1W0KG 4CODB 4F11A 2PYDA 1UJNA 3EGWA 1RPAA 4W5HA 3T54A 4Z53A 1T5TA 4O3FA 3PE6A 3NATA 1JILA 1USIA 1IMOA 4O6VA 5TV2A 2JEXA 2AXTZ 1RYMA 1FU4A 1KK1A 2WLIA 2QKAA 1AUVA 3F0EA 3QBVA 1PG2A 1GPDG 2JRIA 5DHRA 2AS0A 3AIOA 3WDMA 5ECDA 1EWYA 2GCOA 2V6BA 2DECA 5DH9A 2VK4A 4I99A 3TR0A 4CNQA 4BTEA 3IKJA 3G9UA 4LF6B 1IZ8A 1CK2A 5BQXA 2MYUA 1UKEA 1WVMA 3B1YA 1D2GA 4FP9A 4UCWA 5T41A 2BI4A 2EWWA 1L5OA 4AY4A 4EM6A 5FPHA 3TLYA 3FAKA 1Q3EA 2OBXA 4IV5A 3IHKA 3HABA 4YI3A 2V5UA 3BTOA 4ZHSA 4DZTA 5JYEA 5JYBA 1SVNA 3K0AB 1NHGA 4EVSA 3UT0A 2HRZA 2I6XA 4BMCA 1PZHA 2EZUA 4GAEA 1URPA 2WUWE 4X91A 1TU0A 1LSUA 1IEWA 5L6LB 1II8B 1R2QA 3VQXA 1X7WB 1M2HA 2PUSA 5F5NA 4OVKA 3VIUA 1T25A 1X9IA 1TEZA 3QE4A 5IYBO 1LK5A 3OMLA 3UT6A 2GBFA 4R6ZA 1G2QA 4RL6A 1QAOA 1EM6A 4ND2A 2YJ6A 5JRJA 2H65A 4G5OA 2VJYA 1XJCA 3NHPA 2DE0X 5KJEA 2RGUA 4U7OA 4US2R 3K2QA 1YQDA 1A5AB 3H99A 1NMSA 1T15A 4IGAA 6Q21A 3JD0A 2HX0A 1Z08A 3DP7A 4LECA 1M1ZA 2V74B 1MO5A 1LBTA 1AVMA 5JO9A 2O1SA 3BIWA 4DK1A 4BZWA 3CHYA 3B1FA 4BO5A 2W7TA 5C93A 3LPNA 3RFFA 1NRXA 5FLXM 1YZHA 3OQMA 1JLKA 5F64A 2X0RA 1SB9A 2UUCB 5BV8A 3NBFA 5H6QA 4J3JA 2B7LA 2B2NA 2OB2A 3BXPA 2WIDA 3EZFA 1T34A 3U13A 2QNIA 4AXXA 2Y05A 3AVPA 2R87A 5H59A 1GCAA 1FW6A 4AMBA 2PGNA 2I7DA 3CRZA 2R3SA 6AT1A 3KYCB 1KI6B 5EGNA 2MW2B 5IBPA 4D4GA 4LKRA 3G13A 1L7NA 3GFQA 2ZUUA 3EY4A 3WKAA 3RSLA 3BL6A 5EWLB 1D7OA 2C9YA 3IDOA 1RQLA 1EUQA 2J87A 2WV7A 4IZHA 1T2DA 5A03A 5C8ZA 1HLPA 4DA6A 4E33A 3ADBA 2W6PA 1GN6A 4JBNA 4EKNB 3CXHF 4ALJA 1XI2A 3DV2A 4J8PA 2IE8A 3IAUA 4IUCS 3FNQA 1K68A 3KDSE 5GINE 3UK7A 1ZO8A 3SXPA 1P7BA 5BOSB 2C8KA 3EW9A 4B3IA 1KMNA 3L6BA 4W8GA 2PCLA 2H5JA 3C1AA 3DGEC 1IQPA 1MO4A 4Q0MA 4MW2A 4PINA 4UU7A 1Q0SA 5HQ3A 1G3RA 1F0YA 3D3QA 3DHNA 2Q4RA 3TCUA 1ZH6A 4H60A 4KDCA 4D45A 4E2LA 3UC5A 5FA6A 1B23P 3EMBA 1V95A 3AONB 4ZMBA 3S02A 3KWJA 3IJ4A 4YMVA 4JC4A 3VDMA 5AP9A 2CZWA 5EO3A 4EUSA 1ZH0A 3ZTYA 3PHBE 3TAUA 4CIDA 1UBSB 5AQ1A 2CZQA 5LOVB 4P4SA 2EKLA 3RAPR 4YAWA 5EEHA 5TQ2B 4AT1A 2VNKA 4IDBA 2Q0SA 4I5SA 5ER6A 5D86A 1UT6A 1QZZA 3GUUA 4RZIA 4L4RA 2ROQA 2WAXA 2BM9A 1CUGA 3G8YA 2P9QA 5F9HA 3CPQA 3ZLVA 2VUSA 3FWPA 3H5IA 2H07A 4GBJA 3QEAZ 3ABTA 5IT0A 2P62A 2YFKA 1WKVA 4A3SA 2J3JA 5DOZA 1IVYA 4WA7A 4OYRA 1UJ5A 3AK4A 3FZQA 1OWOA 3ML1A 4X00A 3COPA 5F35A 2V98A 3UVEA 1C1YA 4BQIA 4E5UA 2XKJE 2O3JA 1HNXO 3ZWOA 2W2PA 1IL0A 1E1YA 1WOMA 2KG4A 2HL6A 3APQA 4HWKA 2ODWA 1UKAA 4E4TA 1ZOPA 3AHJA 3WFIA 1YBFA 1WBBA 2ZRGA 4BHTA 1EB8A 2BHLA 2PK3A 4CQLB 1G63A 1VJDA 3WC4A 3RKRA 4A0FA 3ED5A 3EW7A 5KJ1A 1MB2A 1SRYA 3UH1A 5E8RA 1RYDA 4RIGA 3KT8A 4Y0VA 1OV4A 4HXYA 5CLGA 4LSWA 1M2JA 3G0DA 4UMFA 2QT9A 2QL7A 5ECGC 3OM8A 3OZGA 3L77A 3D7MA 4IQFA 1FYJA 2LBWA 3LHFA 4C78A 3PJDA 3A1DA 2GNPA 2HR1A 3NV7A 2FN9A 2H4ZA 3D7SA 3M1LA 1RFLA 4NDZA 1T8RA 1RKUA 2NVUB 3KV3O 3AJ8A 2ZSHA 4CKWA 3VC7A 2FW0A 2P90A 3LYUA 4EENA 5CBHA 1JRLA 2W6OA 2P2YA 3NX4A 1VJCA 2Y9MB 2JVDA 1G0NA 3ASOB 2UZIR 1WAMA 2XDQA 4L4XA 1JVNA 5K6RA 4RVOA 3CINA 5KYUA 4GQIA 2DWEC 2I3AA 4J9ZB 4ND3A 1C9KA 1MNGA 2AVDA 4RZ2A 3F74A 3R0VA 1EE9A 2CGNA 3SEZA 4PLFA 3C3KA 5JJLA 4Y6GB 4FCWA 4PN7A 1DF5A 4JI4B 1V11A 1Q2UA 2C58A 2LCFA 5CYFA 4OLBA 2BHTA 4JJ8A 3U5TA 1MGPA 2VWKA 3K3WA 1AR1B 4PG7A 1RI3A 2ZROA 2VXBA 1KF0A 5BUZA 5L40A 3KVYA 4LI0A 5H5NA 3W4KA 1DELA 4EB6B 4AB1A 4XUEA 1GN2A 3GU3A 2HLDA 1T9BA 1U4NA 1ZCJA 4B76A 2XTMA 4BEWA 1DV2A 5CVJA 2L26A 4PSDA 1HFKA 1YQ9A 4HQOA 3L7AA 1N36O 1V8ZA 4BEBA 2QX7A 1Z17A 1F6WA 4RMHA 4S1WA 3LGXA 2RG1A 3IRUA 2ZLBA 5TPZA 5A4MS 2Y3IA 4BBAA 2ZIFA 3E70C 5E1OA 3H4IA 1VYHA 3I9NA 4EW3A 2A5GA 1O0SA 4GPD1 4CM1A 4K3AA 3KYDB 2ATXA 4MV6A 4OREX 2GVNA 2BAGA 3WWDA 5JROA 1Z0IA 5EUQB 4JFAA 4YJ2A 4M1MA 2JHFA 2H4HA 1H2SB 5BZBA 1U2GC 3GNSA 1LCIA 4BB0A 2KM1A 1G6KA 3A1WA 1WLSA 3OU7A 3RC2A 5A5EA 3TX6A 1RI5A 1YFJA 2CLKB 3VR5D 3DAOA 4A82A 3MN1A 5HDBB 4Z9XA 2FYUH 3HS3A 3D0KA 3CZRA 3AVXA 5CCEA 3OCYA 3PPIA 5KUTA 4FS8A 3F6YA 3KYIB 1J25A 2O8DA 4B2LA 4ZV9A 4OKIA 2ZAYA 3ETNA 4NMXB 5DK4A 5DM1A 4ID3A 3C7KA 2BHNA 3H7AA 1OFUX 2P2SA 3Q87B 1X80A 4D3SA 3K4HA 3CRRA 2HLHA 3VR6A 4KE8A 3B1WA 1IE3A 3HCBA 2Z3YA 3C9TA 2ODAA 1GTRA 2WLHA 4AKIA 1KJIA 3E8FA 2VPIA 2XGJA 3T41A 1XMOO 5HP4A 3VUFA 3DUFB 1SG6A 3M84A 3O3OB 2GN6A 1GGEA 2XCTB 3PP8A 5DT2A 1PT6A 4GYYA 4UBLA 5A4JA 3HGTA 3K1ZA 3VR4A 4YY3B 1CY0A 1TXGA 5A1JA 3GY0A 2XOKD 5FTNA 1JMVA 1T1JA 5B8FA 1M5IA 1P81A 1A72A 3A6EA 4ABYA 2QSZA 2FE1A 1BE8A 3B2NA 2I4LA 4YH1A 4Q1FA 1AS0A 2XDAA 3FPHA 4K6CA 1NVAA 1IHUA 3VJMA 3KK0A 2ZRBA 4Q12A 3X1WA 2GBCA 5IT5A 4E3WA 1GCIA 2Y68A 4JUFA 1JQ0A 3DA8A 1P2TA 4ZMRA 4N48A 5KNDA 2AG6A 3WWCA 9ATCA 4DCPA 4MHTA 4Y6OA 3IOYA 1GRJA 1I2MA 1ZXXA 1BX1A 3HN2A 2VP9A 1I7LA 1CJSA 5C34B 1S8OA 2OHIA 8LDHA 1I3LA 2DHEA 5C3MA 4QX6A 3E89A 2YZGA 1XDSA 4CETA 4BP1A 3H5TA 2IE0A 2J32A 2MSWA 4I4TA 4Z2AA 2JIQA 3ZWKA 3BS4A 5BORA 1FMJA 1FNJA 3RV4A 4TVSA 3HEAA 3F8SA 3QWAA 1S72F 1RSOB 4XR9A 3V7YA 4LJKA 3AW9A 1AP6A 2ZJZA 1X1SA 4K9NA 3TM5A 5C51B 1ADYA 4KODA 3H5RA 1IQUA 3NGXA 3P9ZA 2EG5A 4LMRA 1VQ7V 3H2KA 1Z0FA 3IOEA 3PFIA 3VTAA 3UQYS 4E08A 1U0LA 2CL6X 4DR5B 4O2AB 2WHEA 4D7AA 1G8YA 1DU4A 1YQNA 2OO7A 3B13B 2OTMA 1A04A 4U0JA 4CL2A 4URVR 4X20B 1H2LA 2FMUA 1FZQA 3NH6A 4ISCA 2ANBA 4MW1A 5GVRA 1XHOA 3OE5A 3FGNA 3VTKA 1PHRA 2GHTA 1E6WA 3K15A 3LA6A 1FNDA 3IP7A 2ATEA 5I51A 1WHTA 1OLXA 1L4BA 3F5WC 4ANFA 2MR5A 2C2OA 3VX4A 4LYHA 4DV4B 1TMYA 3TKLA 1O6GA 3ZY4A 2D5IA 2HJVA 3ZUGA 4ENPA 3CSXA 1GV1A 5JS1A 3K30A 4AYWA 3Q8XB 5JCXA 4ESHA 2X8AA 1Z5UA 3SE7A 2GI4A 4KACA 1DO8A 2DR2A 1IFXA 4UKDA 1M2EA 2IXFA 3NETA 2YIMA 1VLVA 1W0JD 2RHHA 1Y67A 2BDEA 5DOVA 1DHTA 4PYLA 3LOUA 1N8KA 2FPGA 3IOMA 3Q7PA 2Q7DA 1W8IA 2Z2KA 1NZJA 4FFRA 1YV9A 3QTTA 2B25A 1KEKA 2MT9A 2QD2A 3SEFA 4C3UA 3C87A 4L02A 4WZAB 1XNJA 3LCMA 2A7WA 1TVCA 4JLBA 1BFUA 5CX1A 3TQRA 5LQUA 3CCLF 1LRLA 1CR6A 2LKDA 3CYPB 1EFVB 1QG2A 1N6PA 1BJKA 3R3SA 4BR6A 3PX3A 3OEEG 1XDDA 4ZIBA 4JV5B 1M6EX 5TQ0B 1CS0A 4CWAA 1CQJA 4L95C 1TRKA 4C3OB 3PXDA 4MHSA 1I5OA 3WSVA 1QNLA 5ENZA 4WZBB 5TVKA 4W4LA 3DMHA 1KIMA 4KP4A 3N8KA 4W1QA 2NIPA 2JZCA 3I56V 3DWFA 1QORA 4KIJA 3WP0A 5JD6A 1PZGA 4PX5A 3QPVA 2IBTA 4BAYA 4DUGD 1TFRA 8ATCA 3IC7A 3I0ZA 3TSZA 3EQ9A 1NYLA 3D64A 5IABA 1CB0A 1CZLA 3UJ8A 3AR8A 3LK7A 2MR6A 4UE6A 3P2YA 1GTSA 4GBGA 5F5XA 3MRVA 5LP6A 1Y8RA 3OFSA 2QL5A 4J29A 3JQQA 4C76A 5TMPA 3CMAF 1ZC4A 3HU1A 3SM3A 1C7ZA 3OQBA 4WCFA 5IM4A 1LUWA 3ABSB 3PQ5A 4UJ3A 1WY5A 2EZPA 2NLJC 1QRDA 3LE8A 4D7TA 2ISQA 5BXZA 1P4GA 2ZVZA 3NC1C 1GGKA 2VEDA 4GKBA 4HSEA 1J09A 2WFZA 2UZAA 4KXLA 2PU5A 2ES4A 5F7XA 1VL1A 4EQ6A 4DVJA 2P2NA 4U3JB 4CR8A 2LXNA 3G5AA 1OREA 1YRLA 1HYHA 4P7KA 3R8CA 1D1PA 4PZDA 5B1DA 5IE9A 4TV8B 3PI7A 2AFHB 2H6LA 3OR7C 2DH5A 4YRNA 1YB4A 1PJLA 2OHXA 2AE1A 3U2QA 4RGYA 1X1QA 1WXHA 4RD3A 4RD6A 2HCTA 3ETGA 4K9SA 1I4TD 3KQHA 3GOQA 1PO7A 4CM3A 3M7IA 5CPFA 1Y7HA 4DJDC 3IPLA 4GXRA 4JI5O 2HU2A 5ARDA 2QZ4A 2QPTA 4OOEA 4RQEA 4P86A 5AK4A 1DKNA 1HEUA 4FDMA 1UBMS 1PV4A 4TL6A 1MQAA 4FN5A 3H0EA 3S8MA 3AUYA 3OX1A 5I8PA 2E4ZA 3TIIA 3QKUA 3M8KA 4MVJD 3FX7A 2GDJA 4N12A 1BN6A 1EM8B 2ODNA 4QM7A 5GAJA 3OLWA 3VH1A 3GFBA 3BL5A 5I7VA 2WNIA 1JECA 3IHTA 3C9RA 5ESRA 2Q9UA 1AMNA 5IDJA 4P54A 3MWJA 3D6JA 1UPUA 2V97A 5H9CA 3WB1A 4MUMA 1C4WA 1I1NA 6REQB 3PGMA 3D4LA 1BZYA 5JQGB 4JSYA 4UTZA 2ATKC 1NGSA 2MWMA 4L6CA 3B8HA 4KI7A 3OZXA 2H8GA 5J9FA 3RQSA 3OIDA 5IEBA 2VJKA 5IDVA 2JEYA 2RMKB 5CA1B 5IAKA 3F3KA 4RDXA 5ABPA 1F3OA 1B0UA 4G4IA 4MA5A 1FFGA 2QLTA 2X0DA 5C5IA 1LDEA 1BN7A 1U1FA 4YCBA 2X7RB 2VQEB 5A3SA 3WRWA 3ZN0A 3W2HA 4CLOB 3AIKA 4D4LA 3RIMA 4OHVA 1ORWA 3K0CC 3O74A 2VNJA 3CXRA 5MFZA 1H05A 1C50A 1Q1QA 2C2ZA 3SN6A 5IN4A 4KOAA 4X7BA 3AZOA 2EQAA 1W34A 3P97A 3HFGA 3EVKA 4A6XA 2A35A 4K8ZA 1C80A 4HYYA 3HHPA 2IZ6A 3KTOA 5G02A 5IJ9A 1JIKA 4HYEA 3TIVA 5GJVC 4QOEA 1FU7A 4YT5A 4DPLA 3VUEA 1C9NA 2ACKA 2A88A 5DDIP 4ITUA 1WW3A 4OHXA 3IHWA 4D4KA 4IMRA 1GAJA 2EIMC 5LR6A 1FS6A 3QENA 4I4IA 3QFHA 4NOLA 1M75A 3H75A 5TEVA 1K3EA 1APBA 4TMYA 3ZZ0A 3GLHE 3CF0A 2HQBA 2NO0A 5CYOA 3RI3A 5ALJA 3TSCA 1DI0A 4MS1A 4CL0A 4PGGA 2O0HA 3BERA 2Y69C 2J3HA 3G2PA 3AF1A 2FLWA 3EUFA 3SHFA 5CBPB 1XCGB 2W0MA 2WZBA 3BMCA 3ZCVA 1CB7A 5B55A 1XHXA 3AKDA 5K4GA 4BKQA 1R3LC 1PR3A 3B60A 5I3CA 4YIPA 3R8FA 3C6XA 4DK0A 2OGUA 1JJOA 4NE9A 3D4BA 4P3OA 2WWYA 5IJWA 1HEYA 4KPUB 4I7ZB 5FI3A 3OEHD 1IBLO 3DPIA 4RJJA 2A57A 1TCBA 3D4IA 4EA7A 2Z1EA 3T3GA 4JSTA 3A31A 2EILC 3H9GA 3TMAA 2YHIA 3IEUA 3EVAA 3ESRA 3LVQE 4WBSA 3WJPA 1Z35A 2H3OA 1Q7RA 3CD6F 4RJ2A 2Z5VA 2EIKC 3OPXA 1WEHA 4IHJF 4TSRA 2XUHA 1BHO1 3VBEA 3U4HA 4NWIA 4RF4A 1PQPA 3K9WA 3FX2A 4L85A 3L07A 2QN6A 3P9IA 4WGFA 4NEQA 4UVBA 2H3EA 3KJQA 4CN8A 2ZUSA 1D1QA 3C3DA 3A9UA 4LYDA 1OX5A 5JUWA 4D79A 2X5OA 2JLQA 3S3TA 1Q8RA 3NNDA 1BAPA 1KY5A 1KJYA 5CDUA 1G8AA 1V1RB 3M4JA 1NULA 4DRXA 1F6BA 2AQ8A 1HDCA 1V41E 3C3MA 1K97A 5FPQA 2DBQA 2YL2A 1B0AA 3FUUA 5JU6A 3PC8A 2X2OA 4XYEA 3AG4C 2QYOA 1DAKA 2AG5A 1W88B 4NJEA 1W5AA 5EHQA 3S70A 3HFJA 4L28A 5AHWA 4IYHA 3L7KA 3N2ZB 2UXCO 1YZFA 3BWVA 4OXNA 3SPCA 4HUQB 5CDGA 2WJ3A 2VNAA 5FWNA 2C0CA 3N7TA 4IDEA 4UCXA 1SQPH 4NATA 4GP9A 1V54C 4C06A 4EGFA 4LHXA 4LGCA 2HCJB 3I9MA 3HYTA 2HIGA 2ZKOA 2Q69A 3QF4B 1U0JA 4LR3A 4LG1A 1L5QA 3NTOA 3K20A 4BO3A 2BKLA 2RKWA 4X62B 1KVRA 1JHQA 3DDSA 1PSDA 4RHEA 2AMFA 3B2EE 3EJWA 2B36A 5IYZA 1GPAA 3WAKA 1B2LA 1XFDA 4BQNA 2JD0A 3A6JA 5AKHA 3HVRA 3N75A 3ABUA 5DSTA 4FC7A 1T8WA 3V7NA 2II6A 1YR6A 4IV8A 1R0WA 2DBVO 5AW5A 1CXZA 2M6YA 2W71A 7GPBA 1GT6A 1QU9A 1ZD3A 4DIBA 2DQ4A 2ZAUA 2QM8A 3R74A 3DDCA 2YI8A 2WIAA 3ILYA 3FJ1A 5LZ9A 2BFBB 7REQA 3SYLA 3CF6R 2M6LA 1PGPA 1M8FA 4TKUA 2V7UA 2AD5A 3TDMA 1FRNA 4BNIA 4HLDA 4HVTA 5EIFA 2IHJA 2QDKA 2P5SA 3G6EF 4L6AA 1UH5A 4RQOA 4K40A 2XLCA 4PEVA 2HSDA 3HPQA 3QXCA 3FSEA 1L7RA 5LBIA 1J1UA 1NY6A 1KDRA 1QG4A 3K5MA 3RPEA 4LCJA 1G66A 3F73A 4LIPD 2PWZA 4I1RA 2VPXA 1JSLA 4BP8A 4DR3B 2AFIB 3JVVA 4P3KA 2LE0A 4KFCA 3BQ9A 1ZI8A 2QTHA 5KUMA 2H9AA 1EA5A 2J9XB 1PJSA 4JI1B 3N4YA 2Q5IA 3FSJX 4LJ9A 3S3WA 1OE0A 4MMZB 4B3TO 5BUCA 5EZ6B 1FTNA 2IEZA 1JJAA 3FVQA 3Q9LA 3U3RA 4QTUB 3WFVA 1ISGA 3E9CA 3LC1O 5C8YF 3ASVA 4RETA 1UXKA 4M6WA 3ONNA 4HZUB 4ZYWA 4MP8A 4AX4A 2AMLA 2FI1A 2NYVA 3W2GA 4GXQA 1PJRA 5FULA 1E69A 1HYGA 1EUYA 4FFDA 6YASA 3E9ZA 4S0XA 4LXXA 2BJHA 1I94O 2GZSA 4JI0O 3EHBB 5EI5A 1HWYA 4C29A 4E6EA 2JFHA 4WXHA 5IDXA 1NXVA 4DQVA 4QOHA 1TFUA 4AN4A 4Q82A 1Q7EA 3RBXA 1UWKA 3DEAA 3L8MA 5LFAA 4AJHA 3IQGX 1KZ9A 2B0JA 3S2FA 4EYGA 3JATA 2JLBA 5JAZA 1IXBA 5FX2A 1N33B 4MI1A 2AMTA 1LSSA 3GLFB 3V5NA 3AH8A 2XCQA 1CQIA 4GDFA 1IBKB 4ZQBA 1GG8A 2ZIXB 2EIMB 3EGXA 2HH9A 1B06A 2ZK7A 4UMEA 1SHJA 2ID9A 3VHXA 5EZ5A 4M9QA 3DMRA 3EVZA 4DDWA 3HUTA 4O4IF 3AFGA 1FEZA 1U7DA 4BT7A 4NZNA 5C8XA 3UCEA 2QVYX 1CEEA 2C07A 4BAUA 2I7CA 2GJ9A 1SD5A 2Y69B 1NBMA 4K86A 3FLBA 4AUKA 4PELA 3TW6A 2P4EA 4I5GA 2IEDA 3IPYA 1GTZA 1TF7A 2UVDA 3GG9A 2VTVA 5HPYB 3MT0A 4L5JA 3AJRA 3D7RA 4ML3A 3WGKA 4P33A 5DFAA 5B6JA 2C04A 3HXLA 3WWEA 2Q6OA 4CMGA 3HBLA 3FJOA 3IPCA 2WWHA 1N0UA 2F7SA 2ZODA 1GZ3A 3PXGA 3IE2A 3EUEA 1JGTA 1XZ8A 1ENYA 2WWVD 3ZY2A 5FOTA 3REGA 4N54A 1QH9A 4ONEA 3V32A 1PWEA 2C98A 1H1TA 4DR7O 1CP3A 2EILB 1NM5A 3OPMA 3AK3A 1GWNA 2ONJA 4B3JA 3VKUA 2A59A 3IUNA 2EIKB 1GRCA 1VMEA 1M4UA 2XWBF 4RD1A 4L8LA 4BFZA 4GRDA 1H1LA 2VTEA 2QA5A 3GWOA 2RE8A 3KXIA 1XCMA 3K2EA 3DWGA 3SIWA 1A95A 4DV1O 5LGUA 3C43A 3E05A 4E15A 4UVIA 3G4SF 2A9FA 2O8CA 3DF7A 4BQFA 5KA5A 1KDOA 5CBFA 3KBBA 2Z5GA 2VBIA 3MMNA 1MZEA 2WICA 2YWHA 2VWGA 3PE4A 3G1TA 5LCXA 4MP3A 4JLDA 1FS0G 5FWXB 4HLNA 1JS1X 2X5KO 3OCJA 4A1OA 3CNEA 3FPFA 3UKJA 5FP0A 3AG4B 3MJDA 5JFGA 1B43A 4GDMA 3A2MA 3REOA 3QU2A 1OXSC 3DZBA 1MZPA 3K0DA 1WX1A 3GVPA 4I81A 4MWDA 1KYZA 3ZI7A 3IJEB 1ZGBA 5TQVA 3SSAA 3QKRB 1G8HA 1QP7A 4WASA 4P3PA 2OKGA 3ZZTA 2NV2B 2WLIB 4BFCA 4DV3O 1IHPA 3D7NA 3FUCA 2FSUA 3SF8A 3V6LA 5I7AA 3R7LA 1O2DA 2GCOB 3P3NA 1KH2A 4JYAB 1SHUX 2EKPA 4N8SA 3MDOA 2QEXV 4IIJF 4RUKA 2IG8A 3WI7A 4RHTA 1KQ3A 4ZXFA 4OJKA 3HO8A 3Q2IA 4E88A 3COWA 1FTQA 1E6LA 4ZKDA 2PA3A 2D7DA 1Y1QA 3L8YA 4J0CA 2Q9LA 4AAYA 2I33A 4KR9A 5COQA 4RTJA 3KC2A 1OJLA 1L1QA 2ZSAA 3UAXA 1Q82W 3IESA 5CIWA 4X97A 1JFSA 3F6PA 2R1VA 2F93B 2NTYC 4MJ3A 4NI5A 2H16A 1OLSB 1SZTA 3UA4A 4MLCA 4IO1A 2WSMA 2EJ7A 4E32A 3P2OA 4FGKA 2ZPUA 4ZT2A 2G36A 2VTKA 3TE7A 3OCVA 5HE8A 3DL0A 4G65A 1PTJA 5E8JA 3FNFA 2D5LA 2IW5A 3IDFA 2WG2A 3D43A 2IYEA 4Q7JB 4FYYA 1K9SA 1X7ZB 4R8SA 3EAGA 3ND5A 4MUAA 2F17A 4QTYA 3ZCTA 2FMIA 4M36A 4GLLA 2C8LA 3U3OA 1LVGA 1Z0SA 3CBQA 3GJSA 4UHFA 1NNUA 5ECYA 3WMFA 1YTLA 3F0TA 3K71B 3LAWA 2XIJA 4BV3A 3TEFA 3GLQA 5FOXA 5BSGA 3VPHA 1FNSA 3JVUA 1M67A 2GOYA 1YAJA 4J11A 3SFTA 3QKSA 4UXNA 2PIAA 2HI0A 1OAAA 1JVMA 3K2IA 2YOHA 3QEOA 4NU5A 3L8CA 1GPMA 1COMA 4LI3X 4XSVA 5EKTA 2WNHA 1MEEA 4NCBA 3ZBQA 3WV5A 1FX0B 2X6TA 3SDSA 3MDSA 1NUAA 3C16C 3GGOA 2MYNA 5C5DA 2NV6A 2WF5A 4JL8A 5HW0A 3Q0EA 2HXYA 3RU3A 2PZSA 5AKYA 4RULA 4ETWA 1MW9X 1NW4A 3PUWA 1KH3A 3P71T 2J7PA 5BR8O 1DEKA 2CHEA 3NDJA 5AKIA 1X8XA 2R4TA 2BEVA 4LZPA 5BY2A 2BM0A 4QNHB 1FXWF 1XZHA 2LD4A 1R27A 3QXHA 4B3GA 3EULA 1OCOC 4I50B 3CNLA 2FLKA 1HT3A 2FOXA 5BNIA 4G85A 4R1MA 4CF6A 4LF7B 5LHGA 3FIUA 1EK6A 3G0IA 3D2LA 5JWHA 3OECA 2HADA 2I2WA 4MRNA 3FPLA 3DAFA 1X1AA 3VR4D 4R8LA 1QLWA 1Y5NA 3TSAA 5DYIA 2VATA 3A3PA 1L1RA 3VOSA 2JCGA 5DE3A 4MRAA 3PHIA 5HQ3B 2Q4BA 1LI4A 3C97A 4RMNA 2NT3A 3BMQA 3WBJA 4HGPA 1QIKA 1EVQA 2R6DA 2W6NA 1ACMA 3UJBA 3V48A 2IH3C 5BWMA 1WNFA 4JJ6A 3ZLJA 3A1FA 1IY2A 1CULC 1GAXA 4JLSA 1KO4A 3LT1A 4BO7A 3NWBA 5DRTA 1X0XA 5JNWA 5HCIA 4FYMA 5G2OA 5AI9A 4B62A 5JD3A 4NMMA 5KNDD 4JVLA 4B3MO 4IZOA 1YQUA 3WQRA 3NWEA 3VX3A 4FLUA 2JVIA 1P7WA 2GJAA 2QVXX 1CJUC 3B85A 1I3NA 2XQFA 1P9RA 4WKBA 4PTLA 1ZCAA 4HWGA 1M66A 2GZHA 3CH4B 4E70A 5CR9A 2OKCA 2WPNA 4KBYA 1XU4A 3EIXA 2N47A 1PF5A 4EUEA 2PJZA 3U17A 2PSJA 1XWFA 5F3DA 1KC8W 2I6QA 4OX9O 2RHTA 4D9IA 3BE6A 2WWFA 4XLLA 3BQMB 3OBIA 2Q68A 4CEHB 1FS5A 3ESZA 4MI3A 4ZN6A 1HLDA 3OJOA 5KTMA 1OXBB 5KMGA 4ZVPA 2JIRA 3OTOO 4HNGA 4OB7A 3UMMA 4JB3A 1SB8A 4LE2A 1XCOA 4QDOA 3ZCUA 3HUEA 4X71A 1YI2V 3G3EA 4MUNA 1JAXA 4M0DA 4W5QA 1N8RH 1WKCA 2O7NA 2OEPA 4KXQA 1NOKA 1X1CA 4NYKA 1FSZA 3O03A 5CJPA 1LDMA 2B4TO 4C0BA 4QYXA 2WR8A 4G26A 1DO2A 3I2FA 3V4LA 5DWVA 3AO0B 2AF3C 1UIRA 3I8SA 1Q44A 2Y4OA 3RIGA 4KTVE 1EDOA 4ZT6A 2BM1A 3RTEA 4FEEA 5LBQA 3UC9A 3EY9A 2DFPA 3RO7A 4EO9A 4AP5A 2J41A 2NPIA 4B4VA 2QTFA 4CQNA 2WJGA 4RK4A 3WSWA 3DSRA 4JX8A 3MWFA 4AWBA 5IY5B 2A9QA 4N7RA 4AMYA 3BABA 2HV8A 3THOA 1DL5A 2UZ3A 3AILA 5EKXA 4OM8A 1RQ2A 2WUFA 2WSSG 5B4VA 1RR6A 3Q98A 2SHKA 2W98A 1C3XA 4ERHA 2LIPA 3T5BA 1LBIA 5H2FZ 5SY4A 4NE7A 1SKYE 1QOZA 3H13A 3U7EB 2PPVA 2IQQA 2Z8YM 5F1YA 3PGJA 2WINI 2IS4A 4IHQA 4IYRA 2WM8A 4G67A 4QBHA 1E3IA 5EWMB 2HYDA 2JI9A 1DC8A 1RRKA 1MKYA 1AM4D 3GVIA 3QUSA 4U2FA 5DULA 4JJZA 2W6JG 2GTHA 1BS1A 4BVJA 3ZGYA 2AUNA 4OH7A 4DYHA 4MCJA 2FEPA 2PGGA 4YJ2B 2R1TA 4M3NA 1OCZB 5TLSA 4YUVA 5LP6C 1S77D 4B43A 4FGWA 1FE8A 1QYIA 1KYOF 2DQYA 4LJ7A 2QW1A 3E9EA 4WCFC 2CW5A 1FDTA 4EY7A 2HBQA 1UP4A 4EJMA 2DFNA 3CTMA 2OAEA 4Z8YA 3ZU5A 2O8DB 4NMLA 3BH0A 5B1YA 4URZR 4LQLA 4O0MA 2RBGA 4ZOLB 4NH0A 3C1UA 3QU7A 2EGUA 4Q3LA 3NDIA 3AVVA 1WB6A 1R73A 4LFAO 3QVWA 2RARA 3SNKA 2NPOA 4AKHA 3G23A 1C0PA 4JQYA 4W5JA 3AV3A 1J0BA 1PL6A 4MRVA 5HTKA 1DO0A 1TK3A 3MPUA 3MCWA 4UBNA 5K6TA 3BMXA 4GX1A 5AFSA 3ISTA 1EP2B 2ZAIA 2FX2A 3S06A 3RABA 4DJFC 1OCOB 1E1DA 2NAFA 5AXBA 4QYWA 3MGGA 3BRQA 5J4LA 3UANA 1C4KA 4AF7A 2JAUA 4Q66C 4OEHA 4IKPA 4XVCA 3WBBA 3WWYA 2I80A 4JEHA 3USCS 2V7BA 4FOSA 1Z28A 3AGPA 4QQRA 3R5FA 4LHWA 4EI9A 3VQWA 3WQSB 4UDNA 3FSRA 2IH5A 3UWMA 3C1TA 4B46A 2LTAA 3ERNA 3FDXA 3A3OA 4ZO9A 3I62A 4PANA 4NCHA 3THRA 5IC4A 3ZGZA 2YC2C 3E82A 2W00A 2VHTA 3WK8A 3H1TA 1II0A 1PD3A 5HDQA 4LDPA 4BUCA 1EDEA 1M8GA 2BKEA 1Q6HA 4V02A 5LQMA 1G1AA 4TQDA 1B6QA 5LUAA 5KOYA 2H1RA 5L51A 4XB1A 3VRHA 3A0UA 2UXDO 4FR0A 2RDCA 3ZC3A 3DV0A 4PLYA 2ZJFA 4B32A 3M99B 3P4UA 3A0HZ 1KARA 5KTNA 3B1KA 4MR8A 4OQDA 3JR7A 3RAFC 5LMUB 3IQDB 1Z06A 4CF4A 2J6IA 3DBIA 3OHPA 5AW8A 1U94A 3PTAA 4DR2O 2JHPA 1H8HA 4FCVA 3GZ4A 3VAYA 3L6EA 4LC9A 5A0VA 4I4TB 4JI6O 1NSTA 3C3SA 3G0HA 3QXGA 3SX4A 1RJDA 4WNCA 4YRJA 4IHKA 1QOPB 2HMWA 5AKLA 3LPCA 1JL3A 3JZIA 1S3FA 1QHTA 2X0KA 4B6FA 3U16A 2OQVA 5T67A 3MS4A 3N76A 1DAGA 1WW2A 3COJA 3FKSA 2BEJA 1E2HA 5FUQA 3JQ9A 2B5UA 5KPJA 2H52A 2FPSA 4R1TA 3GPDG 4N9QA 4BFUA 1DFIA 1E9VA 1GR0A 5FJJA 4LJ4A 5EJMA 3WNQA 3DZIA 4ICGA 1VI5A 2QXUA 4TSFD 1V3VA 4CTOA 5FAKA 2I7XA 5ITWA 2YOGA 3NAQA 4JBXA 4XR4A 3OCXA 1T8SA 3EQ6A 4IY1A 4OQ4A 3RT3C 2FAXA 2FVXA 3GYGA 1K4MA 2C82A 3DOJA 3K6JA 1DFGA 2XMSA 3N6VA 4UPDA 1WHTB 2EP7A 2Y27A 3H4MA 5F76A 4EVIA 1ZW6A 3MMSA 1P5JA 2OGWA 2Z5LA 4MKXA 4IMPA 4PZZA 1PGQA 3TTXA 5HUJA 5GV8A 3JW8A 1KEWA 4NR0A 3BCUA 3EPRA 4R8KA 1HG0A 1GUDA 1VIBA 3TZBA 3FPEA 1F1BA 1FDOA 1E7WA 1PJ2A 2O0KA 3NFRA 3RW9A 4B2IA 3Q9NA 4C87A 4EG4A 4TRMA 5FA8A 5FHQA 1ORQC 3RREA 1YAHA 3BXEA 2ECQA 1VQ8F 2O8FA 2FPGB 1B1AA 3TB6A 3OAAD 3K53A 1M0EA 3BPZA 2PTHA 1OFHA 2IH4A 3IAHA 4DJAA 5CX1B 1G20B 3AR7A 4ZYXA 4RSHA 2DZDA 5AUPB 2Q3LA 3UTDA 2ZYTX 5FNVF 1J8DA 2BKXA 1RWBA 4FB5A 1CS0B 5TB5A 4AKEA 1CQJB 3TLXA 2FEXA 3Q3VA 3PC8C 4TVBA 1ZBQA 4YQZA 3LS2A 2L35A 1R1DA 3AB3A 5KAFZ 4D0RA 2YWCA 1UXHA 4RQUA 1WJGA 3FVVA 4LSGA 3W3AD 5GIOE 4GZ3A 1JQDA 1GNLA 3EGDA 1LXCA 1VCIA 3D3EA 3AM3A 4YI5A 2QG4A 1K8AW 1FB5A 4Q48A 1EE2A 1JR9A 1Y8RB 2A58A 5GONF 3B40A 2BDUA 3K0BA 4IFIA 4YRFA 4WCFB 3LDTA 4MGKR 2YICA 3QVKA 2Z2ZA 1DRKA 1NUSA 2H4JA 2AHYA 3ANLA 1JDVA 2JHGA 1IWOA 4LVUA 3V46A 3G8AA 4DMHA 4B3DA 1X7GA 1I3CA 1IH8A 3KWLA 4Y98A 3O4HA 3DEFA 5REQA 1ZG3A 3RTCA 5G0TA 1KY4A 5HTOA 2O54A 3AL3A 3BH7A 3AP2A 4YMLA 3I2IA 1NW6A 3UMBA 1PF7E 4JGBA 2EBWA 1SVMA 1QRTA 3BGIA 3C3BA 5KINB 4K7JA 3IBYA 3RA6A 3DBOB 4ZFNA 521PA 2ZI5A 1DK1A 2VGNA 2FUG6 1MCZA 1SBCA 2OD9A 4GLFA 16PKA 2KX7A 4UMDA 4QM6A 2O8EA 4PO1A 3K03A 4GQAA 3W2FA 5JAHA 3DSQA 3H1KH 5BN4B 4LWZA 3H8WA 4M86A 1K6XA 4PFKA 5DCYA 3V8NA 4RUFA 3PN1A 4CM4A 2BH2A 3T3HA 5G41A 4PZ0A 3TFWA 5ARCA 2UV8A 4C0JA 2I78A 1QGOA 5F4BA 2ZDHA 3GRYA 1H6CA 4Z4FA 1UAAA 2OFOA 2PGLA 1ZCFA 1M2WA 4ARBA 2JGJA 5AW4A 5IF9A 2Z83A 2HA7A 4ZYZA 1I33A 2JLVA 3C3JA 4XVUA 3NTRA 2H1HA 1RJEA 4L9RA 1J0CA 5FADA 4LXUA 3QYPA 3QVNA 2JJ1A 3E2MA 3DGFC 4TWBA 5HXZA 1GAWA 3VYWA 3IEWA 3LOQA 5JQWA 1S72V 4NHEA 2FMHA 4YT4A 1NC3A 5A4DA 4ZOQI 3MLEA 1RLGA 1XPRA 1BKSB 5AOBA 4LYEA 1OXVA 3JARA 2IHNA 2ZD9A 5DTEA 2YWDA 2C99A 3R3JA 4WLOA 5B30A 5BSWA 2OHFA 4UTVA 1J2JA 4ES6A 1C7FA 3O1IC 2AIFA 4RCZA 2I87A 4KREA 1X1DA 2XUGA 3B6IA 1N6IA 4ZZ2A 4TTJA 3EXG2 4CMKA 3VR3D 3QTBA 4MKZA 4BWVA 4R98A 4JIGA 1BXGA 4WBNF 5ALMA 3OU6A 2F8MA 4WPGA 3RVKA 5CLIA 4BB5A 1R5NA 2J3EA 3FOFC 4LGYA 2ICAA 5IJ9B 5GQSA 3FB8C 3ZY6A 1H22A 1WPQA 1Z33A 2HB6A 4WDRA 1G3QA 1KOLA 2H2GA 3D0RA 1H3EA 3WYDA 5HMMA 2ZM5A 4W9NA 3HGQA 5F5LA 1BSVA 4R2HA 2V0GA 2ZE8A 4TV9A 1HG1A 1Q86W 4KYUA 5JR3A 4YT8A 1NE2A 4TMFA 1CUCA 4MS1B 2GTPA 3AI3A 5KYNA 4R3WA 5U1PA 3ZK9A 1AS3A 2ISSD 1D1TA 1S4MA 3CRMA 1AI6A 3BMCB 3GAZA 1U04A 4FN4A 3HDTA 4BMPB 1T43A 3V4RA 3ZH2A 1NBMD 3ORQA 1I4OA 3GJQA 2QD1A 3GEGA 3F0DA 1HSZA 2SNIE 2VUUA 4GI7A 4WV3A 3NBAA 4YRSA 1G4AE 4G37A 2P0YA 2GF9A 4F3RA 4Q6GA 1S2DA 3QVMA 1Q16A 1GEEA 2Y4UA 2J6CA 3D6HA 3DE7X 1DAPA 4M0EA 3EAFA 1NM5C 3PNOA 1M2OB 1JFTA 1ZUNA 4AQDA 1U7WA 4XGIA 2GVZC 3U39A 2XPCA 1BRMA 5AXCA 5JW6A 3HI4A 4BJHB 1V8PA 5T4FA 4HZIA 1WD7A 2W4MA 1MNQA 3NHMA 4QXMA 4G24A 3A2KA 1IQ0A 2LQTA 1X7YB 2Q9CA 3GGPA 3ICQB 2GXQA 3DG9A 1GT91 2HPVA 4DCNA 3L9DA 2RHBA 5HK8A 2JLCA 2NTVA 5AUQA 3S2YA 2C4NA 1I7NA 4ZZ0A 5DIZA 4ZAXA 3WZMA 7MHTA 1MX1A 4N7MA 1T2VA 3DVSX 3PNKA 1YZQA 3L4EA 5MN6A 2WKQA 4MVJI 2A1TR 4WEQA 3PPYA 3OBYA 3NUQA 2KBFA 1P1JA 4AJJA 5ED4A 2HDWA 4D7SA 4YJ3A 2Z6VA 2QR2A 4MW6A 4RF5A 3I0NA 3LCVB 3QVUA 4WOCA 4BQEA 4M1OA 3R5JA 2XNKA 1Z0KA 1O94A 5JNUA 1GQRA 5BY1A 3FY4A 4RCYA 4FHDA 5JAOA 3F78A 4IS3A 4YAJA 3F7YC 1ZGGA 4UOZA 1R1BA 1OFIA 1PG0A 4HMOA 4N0EA 5J1TB 2ZBGA 4LHSA 1XYVA 2W0SA 1R74A 2KLBA 5C1OA 5EIBC 4ARIA 3B8MA 1M6WA 2M1XA 4PLTA 4QDXA 5FR1A 3N0XA 3IJPA 5ALGA 4WFEA 5SYAA 5BW5A 4AHCA 4X3MA 1KE2A 4Y3UA 3H8SA 1NTZH 1CXZB 4AJ9A 2J7KA 3O65A 4Q3NA 4DLWA 3NHBA 3CVWA 2HPZA 3I5MA 2ZBEA 1K0FA 1KEEB 2F1IA 1GFSA 2OSVA 1N5IA 1IOLA 2Y92A 3KCNA 3FYSA 1PTJC 4A5OA 4NICA 4MULA 4Q39A 1FUIA 1GQYA 4TKUB 4AF8A 5AW9A 1S2OA 1RXEA 2E55A 3OLQA 2ALJA 2CL0X 1XAJA 1Z4QA 1PI3A 2AE2A 3PJEA 2JIZG 1T9DA 4ZO4A 2C0PA 4PIMA 1C3OA 1MVLA 3T7JA 5AVUA 3VKHA 3QY9A 4EBFA 4D3YA 3MJ4A 1U63A 3W9BA 5JNRA 3I3OA 3L6CA 1IX9A 2DPYA 3IDAA 2A06H 1GN8A 1SBTA 2NVWA 4RANA 1EPUA 2OD7A 3WIBA 4ZT7A 5LU8A 3OI7A 2VZ9A 5IKEA 3D3IA 3VO1A 4P5EA 1SCDA 4C9BA 1GKIA 1NF9A 4MVOA 3RAEC 2EQ5A 4IFBA 4DIOA 2UYJA 1ZQ1A 1DJNA 1CDDA 4RXTA 1Q22A 5JDIA 3EXHA 4LJ8A 1VHDA 2R70A 3T3NA 1GZUA 2A94A 3R0IA 3O83A 4QJBA 4P4GA 4M6WB 4TMXA 4HGOA 2NYAA 3X1KA 4L8WB 3BOSA 3QW4B 1ZN2A 4TTIA 3LFUA 2AC4A 1PD1A 5JI3E 4I1PA 2J7PD 4ZU3A 2RJ3A 4AS1A 3AXSA 2HG5C 4OYYA 1JIXA 4MO2A 4QG7A 4L6IA 1TKCA 3I83A 1XMSA 1CHDA 1NA5A 2Y99A 1SIUA 3A6PC 1T6XA 4AILC 4QGSA 3EZ7A 1X14A 3G85A 1LF0A 1CQIB 2DY0A 4DDTA 4G01B 2XOXA 4AURA 3L84A 1XEAA 2FPLA 4BTVA 1CRQA 4N5MA 3JRWA 4U2DA 2FXIA 2ABWA 3L5OA 1RACA 2I65A 1UXJA 3E48A 3VHXB 3BJIC 5LU9A 1K0UA 5FPTA 3V8PA 2Y66A 1QRAA 3HZOA 2CWWA 2H8CA 1P6QA 2FUNB 2I4TA 1P3JA 2UUBB 3CD6V 4IICA 4D81A 1SVWA 1R3DA 1V43A 3G1UA 3QPDA 4P8RA 1J0DA 4N9WA 3QHPA 4GI3A 3ZHZA 3KQWA 2HYIC 1XMVA 4ZQIA 1Y3DE 4HAZA 2V8BA 3MTAA 2C94A 4IRUB 2KKWA 3RS4A 4J4BA 4I3FA 3RYIA 3OOJA 3O1LA 1SU4A 3E7XA 2OLEA 3EPJA 1BO6A 4HTFA 3MILA 5AMXA 3TH5A 3P3PA 4OQNA 4FE4A 1GU0A 2MHCA 4LBZA 4MW0A 1XALA 2C8JA 3G88A 3MBIA 3CZMA 3MB8A 3OWXA 3BHJA 2IBZH 3FOZA 1NF8A 4GMDA 2VAMA 4YA6A 1EFAA 3IOCA 1QO9A 3JWGA 3OZEA 2ASVA 4BGVA 1KK2A 3M6FA 4S0ZA 5HNKA 3EIWA 5B64A 4GE0A 4PQFA 2JFVA 1AT1A 1UQRA 4EX7A 5I4CA 3T3OA 4ZMSA 3E8MA 5EPUA 2Q3BA 5JZSA 3OTHA 2O8CB 2C4UA 5EN4A 4O59O 4IXDA 1E8NA 4EHHA 3EFBA 2V0CA 3WICA 2G8NA 3EZ9A 4KKXB 1EDDA 2DWQA 4OMUA 4XE5A 5KVVA 3AINA 4JLOA 1ESCA 3LXXA 1IUPA 2ONZA 1L2TA 2LJ2A 1V37A 1X25A 3IT1A 2LFRA 2XWQA 1J9GA 1STOA 2YIDA 1U28A 3ORRA 1WZNA 2HF7A 1SULA 1YUNA 5CVVA 1P2DA 1EX7A 5BQ5A 4D25A 3PEEA 5AI0A 1CR2A 1X9GA 3L0IB 3L41A 3SF8B 2GRUA 3V9AA 1TF2A 3VVLA 1O6ZA 5CT5A 3LJKA 2WT4A 4P84A 4NS4A 3OUUA 3QMMA 2EDCA 1RRGA 4DNPA 1XHLA 1KSJA 4V0OA 3KU1A 3DUWA 4URHA 4MDYA 4GZMA 1DUIA 3UW1A 1A50B 3KBOA 1W2HA 1SRQA 5ALFA 1ZMRA 1KY2A 1W9MA 1Y1TA 5L3QA 2GKSA 1Z12A 2R1VB 2B0CA 1BGWA 3DKIA 3IH5A 2Q6TA 4QDKA 1P6XA 3RC3A 4II7A 4DSTA 2I91A 3B6NA 5K2MA 1U40A 4FU0A 5EB0A 1VRVA 1R0SA 1U5CA 5IN5A 5JMPA 3M4NA 1A97A 5I7SA 2YYEA 2WHXA 2D62A 2HRQA 1YS7A 3WMEA 4DIMA 5J47A 4DCOA 2F1JA 2HV9A 1UT5A 1NTOA 4EEQA 4UM8B 4QDUA 4HR7A 1M0SA 4RH0A 4MXDA 2VHJA 3ILVA 5C5EA 5B2EA 4ZPJA 2R9IA 3EEBA 4AYTA 2VPQA 4F3YA 4GOKA 2ZBPA 2G7ZA 5FTJA 4BCBA 4RC9A 1Y48E 3TFQA 4A8HA 1W2BU 2CMKA 3QKSB 5ILGA 1SQVH 4FDUA 1QNFA 3GIDA 4KR0A 2JGDB 2YQ5A 2P4SA 5CJJA 5F52A 3DTVA 4E14A 3CT6A 5EUBA 1WLYA 1Y76A 3GPBA 2OBNA 8OHMA 1H0KA 1T3ZA 1I0ZA 1NT2A 3JQ8B 2IK8A 1K86A 5DM4A 1XVTA 3HM9A 4ZHQA 3B38A 5FOSA 2YYAA 1JH9A 1AI4A 4DM3A 3LUKA 1VG1A 4BTLA 3IEKA 3H9VA 1QONA 1S2GA 2IVZA 3LP6A 1VCMA 1BW9A 4EBBA 4BFSA 3I2JA 3EGVA 2QE7G 2YZMA 1VCOA 2BEVB 2P9FA 5DEDA 4B48A 2C2KA 1YHNA 3QZUA 3IEIA 3UB3A 3VSAA 2XNCA 3WAJA 1Y1SA 1OCEA 3IBTA 1U99A 3RUCA 3QEKA 1GO3F 5K3DA 3TIXB 1QBKC 1RZRA 1EFHA 1H6DA 4JI7O 1K73H 2KB1A 5FKJA 4CE6A 2YIAA 1HQDA 3B12A 5JLJA 4OF4A 2MCFA 2GESA 3CE6A 1TGYA 4CMCA 3PGXA 2HNAA 1S7GA 3L05A 1EWRA 4FGZA 4PHFA 1QFSA 1KO8A 1JBQA 1ZINA 2EZ8A 4MQBA 3H1HH 5FUXA 1L8DA 2PU7A 3BMQB 3A4MA 3ESQA 2ZRHA 3Q7TA 3ZXXA 2I4RA 4I9FA 3UGKA 3JWJA 3GT7A 4IPTA 4JPRA 3ECCA 2J6HA 4RZQA 2CCGA 4PN3A 1PW5A 4UV8A 2PT5A 1KO7A 4PVDA 3HHEA 3JTMA 3VZPA 1G9SA 1KYIA 4EGQA 5AKKA 2CVOA 4MPTA 5BV1A 1TQ6A 3V1LA 2RHCA 4ZI5A 3PJRA 4O5AA 4KH0A 4MSWC 1V0JA 2ZYIA 4AKGA 1U9JA 2G3YA 3BD6A 2GGSA 3DW1X 3QTLA 4YEDA 4EPWA 1E2MA 3LMEA 3L6UA 4PFQA 2I29A 1RKBA 2EFCB 3G6BA 3CZ4A 1F51A 3IB6A 1NVFA 4NFSA 4IG9A 2QTOA 1OXUA 2Y93A 1H8HD 3K0KA 1VSBA 4X1KA 4QODA 2HQOA 4X64O 2FE4A 4PLCA 5JNVA 1S7CA 2JNBA 2XYRA 2C5LA 1DBQA 1DJOA 2VLIA 2BHRA 3NDPA 3TDNA 2V4MA 3JQ9C 3VPGA 3VV2A 3ASNC 4ZGGA 4O63O 3WP1B 3IB3A 1Z5PA 2R60A 4DAOA 1W6RA 1RMTA 5BUQA 2FEMA 2Y1EA 3LFTA 2BFPA 4V3BA 4I6EA 4RPJA 3GNTA 1GSIA 1TD9A 1VZ3A 3D1VA 1HDEA 3KVNA 4YCMA 3HKBB 1ZU4A 5LYJA 1SBIA 2LGJA 5BR1A 2LV8A 1VXRA 1Z6QA 4XYBA 3DZKA 4YXWG 2M32A 3R75A 4KVZA 3W1VA 2WOOA 3OTFA 5J3JA 2IM9A 3R20A 5FBRB 4EGSA 2B4QA 2YWRA 1DDGA 4F9FA 1IG3A 4N03A 4GKKB 5EUCA 3BWDD 2WMNB 1HTWA 4ZQEA 1G7RA 1S3SA 1ZU5A 1R0ZA 3WYNA 2BJWA 5HF8A 1GAQA 4U7NA 4WNYA 2CBGA 3ZVKA 4Y2PA 3VAAA 3BIXA 1GARA 5L53A 3QITA 3FMOB 5J2TF 4QUJA 3WWOA 1GGNA 2WD9A 3KQQA 2NZ8A 1L7MA 1MTOA 3JWIA 2QJOA 1M1YE 2Z6AA 2R4QA 4QFMA 4LZLA 5C1PA 4BKMA 2EAUA 1WVIA 4CUKA 1R5JA 1GM5A 3H0CA 3QI7A 3SIXA 2D1RA 1EQUA 2OFXA 2HNBA 3FTEA 3RJ5A 1XZIA 1E3WA 3X43A 1LY1A 4CC5A 1WDLA 1QLNA 4G9EA 1ORRA 1X1TA 4L4UA 1WXQA 3G80A 4XPZA 1E8MA 3D0OA 2IYPA 1N4CA 1SQGA 2E74B 2IUYA 1EIZA 3WX0A 3LF2A 3QUQA 4IMJB 5F2EA 4JC5A 5CDSA 2AOXA 1DAIA 3TL2A 4IJUA 2IY8A 2J0SA 1E7MA 1N4AA 2AHZA 2Q0QA 3KKPA 4QRHA 3RVBA 1Y1RA 1CP9A 4URUR 3KQYA 4BDSA 5AUNB 3MWYW 3NANA 5JNTA 4KQGA 2PQ0A 3ID6C 5K0FA 4ENSA 2WA2A 3ZCXA 1V54B 3LZDA 3GT3A 3GB7C 3TD6A 3JRXA 2WP0A 1ZMTA 4YVFA 5F2OA 4DABA 4L78A 1Z4KA 4RPIA 5BW4A 1KQSU 4RFSA 5KPDA 2OCLA 3E9YA 1ZL2A 4HN2A 1F4NA 1RAFA 4PVCA 5CDFA 1TZMA 1SWWA 5CGQB 3ENNA 1L8QA 5ALIA 4PIPA 1W1UA 2UYNA 1BS9A 5THKA 3IAM6 1PUXA 3HSSA 4BVFA 1AURA 3UXYA 1XRSB 4D46A 2HHHO 2MDTA 4FM1A 3Q4GA 4HT3B 1X1EA 3ZJTA 4EZIA 5G0WA 4DG9A 4OQYA 2X9LA 4DF3A 3MCVA 1IXMA 3AT1A 5IDYA 1LC3A 3THYA 2HA6A 3UGTA 2HLDD 1QIGA 1TX4B 1Z7WA 5B5EZ 4DRZA 1H2AS 4PONA 2IYXA 4OLHA 4H3SA 1GSHA 4AL4A 3G71F 2WJPA 4UZSA 4IEIA 1C2TA 1N34O 5TPZD 1IDN1 4GC5A 5GM2A 1EE1A 3FM9A 1W52X 3EF3A 2WHQA 1N0HA 2C5FA 2E6UX 2XZOA 4J7KA 2BT4A 1Y6FA 3BILA 3NDRA 1P1RA 3AQIA 3FVTA 1HM5A 4JP8A 4UNQA 2D1YA 2QTNA 1YR1A 2V6MA 5C7OO 3OZTA 2P1DA 4G4WA 3AYZB 2BFAA 1MHPA 1JR3E 1PWHA 1OZAA 4Z3KA 4H44B 2QL6A 3VC1A 3WLSA 5KC8A 1CDOA 2P4VA 2VBFA 3LBIA 1M1KH 4RTQA 2PZLA 4M7OA 3KHNA 1KUQA 2EX0A 2R6FA 4F85A 4BCCA 3TZHA 2G71A 4RE6A 2BE9A 3IVCA 7YASA 1BU8A 2FG6C 1QVZA 3TOCA 3QG5A 3C85A 2JJ1D 2FX5A 4DLTA 3A14A 4NXNB 3OQ1A 3DVAA 1KI2A 2L6LA 4IX1A 3SMQA 4C04A 2BGMA 4W1RA 3VR6D 4MR8B 3BEDA 4QJIA 1OZHA 4HEHA 5EQDA 4MLDA 1L4UA 3R2JA 2Q0AA 3BWCA 4TN1A 3HVHA 3D6VA 1ZD4A 3CC8A 5KO2A 4X5OA 2PWYA 2QTSA 3ZGNA 1RFYA 1MC8A 4L73A 4MGHA 3MXTA 4H1HA 1Y5IA 3ZOKA 1T5LA 3VZBA 1JA0A 2QZSA 2YS8A 3DTTA 4DUPA 2JGAA 4ABMA 1QWOA 4HH1A 4JKOA 2R8XA 3K35A 4A2PA 1Y8ZA 1VG0B 1Q1EA 1J2UA 4ALIA 2Y67A 3EHEA 2V03A 2HW8A 3L0OA 4X63A 3ASNB 3IAFA 2N05A 3H65A 1K4CC 1VB3A 1GNVA 3KUXA 3T1YB 1ORTA 4DM7A 3GDWA 4QQKA 1ID8A 4DQDA 3U9TA 3CF4A 4BO9A 2AZTA 2Q4TA 3KZMA 2DKNA 2VJQA 1F4MA 1JU3A 4ZCTA 5D7NA 1E1QG 3E6AA 1IG0A 4BV2A 4P4SB 4L8YA 3ZN2A 4W9NC 4CKYA 4FMCF 1D5WA 2QU7A 4DLKA 3WO1A 3BVPA 1TLTA 2QVBA 3PEWA 1XLWA 1OFTA 2ECKA 3M7MX 1DJPA 1KJZA 1VJGA 3M82A 2PXAA 2ZWOA 1PQYA 2CH7A 1TB4A 4EMTA 3PAFA 3IGAC 4G8DA 3TSOA 1Y6JA 1TUIA 4BX0A 1KE1A 3QSYA 2YHUA 5B7NA 5HZHA 1ECLA 2O1XA 2HP3A 1N0JA 4H15A 5JY6A 2X7XA 3W1WA 3SZOA 4BX8A 1UBTS 1I30A 4QT4A 3C8HA 1UFQA 2LNDA 1K08A 3MTDA 1MG1A 2OCHA 4OSPA 2IQIA 1GL7A 2QHXA 4H9GA 4M0LA 2EFDB 1NE7A 3I9LA 1CUYA 2XUOA 3ML0A 2UXXA 4BV8A 3AJEA 1Q57A 5JC8A 2A5JA 3WGJA 4NZ9A 4ZOAA 4BWGA 1DJMA 4RKRA 1WO8A 1WP9A 1WD5A 3KRTA 2HSZA 4NPCA 2CE2X 2BOVA 1HW7A 4CG1A 1U0OC 4DJTA 4P2GA 2P35A 3WLTA 3EWSA 2A86A 4ISBA 1XUOA 5KWJA 1FDRA 2DUNA 2IV3A 4EH1A 3WLKX 4CKWB 5B3KA 1GQFA 1OV6A 4TQUS 2O3QA 1IJKA 2JCSA 1J07A 4LRSB 2K5UA 4YP1A 2XDQB 4OYLA 3AVOA 5KYUB 1YR7A 4QT0A 1GYPA 4ER3A 2FEWB 5I6DA 4N23A 2CXNA 3KTFA 3O9MA 4DMGA 4DZRA 3HG7A 4KIGA 3QM1A 1CFZA 4R40A 4MV0A 4YCNA 3QHAA 1YJCA 3VYUC 5AVTA 1SXQA 4O4HF 4RWZA 4TKMA 4JVNA 4R7ZA 1V6CA 4JP3A 1O94C 1V11B 2M6SA 2B1RA 4RX1A 4F97A 1PR9A 1BHQ1 2DUJA 3RFXA 1O94D 2YWEA 3N8IA 2YFYA 1OAPA 4A92A 3WLMA 4F3TA 1PS0A 4BZXA 2JFGA 1GYQA 3GF4A 4BLUA 4F6EA 4YBRA 2CYAA 1S1MA 5REQB 3BXFA 3ZZNA 1L5RA 3RVZA 4W63A 1DEAA 3JQBA 5TPWA 1FL9A 3LX4A 1U1GA 2A2ZA 3QA9A 1MAHA 3GDFA 5E4TA 2Y1WA 2KTUA 1DMRA 1TPZA 3SMVA 3THSA 2GYWA 4M76B 1U4OA 3VC2A 4ED9A 5AVKA 1DRWA 1F60A 2PI4A 3RU7A 2OO3A 2HWWA 2OCDA 5T4EA 2O8EB 1XRNA 3WZLA 2QDOA 3WMGA 4CM4B 5CBGA 2GTAA 4HNSA 3EDYA 4A5UB 4EITA 1AZSC 5K0SA 1DRUA 3PJGA 4GOLD 2IEAA 3BBPA 2VUHB 3EBOA 4OMDA 1G17A 1WXGA 2PUJA 1PKXA 1J2RA 4BAGA 3NHWA 1M57C 4ENTA 4J41A 3NOOA 4Y9UA 5I9MA 3T3DA 2GPYA 1TCAA 2IP4A 2HK9A 4KEAA 4GL2A 3HZRA 1G5TA 1JZSA 1AQJA 1VPTA 2A6PA 5SYNA 1VQ6F 2A0WA 2AXNA 4HATA 4ZCLA 4MUIA 1U0RA 3VO2A 1X80B 4UHEA 1J9ZA 4TKVA 3R44A 2H8PC 2BGRA 2ZUTA 5JDIC 3ZDDA 3EXHC 1ZRNA 2GARA 4IEEA 2C9OA 2HLNA 5A2GA 1IBMB 3JARB 3WFJA 4MSUA 5C53B 1ULHA 1L1FA 1WE2A 2AZ4A 2JATA 1SCKA 1YUBA 3PZRA 4DG5A 4A2QA 3E7WA 3OURA 5EINA 4CGZA 5ALUA 4Y6RA 1T0BA 3O4RA 3TUZC 3VNRA 3UHAA 3KL4A 3CEPB 3DOHA 1ABEA 2W8BA 4BT5A 1BXGB 3BTUA 3BJZA 3K0GA 1L4NA 1EFLA 2DOKA 1AXRA 1IV3A 1VPLA 1REQA 3J81k 2WTNA 5SY6A 1Z39A 3W34A 1WV0A 4CG0A 4JN6B 4B6QA 2GK3A 2C9DA 3RNLA 4H16A 1K2VN 3KFLA 1G38A 4YRPA 3GLIE 3K96A 4PQYA 4S12A 3HPRA 3ZMTA 3IKLA 1HC7A 3Q7QA 3CCRF 1CF2O 1MR3F 3TDKA 1Q6IA 1TJPB 4EB8A 2QQGA 2F8TA 4TV9B 1J90A 3GROA 4LJ6A 5DNCA 4GI1A 4N3CA 4AZSA 3WHPA 4EMUA 2WFLA 1TJ5A 2N74A 4KK3A 2P69A 4WI1A 5JAPA 1NFFA 1VQ8V 1E5XA 4GCZA 2F4NA 3PDJA 2XYVA 3V7FA 1GR1A 1LC0A 2IHKA 4FFPA 2H4YA 2JVJA 2PKWA 5JO0A 5BYKA 1JXMA 1KYYA 1K66A 3AHHA 1TTHA 3A1TA 4D9GA 1H2WA 4RHAA 1NQOA 1F23A 1MRZA 2QQFA 1WZIA 5A9GA 2XUDA 1P6UA 5ALOA 3UWOA 1AHPA 1RYHA 5A5VA 3AHGA 3BKXA 2LZ0A 1LLDA 5BQFA 4WXEA 1GTVA 4Y2HA 3NBXX 5F3WB 3A3NA 3I53A 4YP7A 4C0HA 2EF1A 3OPNA 2VYCA 3LWOC 3DBHA 5JAMA 4M0FA 1RI4A 3ACBA 4ZDIA 1O08A 1D0SA 3SX2A 2XWJI 1JJIA 1NXSA 2QMOA 3D2BA 5DV9A 3AKEA 1M5UA 3TNFA 4J43A 2JARA 3F1LA 4JVSB 4BZQA 3S1SA 1MV8A 1KR2A 5LQNA 2BEWA 1N5OX 4JCOA 1LTQA 2A30A 1B7GO 4ZI3A 3DQPA 1TQ8A 4B4WA 4ZQGA 2LPMA 3NWOA 2Q2OA 4ZYTA 1QGUA 3R4VA 1XRRA 1OLXB 3RRBA 1SZQA 3ZZMA 3LW8A 3NC0C 4J07A 2XWPA 1U28C 4YJ3B 4W4KA 4R8CA 2AXPA 5TGDA 2Q5LA 4Q05A 2JK5C 3OVMA 4JTAB 3IS3A 4EMBA 5KX5F 5IX8A 2ZT6A 3GUZA 2ATVA 2H7VA 1ZGAA 1T26A 1ZJ4A 3MGCA 1HO3A 4BY9D 4OHWA 2H1IA 4D4HA 1UK9A 2IS1A 4MTFA 1XKQA 5BN1A 3QOYA 5EC2C 5CUQA 3OE7A 1ADFA 1VGRA 1DBSA 4FLMA 1ZBDA 2GPWA 3MBKA 1QGDA 3VTZA 2X77A 4JWTA 4KIFA 4RD2A 2MSEB 3HCPA 5EP3A 2CMDA 1YE3A 1TUGA 1E5DA 4Z0NA 5L3FA 4CM8A 2YXBA 2DAPA 4F0JA 2PKQO 3K8OE 3ZQKA 1Z6AA 5ERGB 2ZIUB 3M70A 3PRYA 3AERA 4BASA 4QGGA 4DRYA 1HXHA 2YHAA 2H1OA 2VYVA 2O5RA 3GLVA 1Y5RA 4JR0A 1WB8A 2VNHA 1PZXA 4C1NA 2KI5A 1R4NA 5E7IA 3JYNA 2HPAA 3EE6A 4WZAE 4JUAA 1UZLA 1B0PA 1FZTA 4J0JA 4TGLA 3DR5A 4YV1A 5LP6B 1R6AA 1M57B 3DF9A 3APOA 1RP1A 4C08A 1C3OB 3BSYA 1XEFA 5I47A 3OT7A 2PX6A 5E95A 1P8JA 1HT2E 1DGQA 3D5EA 4WZBE 1T10A 3K8YA 3G6WA 1OFGA 3N8NA 2X6QA 4BBZA 3FHLA 3HJCA 4UHDA 3ELDA 4P4NA 3EQ8A 2WM9B 1PPJH 4EQ6B 2ZFUA 3IKEA 1D5NA 4XIJA 1ZHFA 1IULA 3HDYA 3HB9A 5ANRB 2Z04A 1EG7A 2GK4A 1XDGA 3ABRB 3B6ZA 2V8OA 2AQKA 1OI7A 3GNLA 1XRMA 4RK5A 1YJ9F 3M5WA 5TVGA 2Q5ZA 3LTNC 3KV1A 3E58A 4MGIR 4DV5B 2ACWA 1E66A 2I9KA 4Y1GA 2AI1A 1RLJA 2QRQA 4H4DA 2FW8A 4JS0A 2JIDA 1E61A 3W7SA 2WWTA 3HRHA 4F84A 1EBFA 2P9JA 4LC0A 2O52A 3MCUA 2FW9A 3ZX5A 2IHYA 2JLWA 4B0PA 4FJ0A 3JQGA 1U5BA 4PX2A 2UU9O 1KU6A 5JTTA 1ADCA 2AEFA 2VDUE 1U9CA 1FK8A 4Y2YA 4MTOA 3M6AA 4DCGA 4OU5A 3AXTA 2DYYA 1QQCA 4XM1A 1T0HB 4TXMA 4GMGA 3SS9X 1G6HA 2VRNA 1BU5A 2IXGA 4BNZA 3J81A 1VM6A 1PFVA 3DC5A 3LBNA 5IDWA 3VO8A 2I3BA 5JCZA 3PD0A 2BCGY 1N5DA 2PX8A 2VZLA 1RAGA 2V7WA 3RGWS 1VCHA 2PL9A 3LWDA 2OL4A 5HRUA 3TAXA 1RE1A 1ZIDA 2ZYGA 3CC7F 3F71A 3PXXA 3BE4A 2JAOA 1OXKB 3H1PA 4J03A 4GX2A 4BE4A 1Z6YA 5HM6A 2H2AA 2A3QA 5KIAA 4DQ0A 5FAXA 3KTAA 4KMSA 4RM2A 3CX6A 3DJYA 1YA8A 3CWCA 3E3OA 3A05A 4MWTA 3ZWVA 2DJVA 1UC5B 4QATA 1C81A 1LV8A 2Y76A 1WP4A 5E9JA 3ZMSA 3PCRB 2FG7C 2IYTA 4B9EA 3OMAB 1GQOA 4RV5A 4LCUC 1NVDA 4P98A 4JT8A 1JIIA 2O3UA 1W581 3B3FA 3NBQA 4P58A 1VSTA 1R5OA 3W1EA 4HDKA 2CMHA 4ZJZA 2ZI9A 3CX5F 3LWZA 3L7YA 3F6SA 4CVNA 3X0DA 5IVPA 1WULS 2HWUA 4RTLA 721PA 1IHYA 4P9PA 5LQJA 3OX4A 2AG1A 4IHJA 5A5FA 3HA2A 1G7CA 3HRIA 3M1IA 2GRJA 1CUBA 4OGLA 2COEA 2JI4A 3B2QA 1Z0DA 3OE1A 1OH6A 5GM1A 1ZGJA 1CD5A 2NO6A 4PF1A 2X5NA 2ZI6A 1E98A 4TZ0A 1EBBA 4Y6PA 2CLLB 1XN1A 1DX4A 3IP6A 2TECE 1EP1B 2C2XA 4QFBA 4GYJA 5DNAA 2Y8EA 5KVAA 3ANNA 2FGYA 4O25A 1N2EA 2AX3A 2IYRA 2O3RA 2JJQA 3EFHA 1UPXA 3BTVA 1XAGA 3OY7A 3OX2A 2EBOA 3SZUA 2N48A 3SIUA 1QFJA 3QV2A 2VZ0A 2HHLA 4KQ9A 3CCLV 1ZM2A 3K32A 4M8LA 1ONNA 2PPLA 3ILHA 1PDWA 5A0FA 1XTUA 4GM1A 1RAEA 1W7AA 3PFNA 3LBFA 3BWBA 2X0EA 1OWPA 1XNQB 1FDIA 1Z82A 2PQ6A 1N5KA 4IIFA 1WXDA 3TOVA 2O7RA 2YHIB 4DXDA 1IZ9A 1CLUA 3VPSA 1ZK0A 3HR8A 4BO4A 3BH6A 3HB3B 3QELA 3C15C 2NO4A 2HHAA 1C41A 4S1NA 4O4JF 4NS1A 3ND9A 1XHFA 2WLJA 3DE4X 4JAUA 4XI9A 4JZKA 3M6IA 3G17A 1DQNA 3OT1A 2XAGA 4BLVA 3CMAV 3ELYA 1G0OA 3B6MA 3SYRA 2EHJA 4UEOA 621PA 4LDQA 1FX1A 3AY0A 4DRXB 1E62A 3K5LA 4PHZA 1T3TA 4ITVA 3KKOA 1E2LA 3KSRA 2ZJ5A 2PFSA 2QUHA 4MQLA 3ONDA 5FLXA 3NOQA 4B3RO 3K59A 4LW8A 5D87A 3KPWA 5C7IO 5IHPA 1RLOA 3KEGA 4NJEB 4X93A 3T7CA 4I6JA 4JMLA 4EEXA 3RSQA 3BF8A 4Q34A 3GEIA 2Q67A 3ZWDA 3CCMF 3FMIA 4INPA 2BSXA 3U56A 3R5TA 4Q4AA 1GNQA 1VKZA 4G5FA 4ZVTA 2FSFA 3EGIA 3HQ4O 1MOSA 4QUDA 1NXOA 4NFHA 2HD4A 3ND6A 4LF5O 1HR0B 1NMZA 1TEHA 4KX5A 2V96A 4HQLA 3ANSA 2AN4A 2XCIA 1VQVA 4HUJA 1FBNA 4BQPA 2IYNA 1QTRA 3VSDA 3ROEA 4KE6A 1E9BA 2X3YA 3RRFA 5A2QM 4QU9A 4HQNA 4JU9A 5HA5A 5IYZB 1E89A 2Q4EA 2R4UA 5LZ5A 1QRRA 1X7OA 3DKRA 4YPOA 3EWIA 4ZVRA 4DT1A 4RTMA 1Y76B 3KD2A 1KYQA 3TGLA 3HBJA 2GUZA 1TTTA 1YVRA 3CW2A 5EIBD 4EARA 1NT2B 1P4SA 3LL4A 4ZHQB 1SC1A 5KAIZ 1KMMA 3IQHX 1URFA 3RUAA 5C8YA 2FEKA 2EVWX 1CUUA 4I4NA 3R6LA 1BW9B 2YS7A 3PXEA 3TEJA 2H2IA 4CV0A 7REQB 2HY7A 1HOXA 4DY6A 1XKTA 4OBEA 2R8EA 4PYIA 4NENA 2H2HA 2B1GA 3CR7A 2A9OA 5FEUA 2BDTA 3EIOA 1KPIA 3NBZC 3A1CA 1FDWA 3GFRA 5IUNC 2Z5FA 2APJA 3MMXA 4UUAA 2H8KA 4E2YA 1KI4A 3T1HB 1UADA 1AP5A 2NYUA 3RT7A 2ZJ3A 4NB5A 3ICXA 2AZXA 4UUNA 3AVYA 3UFBA 4QZVA 2R9VA 2O2ZA 4OB6A 1MUUA 4WK0B 5DN6A 3WMWA 2Q5FA 3OMIB 2LW7A 2IEYA 4K88A 3F90A 2MSNA 1ADJA 5HY4A 4F2PA 2GD1O 4UUOA 1EFKA 3SJAA 3HNOA 1A8HA 2E4VA 1LTHR 2ZRQA 1KOJA 3WLHA 3O8CA 1NI8A 1TJNA 3OCCA 4RK6A 1EFRG 3BCCH 2PYLA 2YDEA 4O4IA 2IU4A 4MVJE 3L8GA 1QFXA 3PGKA 1YZLA 2PS1A 2PH3A 5T5QA 4Y2JA 1WXWA 3I01M 2WABA 4DMUB 13PKA 1R6KA 3U0BA 4H7FA 3EISA 1C7JA 5E0KB 4UTPA 3N87A 2IYFA 4DPMA 3JYOA 2PKXA 4DIFA 5FTWA 3WE7A 3C3AA 2FQ1A 4I3GA 3K6KA 2AFIE 2HKOA 3ZRXA 4C7XA 1V8BA 1K06A 4AKTA 3QH4A 3FBWA 5KJFA 1ZK4A 3H84A 1QYVA 1O95A 1F3LA 4G2NA 1CWUA 1NMYA 4RQTA 3L1KA 2BV3A 3SPJA 1X7XA 3JATB 2O3SA 2Z2IA 2R8BA 4X1KB 4JNKA 2CJYA 4D6YA 1P7CA 4YRQA 4CR7A 2RC6A 2J5KA 2ZJ7A 1ZOOA 2IODA 3EEYA 3L8FA 4JITA 4W4TA 3N1UA 3EGXB 2OTJF 2Q6VA 1QQ7A 1KK3A 2BUAA 5L3SA 1G3IA 4KL8S 1A8IA 1NQWA 4WH0A 3LUCA 1YU6A 1V25A 1OVGA 3PTLA 4FYKA 1RC1A 2A8YA 5EXPA 1H2BA 2AN9A 2O20A 4OKSA 2KYRA 4ND6A 2Y1XA 1CE8A 3EMVA 3GLFE 1VYVA 3D9QX 3EZXA 3GARA 1OIVA 3GJZA 3GA7A 4LV5B 5CFMA 3TR6A 2VL7A 2V6IA 1IONA 5AVQA 1EZZA 2CSLA 1K33A 2EFHB 1CIPA 1Q50A 5JMOA 4HLUA 4HQ6A 2Z09A 2XODA 3MWGA 3R6WA 4P30A 2ZRMA 4HC4A 1VKOA 4U2BA 1KAMA 5BT8A 1D9ZA 1AQLA 1MZVA 1PX2A 4AQYB 4DYDA 1F38A 4S1VA 4IIJA 3W8RA 4Z2YA 4UXHA 1Y66A 2AWNA 2MU1A 1H1LB 2R79A 4YJGA 3B7WA 3U3DA 3AFNA 4MCHA 3LY7A 2PGXA 3JX9A 1FYXA 4KFTA 2WSYB 1X70A 1PYOA 2GZRA 3MNFA 3FFXA 2EEPA 4OMCA 1F48A 4X89A 3GL9A 1EVJA 2R6CA 3AG7A 1E3WB 4Y8VA 1D2RA 1UMBA 3K58A 5TARA 3TRDA 1PZFA 2AEJA 2CXTA 1LBHA 3ISJA 3HUUA 4N3GA 1FP1D 4H7IA 1AZTA 4P6VF 1JPXA 4R1LA 4KQ1A 2G8LA 3WGQA 1W42A 1Z68A 3F7VC 4LXIA 3SI7A 3WAGA 1N6HA 3HWWA 4H2DA 5J40A 1I6MA 4JYYA 3GFVA 3IEXA 3PXCX 4A7PA 4AYXA 4MP6A 3NYIA 2O2GA 4BGIA 2M98A 3O2QB 3ROTA 2REBA 4LCBA 3DLHA 3U7QA 4C8IA 3VKFA 3LUPA 4N6NA 4RFSB 4YNBA 1VHJA 4D96A 3LSQA 1QQ5A 2HEGA 5JMWA 4HPWA 3CLRC 3T4UA 2PDAA 1L0LH 1LDYA 1CUSA 4FTWA 5A7HA 3S68A 3CTPA 1T9AA 4FI3F 5JJIA 2UYNB 4FVMA 2AN5A 3G6EV 1JI3A 3KJEA 1GPBA 3O2SB 2E5LO 1RD4A 3BHMA 3CJHA 1PZNA 2XB4A 1W55A 1Y8QA 4OFZA 5HUHA 1MGOA 4MW8A 3FETA 3JQBC 1UOPA 1E58A 3THYB 2V6JA 4QEDA 3ZD9A 5IVIA 5FYQA 2W6IA 1GCOA 4MCIA 1ONBA 5AXAA 3WTBA 3TQHA 2ZDIA 5GGXA 1FXWA 5CA3A 3PJFA 3O93A 1KI9A 2H1WA 2CBZA 4OJTA 1XG5A 3ZU3A 4R0VA 3I9FA 4F7DA 2XVXA 3KEQA 2OD2A 4RVHA 1P7YA 1UPTA 1N8RW 3PFGA 1TMKA 1ZPDA 4GR4A 4ARZA 1DQZA 5CD1A 2V55B 3ODPA 3EMKA 4JLVA 5BVHA 1O97C 1UEJA 5TC4A 4ZZ3A 3RSCA 3TJTA 3T7RA 4YGXB 1QYWA 2XCUA 3IRVA 1FQWA 4Z1MA 4ACBA 3NGLA 3NDBB 3WNZA 3E7PA 5DLEA 2I62A 4D8UA 1X2BA 2GF2A 2E3CA 1JQLB 4L75A 4YX9A 4INOA 5GP1A 2X3UA 1U0FA 5ALHA 2XAHA 1AKTA 4L0CA 3NVIB 3ONVA 1I2ZA 4ECEA 5HJEA 3IUSA 1YWGO 3V1UA 2Z1DA 1WS6A 3M9LA 1S2IA 2J33A 1FFCA 3IQXA 4Q3EA 1VL8A 2WA4A 1IZYA 3I9JA 3MAGA 2CFSA 2O2EA 1TYCA 5JBIA 4BNJA 3LWQC 1P77A 3IELA 3PRKE 1DXQA 1I3OA 1UC9A 3UHOA 1NKTA 2JJ8A 4Q4CA 1WDTA 1EGHA 3PL5A 4D0SA 2ZE6A 3WGZA 3CBGA 4G84A 4R9RA 4X6LA 2R6HA 2IOQA 1OTXA 2BF7A 3PDHA 5BMOA 3FR8A 1PUJA 3UWPA 2P11A 3WIDA 4KQ6A 3GLKA 4JWKA 3LLUA 3FNBA 4GMKA 2W8BC 1PNTA 2QG6A 3W6OA 1TCUA 3UBMA 1P84F 1A0OA 1ZSPA 3PIIA 1GNSA 4LJAA 1VF7A 1RRCA 3JXEA 3GIWA 5JY1A 3BRSA 1L7VC 1Z73A 3EARA 1NFQA 1LLCA 1YXMA 3DQZA 1A5BB 2Q7EA 2BD0A 4R9UC 3HR0A 2GILA 3HDQA 1A71A 3GRFA 1U2SA 4MITA 5FT9A 4NJOA 2J3IA 4ZK7A 4H7KA 1DAHA 2HP8A 1H6AA 1EAMA 3PFBA 1X8JA 3U6BA 4ALNA 2OQRA 4GPAA 1JXQA 4DGSA 5DCVA 5TSDA 5KQGA 3MBOA 3BAFA 4REQA 2ZBRA 2IW1A 2A5DA 3WOVA 3G4SV 4PPNA 4OHRA 4I1YA 3S0JA 3MC1A 1GXSA 3ENQA 1Z2PX 2CNOA 3CU5A 1FPOA 3SBEA 3PC3A 1TUEA 1WDKA 2PUFA 2HK7A 2JIPA 3JZFA 3WYGA 1TD1A 2GPAA 1GTL1 5GAPK 1Q7CA 1W96A 3RS9A 1DKLA 2RNBA 3A26A 4DUYO 3HL4A 2AR9A 3AJ9A 3PFFA 2P1ZA 4CKXA 1YMUA 1W48A 3RYFA 2BKAA 2C2BA 3HA5A 1J8VA 1XQYA 1YQGA 1IPAA 3W06A 5DNUA 4KRGA 2PLNA 3FKSD 3ZNPA 2HRBA 2RGRA 4FE7A 2FF7A 5KMGB 4ZREA 5TE9A 2P4UA 4P2BA 4UNPA 1X0VA 4GUAA 5F2KA 3IX7A 2FKXA 2QTBA 3TLBA 1O77A 1U3WA 2XEDA 3E8SA 1CYDA 4KQCA 4G4XA 1L4HA 4NRDA 3PVCA 2HJHA 4B31A 4BECA 2R5NA 4FJ2A 1HOTA 3BUSA 5L7YA 3SAJA 3GMDA 3NJ8A 4HAMA 3OHMA 3PFWO 5L3ZA 2QMYA 4FOPA 2FCAA 4UZEA 4U5QA 3R7WA 4PZYA 3VGPA 2X8BA 1INLA 1N0VC 1KHHA 1KEZA 4GF5A 5EJ7A 4YAUA 1CY1A 2FVYA 3UV3A 3ZX4A 3NBYC 5BT9A 5FRDA 2QRMA 3WK6A 4PFSA 2IYUA 1XZDA 4EB0A 4FOOA 1Y6RA 4LDRA 4H7DA 5BWCA 4LBWA 1GP2A 1ZITA 1UKYA 1YJNF 1VIYA 4R40B 4M1TA 1ND5A 2JFQA 3TD3A 4DLAA 3B6EA 1YDFA 4LAFA 2YUIA 1ZYUA 4XDHA 5HK9A 2RGGA 4KQIA 1Y4AE 4BNKA 1Q92A 1U1IA 4AW9A 4C6HA 1CRZA 2GNAA 2CWDA 3EXAA 3S55A 3LC0A 4WECA 1KTIA 1K88A 1B2RA 1TECE 3WPWA 1N2CA 4JLWA 2WLKA 2XMBA 4P36A 1SFRA 2WWGA 4XEUA 4LOHA