3HKDB

Tubulin-tn16 : rb3 stathmin-like domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 115
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkdB01
4X1KB 1Z5WA 5KX5A 3HKDB 4E6EA 3RYHA 2Q1YA 5LYJB 2RHHA 5ITZA 3RYFB 3M89A 3RYFA 5C8YA 5EIBD 4TUYB 5C8YB 4DRXB 1JFFA 3WGNA 4X20B 4WBNB 4LNUB 1W5BA 2XKBA 1W59A 2BTOA 3N2GA 2RHLA 4O4JB 5KX5B 1FFXB 2R751 5CB4A 4O4JA 3JATA 4O2BB 5CB4B 1FSZA 4O4HA 5CA0B 3JARA 4ZOLB 4U39A 3JARB 4TUYA 4X1IB 4DXDA 1W5AA 3VPAA 2Q1XA 4I4TA 1RQ2A 4B46A 3VOAA 3JATB 3JAKA 4O2BA 2RHOA 4FFBA 4YJ3A 2VAMA 4O2AB 5JVDB 4ZI7B 2VAWA 4TV9B 1TVKA 3WGMA 5IYZA 5JQGB 3N2KB 5JCOC 4EI8A 4U3JB 3N2KA 4EI7A 4U3JA 1TUBB 3JASA 3ZBQA 1TUBA 3JASB 3E22A 4ZI7A 3VO9A 5JH7A 5IJ9A 3HKEB 5CA1A 5CA1B 5FNVA 5LP6B 5FNVB 2VXYA 5EYPA 4X1YB 1SA0B 5LOVA 4IIJA 4EB6B 1JFFB 1RQ7A 4XCQA 3RYIB 4O4LB 4ZHQB 5KMGB 3E22B 5JH7B 5LA6A 3RYHB 5LA6B 3HKDA 4O4IB 3VO8A 2XKAA 3HKCA 4O4IA 4X1YA 1W581 3WGJA 3WGKA 4X20A 4WBNA 5M7EA 4DRXA 3V3TA 5IJ0B 3JALA 1W5FA 3JALB 5EZYB 5J2TB 2R6R1 4EI9A 4TV8A 5EZYA 5J2UB 5J2TA 5JCOA 4TV8B 5LYJA 2GVIA 4ZOLA 4YJ3B 4X1IA 3JAWA 5IJ0A 3CB2A 4TV9A 2RHJA 5MN4A 4I4TB 1FFXA 5BMVA 3RYCB 5J2UA 5BMVB 3RYCA 1W5EA 3ZBPA 3RB8A 4IHJA 5CA0A 4HNAA 4IHJB 4O2AA 5JVDA 4YJ2A 3M8KA 5GONA 5GONB 3JAWB 4B45A 2VAPA 3UT5B 3UT5A 3JAKB 5EYPB 2BTQB 5LP6C 4FFBB 5LXTB 2BTQA 3VOBA 4HNAB 4YJ2B 5EIBC 4I50B 4I55B 4O4HB 4KWEA 3ZIDA 3HKEA 1OFUA 4X1KA 1TVKB 5IJ9B 3HKBB 5IYZB 1Z5VA 3HKBA 5JQGA 5LP6A 3HKCB 4M8IA 5KMGA 5ITZB 3R4VA 5MN6A 5LXTA 4F6RA 5MN5A 4F6RB 3RYIA 1SA0A 4ZHQA 4I50A 5LOVB 4IIJB 4EB6A 3WGLA 4LNUA 4I55A 4O4LA 3C8LA 3N2GB 1RLUA
chains in the Genus database with same CATH superfamily
1RBYA 3MNFA 1PG2A 3WWPA 1MVNA 4PV1B 3M34A 1VB3A 1KAGA 3RVLA 3GJ8A 3MGKA 2QM0A 1UEJA 1OILA 2ODWA 1NVPD 3IKVA 2X8BA 1DFHA 2QE7G 1WXHA 4BWYA 3AB8A 5U1PA 1NW4A 2W8BA 4Y7CA 3AJEA 3TPZA 2PH5A 2PL9A 1NM5C 4O4JF 5CT9A 4EKNB 3LKBA 3KXPA 1R4MB 2JCYA 4MJLA 3LWQC 1R8SA 3OEYA 5DRTA 4LYDA 4U39A 3RFTA 3JARB 3BE8A 3A0BZ 2VUSA 3NRCA 3U7EB 1E9SA 3GRVA 1EFPB 4AZ3B 1Q1QA 5IBCA 2KS6A 4X6YA 5ARBA 1WB4A 1U80A 5P21A 3R7SA 2DY0A 3ILYA 4KPGA 4FINA 3DMTC 4HAOA 4CKCB 4JP8A 1IBLO 3JWIA 4I9QA 4AYXA 4DHEA 1GTZA 1D7AA 1YK1A 4I55F 5JBQA 5CEEA 3PD0A 4XPIA 3A9UA 4YQYA 1BS2A 2OZBA 1PZMA 1P3JA 1QHGA 5AOBA 3P9QA 4EAQA 2DR0A 3F73A 1MJGM 1GGKA 3UJ8A 2OFPA 4MARA 2EX4A 4PRKA 5EMMA 2AMTA 1YMUA 2GWHA 2VP0A 3FDJA 2VN8A 1IQ0A 2AGVA 2D1QA 1U7DA 2EEZA 1DBPA 4JJEA 4LUCA 5M29A 3U3RA 3CCEF 4AJKA 4EHIA 3EB9A 1P4AA 5PNTA 4C9BA 1AJEA 5IJ9A 2ILVA 3MCAA 4FSXA 2XHEA 1XPRA 4JP5A 2R72A 1MR3F 3AW8A 4UNPA 1OCRB 3UWOA 4B31A 4R8CA 3KUXA 2Z9BA 4UUNA 1BQ4A 1UP6A 2F00A 3CUTA 2OQIA 2X7XA 3E84A 3G6KA 3DZHA 3BZWA 3BJRA 3A6HA 4JT9A 4A0FA 2RHCA 5BSEA 3P4XA 1V6AA 1NZJA 1RWBA 2Y9MB 4MUYA 2DBRA 4JI4B 1VJCA 3QO5A 2QSUA 3JZFA 3AF1A 1JEYB 3UC5A 1N0VC 4NFLA 5E6RB 3TD9A 4OFXA 2C9ZA 1DEXA 3OCJA 4MJ3A 5HKOA 4GM1A 3SHFA 1CUEA 3ABMB 3OETA 2NTVA 2PPVA 4YXWD 1QUEA 1GSAA 4RIGA 2P27A 3JWEA 4NMMA 2FWPA 2P41A 2DKOA 2P90A 3F7VC 1GIAA 4PAOA 4RK5A 3WRXA 2MYNA 4UVIA 3GZNB 4W1RA 3MBMA 2CXXA 1XPOA 1OUMA 5BRNA 1RXIA 1IM8A 1XAHA 2IIBA 4O8ZA 5KHHA 1ZN7A 1K8XB 2EEPA 3ECAA 4X3CA 4XB6B 3BMCB 3O4JA 3TNYA 2PMWB 4C7OB 4CKBA 3DDUA 2Y93A 2YZNA 1USGA 2CMHA 1UBEA 2FDRA 5F1YA 4U2EA 3LMEA 3BL5A 5TDHA 4S1OA 3K5NA 3PUYA 1G7TA 1F2UB 4HN4B 3CLVA 5IY5C 3VSAA 1UC4B 4FDAA 3CNOA 3ICWA 4I7ZB 1P45A 1X1EA 2DC1A 1Y37A 2OLKA 4HD8A 4I5GA 3TQHA 4M83A 1C0LA 4KK4A 2IHTA 2NZYA 1RPZA 4IH1A 4MQEB 1L7BA 2O8VA 2WF9A 3I1FA 1YCGA 3AK1A 2V0GA 4UMDA 1CE8B 1KZ6A 1H4VB 2JFBA 2RFLA 3RASA 3ZU4A 5I7FA 1DSSG 2AN4A 2EBUA 3FPCA 1DUSA 4O4LF 2B4QA 2Y27A 4URFA 1NT2B 4MIOA 3AIIA 4DV6B 1DJNA 4IM7A 3UT6A 2CLSA 4I1IA 4IDHA 4F4IA 4I2NA 4ALLA 3ESYA 2NU8A 2ZXWB 3ZLJA 3SICE 1QF7A 2X5KO 4HR7A 1FYWA 1OGIA 3RIYA 5IHXA 4CU5A 5C80A 1HV8A 1BC5A 2MR5A 1NW5A 1N5OX 2ZS9A 2PEZA 1GSOA 2OTJF 2IC5A 2XMGA 4PLCA 2YJ6A 5FOWA 2JKYA 5DYNA 5F7OA 3S3TA 3CD6V 1NF9A 4WFHA 4ZXFA 1G41A 3M6IA 1I4DD 3S8YA 2QUHA 2P3SA 3OM3B 2AD5A 4LBVA 4M7WA 4TGLA 1AR4A 5C35A 1RHKA 1QQ6A 2XUFA 5KSPA 3KWMA 2LPMA 3ORFA 4ALIA 3ONDA 3OJCA 3O8LA 4MUXA 2HPZA 3QMWA 3BH0A 4FZ3A 2UZ4A 4UEWA 4B3CA 2H7YA 2OD9A 3C97A 1VJ5A 1I4TD 4PICA 3WK5A 1YOVB 3VU0A 1FXUA 4ZT3A 4XYLA 1L0LH 7GPBA 3K08A 3P2IA 3IB6A 1HZZA 2WG1A 5ED0A 2D5AA 2G40A 5A62A 4RFSB 4FFSA 1GXSA 5AO9A 3SQWA 2JRIA 1TJYA 4MP8A 2OCCC 1U2DA 3M2TA 4UE6A 3ADBA 3GP8A 2IIPA 4AU1A 2BOVA 2REOA 1H9BA 3KE9A 2VDOB 4M53A 4GGPA 1XRMA 1P2FA 3FDZB 4D9JA 3M4SA 2PO7A 2I2XB 3HL4A 5K0GA 1P1HA 4HVLA 2RGNC 5A9GA 2YN4A 1ZTEA 2WMDA 1YHYA 4CF6A 2QTVA 2B2CA 1VLMA 2JNWA 3DKIA 4QYTA 5HQTA 1KTIA 1K7SN 2ZRMA 4AY3A 5AKXA 1CNEA 3EGDA 4J10A 1WETA 1YHQV 4B7UA 4D8VA 1SKMA 2K6GA 3RUCA 4D57A 3ZLBA 2UYNB 1T2DA 5BOVA 2Y66A 3WGJA 3C8MA 4HCJA 1G7RA 1UZAA 1WXEA 3UXEA 1RXEA 4EMTA 1S0UA 1M6VA 3FHCB 1Z0FA 3RC3A 2B98A 4EA9A 5AW1A 4QPKA 1L5MA 1N1DA 2AMFA 4H44B 1NIJA 3QV1A 4L9AA 4TRJA 1E1NA 4BNTA 4B44A 5J2UB 3B7PA 4MQMA 1VSQA 1XEXA 4P08A 3G9XA 4R9UC 4ZGGA 1M3SA 4K8XA 2ZCVA 3R7AA 1K0FA 3CIFA 2ADFA 1M1YE 5CG1A 1JHRA 3LRPA 4RK7A 2ZJ8A 4Y2PA 1ECGA 1X15A 5KHJA 2BE7A 2K2WA 2QN9A 2X5XA 2VQEB 3FZQA 1ZA1A 5CPFA 4JUAA 3H9GA 4LXQA 5E3JA 3R76A 1QVFF 1WAMA 1TA8A 5E7IA 2E21A 1A96A 1GPUA 3MT9A 4TKVA 5H7XA 1T25A 4YRAA 2IOQA 2ZROA 3FNGA 3QI7A 3PYXA 3W90A 1EA5A 3C3TA 3CD6F 1KMCA 1KQOA 3K5WA 3WPXA 3L1UA 1K6JA 3D9QX 3RAGA 4RD1A 3I05A 3AOEA 1ZL8A 4IYHA 1GR0A 4LY6A 5G4VC 3L9WA 5EHZA 3EZXA 3EIFA 2P75A 4M99A 1EQAA 2N74A 4G2KA 1OJLA 2JJ2A 3MYRA 5DHAA 3QUCA 5L3SB 4BQIA 1HDEA 3TSOA 1XRQA 1U0LA 1IV1A 2FPKA 2Y1LA 1L5LA 1Y1LA 2GK7A 4O02B 4B81A 2V1UA 2E5LO 2X1HA 2AEEA 2ZUEA 1C30A 2ZXUA 4KRGA 2YIJA 3DE7X 1NDQA 2ES4A 4DR2O 4KN5A 2W0FC 3BEHA 1NMYA 4PYKA 2ZZMA 2PANA 2JGLA 1P74A 2FZCA 1YR9A 1ZKMA 2AVNA 2CGEA 3KPVA 3KZ1E 1ETHA 4TYMA 5B1AB 1QG2A 5H0IA 5H02A 4RLFA 5C8YB 4E30A 1KAOA 1N4AA 1X7ZA 2EKPA 2CB9A 3BXGA 4N0DA 3GCDA 5EXXA 4NH4A 1TKCA 1A9PA 1WHTB 4O4JB 1ZNZA 1K7DA 2CLHB 2GFQA 2B30A 5CDSA 4BMCA 1G6UA 4DR1B 2QZPA 4MTXA 2KB1A 2R62A 4HFMA 4HS9A 5DGIA 5FBHA 4PZYA 5EKTA 4Z0NA 5AW4A 3J80M 1ANKA 3IMCA 4M37A 2A7XA 1A4XA 5CT6A 4YT5A 4HEJA 3SM9A 2DUWA 3CNQS 5IVDA 5AW8A 4DIDA 3IQWA 3V4RA 3NHLA 3GDGA 1E9RA 1H85A 4HLNA 3ZKWA 4RKEA 4C7BA 4F5YA 4N82A 4L8FA 4X61A 3RG2A 3RCBA 1J0DA 3NHSA 1UQUA 4LOLA 4JVLA 4B7ZA 1PWXA 2BRUA 2Y1KA 2C57A 3VKUA 2LCAA 2QE6A 3AF6A 1EGHA 2CZCA 4Y9RA 3NAQA 1SXJD 3REFA 1LBEA 3ZN0A 5A9RA 1J5PA 1ODCA 3IJ5A 2EBOA 3ZNPA 2C9OA 2UZ1A 3SZOA 1M1ZA 3WY9A 1I1OA 4UCTA 2YWJA 1KMIY 5ILQA 3N0RA 1RYNA 2JZNA 4PNZA 2XUPA 4C4RA 4IF6A 4XJSA 1NUQA 3GFPA 4IKEA 4JEMA 4PA9A 1SQ0A 5EMKA 5KNBD 2XDYA 1ZX3A 3GLFA 4FFVA 2H0QA 3OR6C 1BQEA 3IP8A 5IT9M 2ZGVA 3KFVA 3O3CA 3PQ8A 1E94E 4IL6Z 3U4DA 4TVBA 4V0OA 3D6UA 3SLGA 2BSQA 1DCFA 3R0PA 2OOSA 4FXPA 5AJZA 4DCUA 5KMGB 4EVQA 5BNWA 2J9FA 3GGOA 4FC7A 3ZQUA 4QT4A 1EEXB 2WVGA 5TMBA 1OLSA 2DU8A 5B1SA 2ZJ3A 3EXIA 4X93A 1Q86H 3JRXA 4ENTA 3UB4A 1IE3A 2HADA 2PNJA 3D02A 4EKIA 3KX2A 4IVRA 1YFLA 2KWIA 3GCGA 3VMFB 3EJ6A 4FZJA 5GTDA 1CUBA 1P60A 1J7JA 4DC0A 5ITWA 3EGOA 2AR7A 5B66Z 3T8YA 3U7FB 2DQ3A 3GQBA 3QTLA 4R1SA 4O3FA 3O74A 2HA2A 1TC2A 1XP8A 1CJVC 1Y1SA 3A0UA 3NIWA 4WNYA 1FLAA 4BN4A 1X2BA 5IT9N 2WABA 1L1FA 1QLEB 2PWZA 1TYAE 4UCWA 4QL3A 4B6FA 3GT7A 5HZMA 1BOOA 5H81A 3QJ5A 3NIDB 5BMVA 3N4ZA 3LT2A 2QHXA 1T6YA 5CIQA 2R5WA 4TT3D 5J43A 1FP6A 4PYIA 1PVOA 2MYUA 2JHCA 4P6VF 2HR1A 2OKCA 5EMHA 1E0DA 1E2NA 4H1UA 3RE1A 4EHNA 3EDOA 5GMOA 4TKUA 3RBAA 1WCV1 2DYSC 3NNNA 2HSEA 4F2WA 2F1JA 2H5EA 3DL7A 4I9FA 2QRUA 3C3BA 1JBEA 1YF2A 2WJGA 3KJQA 1Z4OA 2H2HA 3WGVA 2ORIA 1D6MA 3CR8A 3J7TA 5JLJA 3AFMA 2Y1WA 1HOXA 1Z5VA 3JVEA 1NG9A 5DRYA 1UPGA 2I78A 4J9VA 3B70A 1JNYA 3HPQA 3VYTB 1YFZA 1FFWA 4M60A 1EVJA 5F5LA 2PWAA 3RV3A 4HMQA 4BVHA 2ECPA 1QQBA 1X70A 4ZYUA 2TS1A 4MUIA 5B4VA 3AFIA 4AI8A 2DWUA 1QP4A 4IH4A 4H1HA 3K92A 4QRIA 1SIUA 4V02A 4DBLC 1XL6A 3CLTD 3RS4A 2XUHA 5GVSA 2UUAB 4HGRA 3KZMA 5KSOA 1QWSA 3L6CA 3NIFB 2G67A 3QG1A 4EMBA 8MHTA 1VJ0A 4QBTA 1K9MW 1BCRA 2AQHA 4G0PA 5FI1B 3N2GA 1LDBA 3CNBA 5K0NA 2FG6C 3BDIA 3JRWA 1Y6ZA 2C84A 2ZTMA 1CUYA 1J70A 1XVLA 3DFMA 1KO8A 4PZEA 5DP2A 5EGNA 3VZQA 1SCNE 3GGPA 4A26A 4ZRNA 4X71A 1GG8A 1WXFA 3LHFA 2IP2A 1RRKA 1EDZA 4MYUA 4FSDA 2K1EA 3VPHA 2QNIA 2Q1XA 3ULKA 2XAGA 2GN2A 2C98A 3H5OA 3U2QA 3VOAA 1LLCA 2UVPB 4G1UC 1QYIA 5F1KA 3S3XA 1NVAA 5DM60 4JI8O 1PF5A 2CN1A 4ISCA 4JX8A 4CKBB 1UDWA 4CI0B 1GYQA 1MJFA 1I2DA 4B6QA 1E3SA 3HY3A 4TTSA 1F51E 1E2LA 4IJMA 1N2CA 2JAWA 3ICQB 4YAWA 3TW8B 2C3PA 4V3BA 1URPA 1QH8A 4JITA 1RRGA 3BRCA 4U9IS 3TRHA 3OONA 1FVFA 1D6NA 5BR8B 1W94A 2C4UA 1RWVA 1WMSA 1YZKA 1XD2A 2DTDA 2DMRA 2PSEA 4KO4S 3UK0A 3K12A 3G9QA 4LOKA 5CCXA 4XA8A 1GQFA 1H5UA 1DKPA 2Q6AA 1VMEA 4NJMB 2BHLA 3BCHA 3J81A 3LX8A 1TO6A 1VKRA 1T1RA 2YUAA 4I9WA 1Q14A 2A0FA 1V7ZA 2FKAA 4OHMA 5A03A 5JC8A 2NUBA 1W36C 5JH7B 1BA2A 1CUXA 4EPRA 5T64A 1RYFA 3WLEA 4JAVA 3U09A 3NAMA 3OR7C 3BFJA 3PP8A 1B1CA 5JQWA 2YSUB 3TLYA 1B7GO 2NWQA 3FRHA 4NENA 2Q1TA 3PQ6A 2B25A 16PKA 3LVRE 4JN6B 1YS7A 4MZDA 3TIGA 1SZCA 4Y1RB 4O63O 1R9JA 4MGHA 3CHYA 4LKOA 1BSMA 1RTTA 1ODKA 3M5WA 1JHMA 4GDMA 3TVTA 3AVTA 1X4TA 3ZTTA 1E4OA 4ER7A 3V42A 3T1HO 4F6LA 1WBJB 4L3VA 2PQ2A 3R5KA 3K03A 1U8FO 1MAVA 1FMTA 1UDXA 1XXHB 2AZDA 2CNWA 3IO3A 3OFND 4L2IA 3VC3A 1FXWF 3NTUA 5BV0A 3MBIA 2O52A 3IQDB 1P7ZA 4OHCA 1Z4NA 4Y9DA 4F04A 3D59A 2J9GA 3GOHA 4AUEA 5KYWB 1VCNA 2SCUA 4WACA 1VIYA 2IZ5A 4F86A 1OCOB 1YOVA 4J3FA 1RU3A 1PNKA 1OIVA 2QDXA 2NV0A 4HDKA 1WJZA 1ZK0A 2B0JA 3C3CA 1HQKA 5HS6A 1XLWA 4BO1A 2N0SA 1PZXA 3K5HA 3PFHA 1R74A 5C46F 4G63A 4Y2HA 1LWNA 4RE5A 4DKJA 2PZEA 3ZRSA 4I50B 1IPEA 1ISFA 2ZT7A 1VA4A 4GEKA 5DSXA 1ZJZA 2PA3A 2H0RA 3PN1A 2GD1O 1PBNA 3BWCA 1ISSA 1Y1TA 3G23A 1S77D 4YFYA 3W5DA 2ZBVA 3VR2D 5BQOA 3K5MA 1VG0B 4BKPA 4ETIA 3DZBA 3KEOA 1EVIA 3QX3A 1SD5A 1EFRA 1DAMA 5MGNA 3MIIA 4H3VA 1YS4A 4BXOB 4ERHA 4HB4A 4HYEA 1WW3A 4HWOA 2G4CA 3FGOA 4WZBE 1E6MA 3W6OA 1X87A 3NC4A 4G1VA 5CFQA 4BQFA 4XVCA 3LYBA 1NW7A 2CE2X 4RYLA 3IMKA 2YJ5A 2V96A 4ZVQA 3ZV4A 5HR5A 1VQNV 2ZR7A 3GGGA 4CV3A 2DEUA 1YI8A 1FSZA 1BJRE 3A31A 3L6UA 2MCFA 1YQNA 4J4BA 5AICA 4WXRA 5KYVA 5C7YA 3GAFA 2IXGA 3GWOA 3W8EA 3QW4B 3TRIA 2NN4A 3G2PA 2WP8J 3AFGA 3JQGB 4FBMA 4FWIB 1QB8A 4J75A 2OG2A 4G01B 5KYGA 4G0UA 3OX4A 3EQ7A 1GMGA 3MSCA 1RCFA 1Z7WA 2VNHA 2EZ4A 3KR1A 4XSGA 1QIGA 1QRSA 3AESB 3IMFA 5AVQA 1MOZA 3ZHXA 2W6IG 3IE1A 2Q5CA 1XK7A 1P5RA 1ADCA 2X13A 4NDZA 1B3QA 1BHJA 2AUNA 3TLMA 3OU6A 5BWOA 4NB5A 3DNFA 2FSUA 1EFLA 4JB8A 4NXNO 4RX1A 1ULZA 2OCIA 4TVSA 2J5XA 2ZSUA 3O2JA 2ZRGA 5CTAA 4E94A 2J6CA 2R00C 4WKOA 4FLWA 4JC0A 3LO5A 4UE2A 5CYGA 1IVYA 5JASA 1XDGA 5HKKA 5KNCA 2JH8A 4IXWA 2VJYA 1QZZA 4RY2A 1MHTA 3MTIA 1RIIA 4RZIA 4KL8S 4OX9O 3QA3E 1T9ZA 1RLTA 4BEVA 2HSGA 5LBQA 3PGXA 5DGHA 5F5NA 1FNBA 1QBKC 3BXHA 3GLHE 5AI6A 5ALJA 4ADSG 4GM4A 1ULSA 2E5LB 1C14A 3IMEA 4AKIA 1D1TA 2DSNA 1K8ZB 2R44A 1OCRC 4B7KA 1ZD1A 1QYCA 3B51X 4LWSA 3OPYI 4HLUA 3DVSX 2B4KA 3PDUA 2JVIA 2QXUA 2ZIMA 3O38A 4ENRA 4NC9A 1K4DC 2C5FA 4N6OA 4LF8O 3R7WB 3VNRA 4DMKA 3BMXA 1PL7A 2F6RA 5HF9A 3FYUB 1RM0A 3JVHA 4KI7A 1I32A 5MDHA 1UDAA 2ZKLA 1JJOA 3OWXA 2JAPA 1JKFA 1Y9EA 4FQ7A 1H2MA 1YQ9A 3ABMC 5SYMA 1ZM4A 3L0SA 2X0RA 5B7PA 1M0TA 3ZGNA 2LKCA 2AZMA 4FJ0A 3OZCA 3TQIA 4INJA 4L4UA 2NUTB 2P8SA 3S2FA 4DQVA 2WG0A 2IBMA 3PPVA 4H7EA 4B4DA 2WA1A 4QAQA 1IN7A 2A79B 1TTHA 3ZGVA 4JA2A 1ZUHA 1FUYB 3WK9A 5F98A 2NO1A 1H2HA 3HNRA 4MPJA 4WXPA 1O5TA 4DUYO 4RDIA 2GK4A 1BE3H 3MA0A 3N5KA 3LDGA 1GCIA 4KYUA 4CETA 1WA5A 3R3XA 5JWRA 1VCMA 5JI2E 4PDVA 3KKYA 5EC2C 3E5MA 3B5EA 4KVFA 1Q1AA 1Q77A 3TOXA 2JF0A 2R5FA 5ERYA 4NMWA 5HX7A 2O3UA 3GLFB 3OC0A 1B41A 1JPUA 4CT0A 1PT7A 3C3MA 4D99A 1YE8A 4RTKA 3VH2A 4LRXA 5G2OA 3FOZA 4LMAA 4MQ5A 4AN1A 5H1YA 2Z0AA 2IJHA 1MTOA 3FGNA 3PUJA 4V2IA 1O54A 1PRYA 5AW9A 3X2EA 3A70A 3BAAA 1JKIA 3PHBE 4LX0A 5JFGA 2J0UB 4DAEA 2XSZA 4QD3A 1SVKA 2VS1A 5KX5A 3DYBA 1OTYA 1YL6A 1PR5A 3L8FA 4D3DA 3ND8A 4PZDA 1KFKB 4GNRA 4L74A 4LGCA 3PNKA 2XUQA 4QBGB 4U2DA 3Q5DA 3WNZA 4EY7A 4BQQA 1HE4A 1NMUB 1C9EA 3QUBA 5EWLB 3ZWDA 4CMHA 1M2GA 3RODA 5DB4A 4LS3A 2NMUA 3CRRA 4GQBA 1ZL2A 4BGIA 1HR0B 5I8WA 4BP1A 3PXCX 4BT3A 1C9YA 1Y3HA 1K8RA 3VDMA 2DT8A 5HM6A 1Z4KA 1RXCA 5H4HA 1LNSA 3EPLA 5BRAA 1XI1A 2JD2A 4ICIA 4L0QA 2L35A 1L5SA 1TUGA 3HAXD 5IFLA 1RP3B 2P2SA 4OV6B 3ZV6A 4BFZA 9ABPA 4ZQCB 3IVGA 3W2EA 3TTXA 1AGNA 2HN9A 2NO5A 1B93A 4GMKA 4OHZA 5D84A 5AUNB 1P2GA 1T2AA 4C0QC 1VL0A 4P3KA 3TG8A 4QM7A 2VQ6A 3FNBA 3RC1A 5CYPA 2AUMA 3R6GA 4WZAE 1L6RA 4MVWA 5JRJA 4MR8B 4WOKA 1LW7A 1IBMO 4JLAA 4M8SA 4YJFA 3GPBA 1I7DA 2GDSA 4RZSA 5GINE 1V25A 2Z6VA 2XB4A 4Q4DA 4YJDA 4RH1A 5IAGA 4QOIA 5IKPA 4FNOA 3GEEA 4QYXA 1PQWA 4NBVA 1DEAA 1X1AA 3VDXA 4E33A 3T5AA 2WJ3A 1AHHA 1SHJA 2BR4A 3GLGB 2C99A 3BC1A 3NVMB 2TMYA 5ALEA 3K0GA 4EZBA 1D03A 3HBFA 3FFMA 1SQGA 3QYAA 3UTCA 3SIUA 4R8LA 2O8FB 2DFDA 4GLOA 1FY2A 1FDOA 5KJ1A 4I0XB 5I7EA 2L26A 1YDFA 1WA8B 3MRVA 5HKKD 4M9RA 4MS3B 4OGKA 4FM9A 1FDWA 3ZIAA 3SPCA 1GLVA 3GP3A 3OM1A 3L7OA 4TS1A 2OM2A 3W4KA 1Y6GA 2XDQB 4JSYA 4DIMA 4HEA6 1N5KA 3H5LA 2OZPA 5CURA 4ZYWA 1TRHA 3B38A 1JTFA 2XWPA 1N9GA 4M1SA 1QS0A 4TTRA 5EZ5A 1BN6A 1T3GA 4DQUA 1GFIA 1PS9A 2HPHA 2ID9A 2O2XA 4WY8A 1XYGA 1OXTA 2XMQA 3TQQA 3ZZTA 4EVIA 4N7BA 1KYVA 4FYJA 2XDWA 3DBOB 1RLOA 4HLDA 1QKKA 2QENA 1DLBA 5LBUA 3LNNA 4D6PA 3ZWCA 3F8WA 1HDJA 2BD0A 4KXNA 4R8VA 4R0MA 2JJQA 4EO7A 3NATA 2GBGA 4DNOA 5J1TB 1I2MA 1W52X 3K0FB 2BHNA 4YAUA 5FLEX 3Q3EA 3STWA 3FMGA 3LQKA 4CN8A 3NHPA 1QVWA 1TGYA 1P49A 3H2JA 4NZYA 4ZGBA 1X77A 3IH5A 2Z6UA 3PLNA 2AFIE 1DGSA 3M82A 2NO0A 3HM2A 2UUOA 4UZEA 3P2JA 4FB5A 2FKNA 5BY2A 3Q41A 4IVNA 3WV5A 1NH2B 2PJUA 5EUCA 1O5IA 3AVUA 1RQNA 4IOMA 5A05A 2QL6A 1G8GA 4N3BA 4YIPA 5EXPA 1M90W 5TX7A 4ZDJA 4RHTA 5ESXA 3U17A 1YJBA 2P3LA 4NIMA 3BFRA 1P0PA 4OAOA 4RK6A 1PR3A 1JIQA 2XD4A 1NUAA 3VM6A 3WTBA 1CY7A 1KSHA 3FB1A 5LXTA 1QRAA 3OZDA 3U44B 2RGNA 1CRZA 1GPKA 3A9VA 5JNWA 3GVMA 3JWHA 3BPZA 4R1UA 4YV7A 3DEYX 3EWIA 3HHPA 4CWAA 3SR2C 1KOLA 2OG1A 1EESA 1ENPA 2GNOA 2JIZD 3A1DA 3KAJA 2RD2A 2JGDB 2R7AA 2TMGA 2IZ6A 3D31A 4Q3DA 4R0VA 4WW0A 4YP1A 5ITZA 5GP1A 1G1XB 5G4UC 4DRXB 4DV4O 1V16A 1GGFA 2I54A 1ELOA 3ZDEA 3JCMM 1NXQA 2AI2A 3GN2A 2KPOA 1N3BA 2X8LA 2JRCA 2QJTA 3KEGA 4G4IA 2WM8A 4RQUA 3HDGA 1H2NA 1R7RA 1JECA 1VI6A 3R40A 4FCCA 4Y2YA 2F1HA 4JJKA 1T36B 4B2IA 2RONA 4H7HA 1OROA 1PSWA 1SHUX 1VPDA 2ZB2A 1DFGA 2VWJA 2ZZKA 2IXAA 5FNZA 2CFCA 2FN3A 3CXCU 3WMFA 5JHGB 3KR0A 1G98A 4Q3KA 1XXHA 1NBMG 3HCPA 5B57C 4RGVA 2X7JA 3BIJA 4J1NA 3E89A 3W0LB 2J3EA 4JZYA 1DKOA 1QCDA 3R24A 5HUQA 4C87A 4BY9E 1JI0A 1B6SA 2BYTA 1Z0DA 2CE7A 2HL6A 4DR4O 1T5IA 1RKXA 2Y1FA 3TJMA 4MW2A 2MIIA 1KKCA 4HGOA 4YPFA 3HYTA 4CQNA 4MYDA 4AMZA 1SKYE 1XD8A 3MWEA 2FG7C 4NARA 5G0SA 5BOSA 1KK2A 1Z83A 2H11A 2J3DA 4TMFA 1XXLA 1CWUA 1UJNA 3N70A 4H1WA 2I66A 1NG1A 2XQIA 3BQ9A 5B4TA 3KCQA 2WJPA 2WHYA 4OA5A 3D0OA 3C48A 3GFQA 3VVLA 3QVGA 2DHQA 2PKQO 3LMKA 1TZMA 4RHAA 2V6BA 3IVAA 1TYZA 3DC5A 1VA5A 2QGFA 3CCSF 1UBSB 2DKFA 1QJ4A 2VSOA 4BKQA 2VXBA 3W34A 3VJKA 2O8BA 1JVSA 2JATA 2PV0A 2HQOA 5IYDO 2EV9A 5CW2A 2J3KA 1US8B 4A0HA 4KFMA 4UHFA 4O1MA 1W1IA 5BY1A 3DAYA 1B4DA 1U0HC 4FN4A 3U9TA 5H2FZ 2G3YA 3RU3A 5B7QA 3GOQA 3E7PA 3SR0A 3HWSA 1AJNA 9GPBA 1EFHA 3OJEA 3FGPA 4JC4A 3CQ9A 3ZWMA 4CLRB 2CT8A 5CLHA 4N47A 1MQSA 4UVBA 1A8PA 3CC8A 3DUFA 4TXNA 5K0EA 4OA8A 5K1XA 2AYYA 4QUJA 2QT1A 1ILWA 1KQGA 3SQXA 1Q5OA 4GBMA 1Y5IA 2GVIA 2BEUA 2R1TB 1X38A 3GD5A 1JF8A 3EXHA 4RV9A 2AEMA 5TV2A 4GPD1 5LIRA 3GRYA 2HJHA 2GFHA 1LK7A 3TOZA 3EC7A 4JUCA 4BO0A 5I48A 4JI5O 3GEMA 3RS2A 3R8FA 5FEUA 1ZUD1 5FB3A 1QK5A 3H5TA 2CNNA 4B6SA 5FLXM 1PD1A 1W25A 2K4MA 1HX7A 4GOMD 1VJTA 1P81A 5REQA 3FWHA 2Q50A 2FYTA 4HN2A 4BP9A 2PWYA 3NHMA 4P5DA 3ZMZA 4GO1A 5CJJA 3RUAA 3HSSA 1MNGA 1P1IA 2IDKA 1YS1X 3RT1A 2B78A 2NUAB 3FSGD 5M34A 2C29D 4MW8A 2B99A 1M1NB 3AZOA 1EVKA 1MC8A 1N7IA 3EMDA 3EVBA 3HUUA 3C87A 3NBQA 3CC4F 4IWNA 2GM5A 2GCOB 3EE6A 4IZIA 4BFTA 1PR4A 3SYRA 1X1CA 2ZUUA 1NL3A 2JD1A 4RPLA 4IIJF 3NYRA 3WRYA 5IYZB 4HWSA 1KYOF 3A2FA 1C1YA 1M75A 4NOJA 1G16A 3JD2A 3QNWA 4URUR 3DVRX 4IQ0A 4MV7A 1X1SA 2GLXA 3AEYA 1W73A 3H0KA 2FRDC 4K9SA 2IYWA 3HDVA 2P11A 2W6OA 2QY9A 4LJ5A 5SICE 3PWZA 5E1OA 1GRNA 1GKKA 5IUKC 1LFDB 3BWEA 3KVNA 2Y71A 1Y3BE 2W6QA 4HG2A 2KE5A 1CQXA 4IEIA 2GDZA 5AH0A 5I7SA 1QO0A 2ORWA 1FFXB 1YMVA 4H15A 3IDSA 3FYCA 2B7CA 2FI1A 4CV2A 2HVKC 1PJ4A 2JI8A 3UCEA 4IGEA 6GPBA 1PUJA 4HV4A 2R7MA 3ZS8A 1PSDA 3GDWA 4J0JA 1UWVA 2ZJ2A 1KBQA 2W8BB 5FYDA 4B71A 1N92A 2B8EA 1DTEA 2Q3FA 1X42A 2WTNA 5IJZA 1GD1O 3VCZA 2FMUA 1U1DA 3OZIA 5D3MA 5FUBA 3ELCA 1NKTA 3QX7A 5HIMA 4CDGA 4ZPXA 4HDQB 2EGUA 2WQZA 2Q2OA 4W6QA 4GOLD 1BFKA 5SY6A 4YPOA 4ZVPA 2XRFA 4QGHA 3OURA 5CH3A 2HEIA 1KJIA 2FH5B 4UHHA 5C53B 1DF5A 2IP1A 3E8MA 3PXGA 2OTJV 5IC6A 4JPRA 2PRZA 5E2IA 4JROA 3TDMA 1FZTA 3GUCA 3LNCA 3I1IA 5ALDA 2ASVA 4ZMSA 2UYPA 3SBOA 1Q17A 3OBWA 1MBZA 3UV3A 3ORQA 3ZHUA 4MS2A 3BFVA 5JZOA 4HHEA 3CHXA 1U99A 4R2WA 2GHRA 1J42A 3LM8A 1W85A 1L5VA 2A5LA 2I3AA 1E8NA 1F2DA 3S2IA 1H5QA 1XQYA 2B6HA 3CZ5A 4PLFA 4QTZA 5HBRA 4X41A 5KNDH 4JUBA 2AFIA 3HDYA 4D9HA 1BMFG 4OHXA 1ESDA 4OMCA 4W7IA 4CIDA 2VUUA 1TDJA 1Q12A 4CG2A 1R50A 5BRJA 3B1XA 4NYMQ 3G17A 4CF7A 2Q07A 4GG1A 3QY9A 2FYUH 1DKUA 2R87A 3EZLA 1J20A 2H85A 1KECA 1YE5A 1Z0UA 2LUOA 3NC1C 5EWLA 1BE8A 1NLFA 3E9RA 4KDFA 5ALPA 3REGA 5EZSA 3WIOA 4C7JA 2Q1WA 1YQUA 1JSCA 2IX9A 2V54A 3UW3A 3WYFA 5AM2A 3UFBA 5L7TA 2AFHB 3MS7A 5JCOA 1FTWA 5AI4A 1YGYA 2R60A 5J4YA 5LQRA 1W34A 3UPUA 3E86A 1ONIA 1GKLA 4KDRA 4L9SA 3RVPA 4ARCA 2O5RA 4EY3A 1KWGA 3TIFA 3VR1A 1CLIA 1XSEA 1ZH4A 4LJRA 2XR1A 2VNIA 3QVXA 1W47A 3LC0A 2GZ3A 1N6IA 1NWHA 2JAQA 1RFLA 3FLEA 3UYLA 1FSPA 5E7MA 2BM1A 5J58A 1JKMA 3QG5A 1S0VA 1XAIA 3M6FA 4FE3A 4YVFA 3PJGA 3CYOA 2CLDX 4AIIA 3ZY6A 1AQNA 1RC8A 1ARZA 4REQA 4PGFA 3KOYA 1THGA 4BNKA 4MR8A 2IS4A 3ZLUA 3PNVA 1GNVA 5GJBA 1KH2A 3EEIA 3T95A 4R8MA 1SKBA 2VTDA 2H9YA 3L4KA 5IYCO 3AUXA 5FIUA 4UAVA 1IHOA 2HSDA 4N5NA 3GQVA 3DL0A 1YJNV 2SNIE 4LXYA 4XLTA 2FXIA 5K8TA 2I4NA 2KSDA 1GZ3A 1JHPA 1B0AA 3K2EA 4MVUA 5K7SA 3EGXB 3JQCA 2NQTA 4JOCA 4GX2A 4C4ZA 4J3NA 2YYEA 1REQA 1HDGO 4LY9A 4REOA 5EE5B 1M83A 2O8FA 1Z17A 2AOUA 4DVJA 4BAGA 1UZUA 1UXHA 3ZRXA 1JHAA 2WFAA 4TOIA 4R8SA 3CO5A 3STUA 4G0OA 1H6DA 2Z4TA 1RQRA 4I4NA 4XCXA 5BO5A 5ADVA 4MUGA 1Z4PX 1BGVA 4MVMA 3KDAA 4LE2A 1MPXA 4V1CB 4J0GA 5L4NA 4K9PA 1N9GB 1X80B 3VR4D 4ZICA 3GP5A 4NLLA 1JHXA 1GFWA 3ESAA 4BB5A 5ALIA 3ZWBA 4CKZA 1VQ5F 4M8LA 3AK2A 2C88A 3HACA 1UMDB 2ZUSA 2A5GA 3S0WA 3DBIA 3QKRA 4DLWA 1NVXQ 1R6XA 2JFQA 2QLMA 4J16C 4IZ6A 3W9UA 4U1RA 4E0BA 5LUAA 1TFRA 4J41A 2C5EA 5L53A 2J0SA 1XZMA 4K9DA 1KKMA 4DR7O 3FOEC 1IN5A 3SJBA 2IF2A 5CAEA 3THXA 3M8AA 2XVXA 2EGGA 2CMFA 2X6RA 1AQ6A 4NYKA 2FRVA 3JR7A 2XNHA 5EJFA 1MFZA 2Y1CA 5HIIA 2JNBA 1BHQ1 2X58A 3PGLA 3W78A 3K70C 2IDZA 3GLHB 4ABMA 4DV5B 1U3WA 2QPLA 3KTDA 7REQA 1GZSA 1A2OA 2H07A 2Q41A 3I8XA 4HAVA 1O9GA 4D8YA 3ABOB 3USZA 1RKBA 3KVVA 1TVMA 2F43B 4R98A 1N75A 1O57A 4YUVA 3UJDA 4LNAA 4ETMA 2XA2A 3E22A 3QE9Y 2HW8A 3JVDA 1T8SA 2BM9A 3EZNA 3FA2A 1IMOA 9ATCA 1XBIA 2PSDA 4MUNA 4OH7A 4JQOA 4OQPA 4D1YA 5CA1A 3CW2A 2BISA 2DQ4A 2PLRA 2PRYA 3OZBA 3WLQA 4E03A 1L7DA 2WIDA 2AXQA 1VKHA 3PPIA 2R7KA 3TB6A 4E12A 1U81A 1TYDE 2VXCA 4DBLE 4ZZIA 2Q8PA 3AR3A 1UBTS 1Z26A 1DJQA 2ECQA 2WNIA 3FDZA 4LZOA 4U00A 2Q68A 4AX8A 1GKFA 2VDWB 3DC7A 4Q05A 4B09A 4MITA 5FL3A 4BNZA 4PHGA 3UATA 4EF6A 2W2XA 1AUXA 1ZGJA 3VNAA 4I4IA 3RSQA 2XEDA 2OCBA 3O3NB 3CS3A 2ERCA 1EK2A 2G7ZA 1RPTA 2PRSA 3G2QA 3CPWU 4FMCF 3I5DA 3Q4HB 2EBFX 2ZYTX 1I94B 2OTLF 5CMLA 3JY6A 1ZOLA 5IS2A 1IM2A 1W1WA 3AF2A 2RH5A 1M2HA 4EI9A 5D5PA 4E2YA 4KQFA 3RA6A 5JJCA 4MRNA 4HX9A 1FFBA 4RY8A 1B26A 4HGZA 4HX5A 4ND7A 3B2NA 3ZXYA 2Y0PA 3D00A 2QAGA 1UQRA 1K4YA 2W2KA 3GU3A 4RXMA 2J48A 1TQ2A 4JJ4A 1OWNA 3FI9A 3MCWA 4RKYA 3S7ZA 4YAGA 1LXCA 4Z3DA 4D96A 3CZRA 3DVQX 1GXSB 3I32A 2VZ8A 5J2UA 3O4RA 4QWMA 4H6XA 2AIRA 5E1BA 1E4EB 2H1CA 3MOSA 4KIFA 2E55A 2FJUA 5LZ8A 3C5CA 3JQ6A 1KZ1A 3EVAA 1YC5A 5GOZA 3SNHA 3S1LA 3RKRA 2UYQA 3CCLV 2NT3A 1OH7A 4P4NA 3HH8A 1NYTA 1ICEA 2V7WA 1YZTA 1ECLA 1C2TA 4RO2A 1VGVA 2FN8A 2YV5A 3WDKA 3KVYA 2RHWA 1Y89A 3T4EA 3AVOA 3IIMA 3HYSA 2P0YA 4J9UE 5F4BA 1CYEA 4CN9A 1FZQA 3HYLA 4TKVB 4G4ZA 3CCMV 3QVGB 3CC2F 1GNRA 3DLCA 2JFHA 2RAPA 3WNDA 5F7JA 1RCTE 3NFRA 4NBUA 5JDIA 2UYNA 2VYNA 3VTKA 2BFDB 4ZPJA 5ENZA 3RS5A 1H48A 3AI2A 4RF5A 1XVIA 3ZDDA 1RLUA 1GYRA 1QIHA 9LDBA 5JEEA 1F6BA 4KBYA 1QX3A 4RHYA 1EFRD 1NSTA 1E1QA 1Y63A 4PLHA 2DLCX 1H8EG 3PEWA 1U2GC 4C76A 4HQFA 2Q5JA 4DHWA 4WESA 4KI0A 5ARDA 2Z1NA 4JHXA 3IP1A 3WGGA 1C0KA 3K14A 2HGZA 2VJCA 3CJRA 3PTZA 4IDFA 3H2IA 4TLMB 3CLTC 5TJHA 4EW3A 2R751 1NNI1 1GTL1 4GZ3A 1XD9A 3IL2A 2Z3YA 1FXKC 1QLWA 1DRUA 4MVOA 2X1LA 4B32A 4K35A 3FKSA 4YRRA 1TFUA 1IZ9A 1OI2A 1YUMA 4I8XA 4ZHYB 4QWWA 4FLMA 4GSYA 4M0PA 2DWEC 1H6CA 2Q4BA 3DWGA 4L9RA 3R09A 4NZZA 4P53A 3OAAD 3HCNA 1L5NA 1IZ8A 5K0FA 3PL1A 5SZJA 1M34A 4I36A 4UTZA 3WBJA 3KR9A 5LZ9A 5TLSA 2I6GA 2XNJA 4QEDA 1XZFA 1YZGA 3SF8B 1IBKO 1P4HA 3D7SA 3BE6A 2PU7A 1J0CA 1GT91 1KFEB 4Z4HA 2IXEA 2XVZA 4XRRA 1FW8A 4ZKDA 1YFJA 1T0AA 1X7GA 3D8UA 2FWMX 3R9IA 4DA7A 2HHCA 2PUVA 4PW0A 4C0LA 1XCPA 1MC5A 1QOZA 1V11B 4HH4A 4O29A 4AAYA 3NH6A 1C30B 4B08A 1IPAA 4HKTA 3AUUA 3UAXA 1SXJA 2JDIA 2WJIA 2VBIA 3UQYS 1GA1A 4L4YA 1JR2A 5GADl 1WB8A 4M0MA 1Q43A 1Z2GA 1WZEA 5TQ0B 3T3GA 2CXHA 3DOIA 4X62B 3E83A 3H8VA 1QB7A 2JDIG 4EB6B 1KS9A 2LBXA 1MEOA 5CCDA 4JJZA 2RB5A 3OEHG 3DMHA 4QOHA 1Z5PA 3KFLA 3NPMA 2WJYA 4RMNA 4UVDA 5IBQA 4KPYA 1RWNA 3HRKA 3SOPA 2MSCB 3HVUA 4C01A 2W6ID 3PHHA 5H3LA 5DO9A 1CQPA 3BXFA 4AJJA 1MOPA 5AQ1A 2JLUA 5A5FA 1RI4A 2A0WA 2EG5A 2H17A 2A4KA 2PVSA 1L7MA 3MM4A 4L7QA 1QV6A 1C4OA 2PRKA 5FFMA 1SCBA 3B1FA 2WE7A 3U4QB 2Q69A 2PMEA 1U3FA 2QVBA 3IMPA 1ZH0A 3QZUA 2BKVA 1ACJA 1WDTA 2SHKA 1LCIA 4H3KB 1FUIA 2K9PA 3T15A 1JLSA 4HYOA 2EGHA 3LFUA 3MLEA 3P10A 3PFCA 4PFQA 2ZYGA 3FFWA 3GPDG 5JNUA 3COZA 5LDGA 3QX9A 1DF4A 3C41J 3ETQA 3E9CA 1G0NA 4I3FA 4BKUA 1LLDA 4QZVA 5A0TA 4Q9HA 1PWYE 3QEMB 3UKDA 1PP4A 3L8MA 1JDSA 2JCBA 2EYQA 2Y1OA 4FGWA 5HFJA 4I5DA 5FCDA 2RKWA 1K92A 3RUDA 3FD9A 3RROA 2VWPA 3D5EA 1VJRA 3E9DA 4NXMB 1UFRA 3AJ8A 3PX7A 1TJNA 3AOGA 1AJQA 1VP9A 4MV4A 4LZNA 2GYWA 4TMWA 4P98A 4PGHA 1XRPA 3AHEA 3ZHZA 3N6XA 2VNKA 1WP8A 4AXBA 1JG7A 4UUPA 2H00A 4Z7NB 2YZ7A 4QECA 3C8DA 2BBWA 4EQ6B 2YN0A 2IBSA 4YRSA 3GL9A 1P0FA 2FP4B 1SPXA 2L2QA 4GOKA 2JFUA 3P0IA 2ACEA 4HQKA 4IFTA 1RRVA 4MQUA 3TD6A 4G0QA 5LPNA 1PGJA 2AKEA 3LC7O 3KXLA 4MMZB 3FMFA 4UOEA 3SXUB 4BJ5A 4LZWA 3GQBB 5CFPA 1H2ZA 1DBIA 4IEEA 4BP3A 4BB9A 3GJSA 1YASA 3JQ8B 2BGWA 4IJQA 2VCEA 5B2EA 5KAFZ 1GPAA 1LBIA 3HDHA 1OCZC 3ODGA 4RJTA 1U7UA 3UMVA 4LDRA 2EINB 2E3JA 1K68A 2IPLA 1AR5A 2NXJA 2ZK7A 1XDDA 2CXPA 2P65A 3T80A 1E1YA 3A37A 3GA0A 3IA2A 3IOYA 3I28A 3GJ5A 1T5TA 4K0RA 4F5EA 2KGWA 4FR2A 2B37A 2OAGA 3V7QA 4W5TA 4ABTA 1U96A 1Y34E 2FW0A 2ZQYA 4NNJA 4TQFA 3WLSA 2WLIB 3N4YA 3MWDB 4DA0A 4Q7QA 3LCVB 2OLEA 3T1TA 4PS1A 4X84A 2VZEA 3Q3HA 1MNQA 1QFJA 2C2XA 5AESA 2V8BA 1N25A 3BSYA 5LVAA 2BTUA 2QR2A 2R8PA 3QE2A 3PUXA 5KYYA 4PPGA 1CK2A 1HETA 4ZYXA 4N6GA 2OFXA 2OVFA 2VKTA 3IVMA 4XQCA 4BRSA 1RJEA 4Q4JB 3G0BA 2G08A 4R2XA 1X6VA 5KAPA 3RFFA 1ADGA 2NW6A 3EYWA 3NKFA 2HBYA 5F3RA 3RIEA 4F1WA 5JXIA 1M93A 4PVDA 2QJOA 3OT1A 3QBVA 1T6BY 2HMTA 3ZWQA 3G6EF 3F6RA 4NFSA 5KHGA 3GHZA 1Q22A 1I6WA 1S02A 2ONCA 1T5HX 5AKHA 3SCZA 4F46A 8OHMA 1JLLB 3E9EA 4RLSA 3TMAA 4DCTA 1FUEA 3MJDA 4CEJB 4UOZA 1KHTA 4B4UA 1L7EA 3EQ2A 3LQFA 1K3TA 2GZ1A 3ZZMA 3A1WA 3B60A 4M9UA 3UAVA 3B85A 3HQ4O 1TVEA 4G5SA 4JWTA 4EZEA 4NTYA 3DO5A 4O4LB 1Y1PA 1M0WA 3L0ZA 4HTFB 4JI0O 5L3FA 1QAQA 2AI1A 2GBIA 2PSSA 4OVKA 4ZJPA 2NZXA 1XEFA 1KI2A 2HLHA 1XEWX 2A57A 1K1EA 4KX5A 5A0VA 4IKOA 2QRNA 1H47A 5IJXA 2I2DA 3VU3A 2Y0CA 3SR3A 2CJXA 3WHIA 3T3EA 3A9SA 1SCKA 2UVPA 3STHA 2R4QA 4BRZA 3OEEA 5FUQA 3D4IA 5E4FA 3CC4V 1KD1H 3B3JA 3QKRB 3L46A 2ZTHA 3S0YA 5E1AC 2GZMA 2IYTA 2OV6A 2YMLA 3DKKA 4DV7O 3H05A 3L7NA 3L92A 1XVAA 3MB5A 3I04A 5LMUB 3V8RA 4BIOA 1UUFA 4WBXC 2GK6A 4LSGA 4A27A 4B6RA 4BU1A 1P7PA 3H2SA 3AR8A 5CNJA 3UHFA 4DLVA 4CTNA 1EFVA 4GBJA 4M0FA 5L7YA 3ICCA 3N3BC 3TAHA 3W04A 1FFSA 1QCEA 4J7KA 2WTUA 3MTGA 2UYCA 1DPFA 3JQFC 3GAZA 1CVLA 3AU8A 2C2AA 1B8OA 1M33A 2H1OA 3ERNA 4BL5A 1GNLA 2PQ0A 1PG0A 3I42A 4UFZA 2XOKD 4UHEA 1ZINA 1H4TA 4RF3A 1Y81A 1A1VA 5B58T 1GNSA 3VPBA 1NP3A 3AILA 3QXSA 4RPHA 3NMUC 3D36A 1X1RA 1E58A 4BFYA 1OPRA 2D5IA 4Q24A 2JD0A 2DGDA 5LP6F 3COWA 1JW9B 2QT0A 2JFXA 2Z6QA 2G63A 2PF4E 1G1MA 5LMZA 2A30A 4G2TA 4J0CA 3UMFA 2FF5A 2VT6A 5LLTA 4F5WA 4ZTZB 1E2BA 3HBAA 3N05A 2C9CA 5LQSA 1WE2A 2FUG6 2HHAA 4MTFA 4PAQA 2FDXA 3W2IA 4OU5A 3O0DA 3B7WA 3AINA 3DKVA 3OOWA 5KBYA 2I71A 2I6RA 2ZUCA 2H1SA 1UT8A 1FDRA 3I9NA 3NGLA 5LXTF 4RAIA 4FM2A 2HA4A 2Q0QA 4LF7B 3OU7A 3QFSA 4UXIA 2VO1A 5KHIA 2R8OA 5GWXA 1OE0A 4Y2SA 2YTZA 1R4ZA 1EUQA 1T5EA 1CR6A 1T26A 4LIPD 2A58A 3QLUA 2EZTA 1BDJA 4OCZA 1UBKS 4DMGA 4MRAA 1YZNA 1QR2A 2Y3IA 3OJFA 5KYWA 2BSAA 1DQSA 4GHWA 3PC4A 1GLGA 1IJBA 2I29A 4KQ6A 4GS5A 4N49A 2FEPA 1N2IA 2NO7A 3VH4A 1W4BA 1U9JA 4CCSA 1WXDA 4XQ9A 4JBXA 4D3YA 1PW7A 2C78A 3L3BA 4LJ4A 1TQ4A 4DM7A 5AW2A 2VC2B 4OJKA 1ZH2A 3TCXB 2BONA 2CLOB 3BRWD 1Q3HA 5CNKA 4Y2RA 1X8KA 1Z4IA 5H16A 4M0UA 1SKYB 3VZDA 3SC3A 4HBGA 3T5GA 1F9EA 3THYA 1X39A 1FBNA 3X1ZA 3JQGA 2BRUC 1TT7A 4RJJA 3RKUA 2IQIA 1K9MH 4QDOA 4CZZA 1U3LA 3CH6A 1E9CA 3GGDA 3SDSA 1D3AA 1M7HA 3R7DA 4F60A 2OGWA 2YZKA 1UPUA 3D8RA 5BVHB 2RJZA 4FYXA 3HVKA 1NY6A 3BERA 3NALA 4FZ5A 1ZJ6A 2RGWA 1AF4A 3CRZA 4D97A 1GCOA 3FVVA 1VDZA 2E48A 4NR0A 2RHTA 1RQXA 1MMMA 1VE5A 2BHRA 1A50B 5FT9A 5E9AA 5YASA 5DF1A 5KB3A 4QARA 2B8JA 3KJIA 2PZSA 4R1PA 3STZC 5BUSA 2P06A 5BT9A 1VLQA 5AK3A 1Z8DA 2OAEA 2MTBA 2MWMA 4YCNA 3ODPA 1IQPA 3C6ZA 4KZPA 1XDSA 4X62O 2GRJA 4UU7A 1Y6FA 1U28A 4RDHA 5DHPA 4DE5A 2A5YB 2Q28A 2W6NA 4CIYA 3VNVA 3AIMA 2XWSA 4OJMX 1VQOF 3UMCA 2BJWA 1EJBA 2P0EA 2YS6A 1P7YA 1RXYA 5AVWA 4JLOA 1MGPA 1IB6A 1RHUA 3OIWA 1B15A 2IZOA 1LJLA 2LE0A 2X3FA 1ZICA 5G0TA 1PGQA 3A25A 1EXVA 1HH4A 1U7TA 3GLUA 2W83A 2ZAUA 3NVIB 4MR9B 4CYMA 5KCMA 1RJDA 1ZZGA 4XDGA 1AQJA 4MB2A 3ONWA 4MTGA 2N42A 3E81A 2H1WA 1Q2UA 2VNAA 3CLKA 2VYCA 5FO1A 2ZREA 4ZA2A 3TW4A 1KY4A 2AOTB 2HNKA 3DE5X 1PTJA 2ZWAA 1UINA 1W2HA 4L5BA 2XZOA 5JS1A 1GSIA 2L17A 1WB5A 2QQGA 3MD9A 3RHFA 5DMXA 2CTPA 3BDAA 3CLHA 3JWJA 4BX3A 1IBKB 2Q4EA 1Z75A 1Q86W 1QYDA 2PQMA 3WSWA 3OCWA 1MDBA 1U0GA 3A8TA 1DNPA 2ETXA 2FE4A 2J7PD 2RAFA 1JQ3A 1UIRA 3AP3A 4G09A 1TEXA 3PLRA 4AQ7A 3ENNA 4N03A 2YIBA 1N4CA 1MV8A 3S6JA 5KVVA 3AEKB 3QYFA 4ZANA 3K53A 1DO2A 4JXXA 4KKVA 4QRHA 1IDSA 2WWWA 2HIHA 1R5JA 2BEJA 3NONA 3QF4A 5HY4A 4XQGA 1UMKA 2ILMA 1QP8A 2R5NA 2PN1A 4ER5A 1O8CA 4LRYA 4MDEA 4K6GA 4R3NA 3R44A 1NBMD 3IDFA 3KALA 3NWPA 1F3LA 1XTVA 3AERB 1OTXA 3T1NA 4ARAA 3W6UA 3AW9A 4JGBA 1ESEA 5ARCA 3QEBZ 2GI4A 2GYVA 1T1SA 5F2EA 1TL7C 3BD7A 2BOBC 1W44A 4RW0A 1WF6A 3UIEA 3VYVA 4Z51A 4PYJA 3GPIA 2GFIA 1QRUA 2AXTZ 3U4QA 1J07A 2OIGA 5E9JA 1O89A 3K3WA 1GTVA 4LH7A 3OPQA 4H77A 1E59A 2HDWA 4TTPA 1O6CA 1E61A 3QHAA 2J8ZA 1FXHA 1Q83A 2TYSB 3C3KA 1HK7A 1HFKA 3B9QA 1T1JA 1SCJA 2WVAA 2O54A 4JZ2A 2AN3A 3T7DA 1NSYA 4BBAA 2JZOA 2YY7A 3M6WA 4XGQA 2B35A 2ODPA 4ZOAA 4DLKA 1XC7A 4OJQA 4V0LA 2CGNA 3N58A 4XQ0A 4XPIB 1IJFA 2WZQA 1JXMA 4EPXA 1MO4A 1AX9A 3OPVA 4H9GA 1P7BA 3QO7A 3DMPA 3OKPA 1NVKA 3F90A 1J95A 3O4VA 3IEIA 4HATA 2QP3A 1KB9F 3CEPB 1O9BA 2FPWA 3WYDA 3SOZA 1ONBA 3KQPA 1Z6PA 4X89A 5KOJB 4L28A 1NHGA 5JC1A 4TLLB 3A4IA 4ZU3A 3E58A 1VPEA 3ER8A 1EM1A 2OFFA 3HKEB 1ZK1A 1DOHA 1X7XB 3UGQA 1IN1A 1N2BA 3A3PA 1MENA 1NJ1A 3EOZA 3LXRA 1MAHA 1QORA 4HXEB 4GC5A 5F12A 4G1EB 2WUFA 1Y82A 4EPTA 2BFBB 4Q3CA 1R0KA 4FUTA 5JXGA 2G0NA 2C31A 3VR5H 3RWRD 1KEEB 2Q7HA 3I9V6 3VIUA 1RABA 1L1EA 2VTKA 3BGSA 3TQRA 1ZNWA 3UFXA 3JQ8A 4D5EA 5C7IO 1BE6A 1SBZA 2ZPAA 2D3WA 3DOCA 1USIA 4NMHA 3K2BA 3THWB 1N3YA 2I1WA 3SBXA 3GFVA 3ABLC 1QANA 5D1HA 3C9RA 1ZNQO 1TTPB 2ATVA 3E48A 3L7CA 4NAHA 4WK6A 1BDIA 5D6NA 2CUZA 1J24A 1KETA 2V1XA 1JPVA 3MFQA 4JR2A 2IWRA 1F12A 3SXPA 5C4IA 2W4QA 1DJPA 3LP5A 5IZCC 2BGKA 1MJNA 3GRKA 2B7BA 3H2BA 3MJTA 4QO7A 5B37A 3UWKA 4A82A 3QVUA 3G67A 4GGOA 1KI4A 5KTTA 2ALEA 2GZLA 2P9JA 1T1EA 3ROXA 4CW7A 1CB0A 1J2UA 3OE1A 1R1BA 4KXFB 4B87A 4IMRA 1BGWA 1GUZA 4HNTA 1OH5A 4GPBA 1GPYA 4Q20A 3H84A 4GPAA 4LTNA 5IZ4A 4B76A 1YUNA 5DBHX 3H1PA 3BMQB 1A5SB 1Y3CE 1XB2A 3DM9B 4JQZA 1RM4A 4KQKA 4TSKA 1KZ4A 4JH0A 3WLMA 1S3JA 1INLA 3SGIA 1ZI8A 2KW5A 3KKEA 4NV1A 2EF0A 3MPUA 4C4PA 1B14A 1JKJA 4R81A 1QLJA 2XXAB 2QVXX 5JDCC 1JLLA 4G24A 2FMTA 4JDUA 3KYDB 1UFIA 2KTVA 4JJIA 4JSTA 3WIEA 3S28A 2O7NA 5TVKA 1EGMB 1ZWIC 2FWNA 1M8GA 3D8TA 1H23A 3G6WA 4PE5B 1LGYA 3G8BA 3OY7A 4JUFA 5E8JA 3H5IA 5J5AA 4EPVA 1ZP6A 2D8MA 1CS0A 3GELA 3LRXA 4ZVRA 4YDQA 1Y6RA 2IJKA 5DCYA 4H0CA 4DNFA 1YS2X 3AKZA 3V33A 3SSNA 2YINC 2JAUA 3T35A 1EAYA 1GPWB 4WCVA 1S8OA 4ZYYA 2EIXA 4H3SA 1W42A 1TAGA 5NULA 5IFKA 3TAXA 3I45A 4F72A 3C5HA 4B85A 1GPDG 2VR1A 2WQ7A 3DGFC 3DR3A 1KI8A 3TQFA 1BW9A 2DQKA 3A0HZ 3CKLA 1LFAA 1UBGA 3B1YA 4WXYB 3VO2A 1NUPA 3CVVA 3BTVA 3S1SA 1NVFA 2GXSA 3HCDA 2W2VA 1K3FA 3H6KA 3Q7PA 5HVNA 1UK7A 2XMBA 2YHIB 1V5EA 4P35A 1RWWA 3S1AA 3DKPA 1KU6A 4GM0A 3ZHTA 1RS0A 1U11A 3ZO8A 3GUUA 4TWKA 4UBKA 4WEOA 4XYBA 3LJKA 1OXVA 2Z1UA 1V1MA 5DGDA 3N8HA 3BSSA 4DSOA 5M5BA 1OX6A 3J81k 1N34B 1RWPA 4P4LA 2ZLBA 4CE6A 1VQLF 1BZKA 2IGBA 1CHNA 5LZ4A 4XCVA 1A32A 1IAQA 3U56A 3CT6A 3PNQA 4X9QA 5L3BA 2N1BA 4Y6QA 4BO2A 4BPBA 1PXWA 2ZSHA 1JR3A 2FAXA 2Q8NA 1FDUA 1PJSA 3FF4A 3FKSD 1I7SB 4K3AA 5HXUA 1HNXO 2Z2XA 4W82A 2DT5A 2R97A 3HSKA 3CEAA 1VC2A 1QVRA 3K0EA 2PGGA 1O6BA 3VOSA 4AN0A 2H5LA 3UHJA 1QRTA 3EUFA 1KDOA 4UCOA 2QWRB 2CTRA 1VQNF 2RARA 3FVQA 3CEHA 2R6ZA 5T5QA 2PMCA 3DDCA 4KQCA 2V7EA 4ARZB 4NSNA 3V7NA 1NTOA 4QFBA 5AVZA 2FRXA 1AS2A 1GCAA 1AS0A 3AV0B 1CJBA 1P5ZB 1M1KW 2VJMA 2MSDB 3EQ9A 4H7PA 3WIBA 4BTEA 5DVZA 4CXMA 5K51A 3PSAA 4F84A 3GLIB 3EGDB 3A4LA 3HKDA 1CXZA 1FQJA 1KY3A 3VR6H 3I12A 5EZQA 3K5LA 1FRZA 1SUWA 2A5JA 4G2NA 4MQ4A 3I3FA 3RGBA 2JI4A 3CNLA 1S5HC 1W9HA 3JWGA 1FMCA 4M2LA 2IPOA 3PX3A 4OAPA 4KHPO 4NR1A 2YEVA 1NJ6A 2CD9A 4PZPA 2FR0A 3ITKA 2ZQMA 1U90A 1WW2A 2IEDA 1WCXA 2PS1A 2AGAA 4YRFA 2JASA 3DZJA 4PPYA 1VBNA 1RAEA 1KFCB 3KJHA 4CM6A 1FNDA 2A9RA 2ZYUX 3C6YA 3CS5A 2EX0A 4JI2O 2QEXF 1IYZA 3L4JA 3W5AA 10MHA 1FX0B 5E8RA 2ZWMA 3ZWYA 4BMVA 2H2FA 1MP0A 3I01M 1NF8A 5CFLA 1D2DA 5BNZA 4MHTA 4YMIA 1I7FA 1E3JA 1ZQ9A 2CMGA 2IIQA 3AM5A 1KIFA 3EOAI 3JAMN 4PSAA 5GV8A 1R4NA 2AWOA 4QBKA 5CB4F 3KOMA 3RSOA 5LZ2A 3DXRB 2ZAMA 3AR4A 1U0SY 2UXDB 2Y48A 3WJQA 4MRVA 2FW9A 1M8PA 1VQ6F 1E2GA 1XMSA 3ZH9B 3NEPX 1S7CA 2OHWA 1C3JA 4W63A 1G8SA 4L5AA 4XX0B 2BMDA 3WTCA 1IXSB 1AILA 1ESMA 3RE3A 1LC3A 4J4HA 1CEZA 4UUQA 4CMEA 1HG0A 3ON5A 1AROP 1DJOA 3FPAA 4Z2YA 1SQFA 3FE2A 4OJNA 3WS7A 4MVJP 1ZL8B 1DAHA 3EEOA 3ZNQA 3DM5A 4DG8A 1QVFU 1RSOA 4ZYVA 1V4VA 2R11A 2VFAA 1MH9A 3G2JA 3IBCA 4G41A 5WRFA 3DMYA 1YI2F 3VVCA 1G20B 4MPRA 2C1ZA 1V5IA 1VZ2A 4D26A 1VQMF 1SEVA 4D8TA 4DW1A 2QI9C 4RH3A 5CIYA 4V3CA 1ZD8A 4JI4O 4BY9D 1RYZA 3UMJA 4B4KA 4YV2A 1NXTA 1FS4A 4QT0A 1YVRA 4UBIA 3GEHA 3OX1A 4J0IA 4OU4A 1U63A 3A04A 3SJCC 2PMDA 3NTRA 3FCOA 5HRAA 2Q7XA 4KU4A 4ENPA 3R9XB 5EIBD 2Z8YM 5DWVA 1AKNA 5BWNA 5LYJF 3BICA 3O2NA 4EELA 1H9CA 5KA5A 2RHLA 1QVGF 1I36A 1KJ8A 1S89A 1V8ZA 2O2EA 4HH3C 1CJSA 1FP4A 1G20E 1TUEA 4FFPA 4G8DA 3K1TA 4GCZA 4OHWA 4B6GA 4O3MA 2IYNA 2IUFA 4EG8A 5KSZA 3OQ1A 4HLUC 4Z9BA 4EFEA 5LKAA 4R54A 1R5NA 4EK9A 3ZJ5A 2QXYA 4RD2A 5LWHA 3PAFA 4EPYA 4I4TA 1EB8A 3BIXA 4FU0A 2PS9A 4OEHA 5DYTA 5LBTA 3ZBUA 1MO6A 2D2FA 1IONA 1T0HB 2ZVJA 1BXGB 1WKCA 4P7FA 3V7EA 1CP2A 2FZLA 1SCUA 3DBLA 3C85A 2VAMA 1LK5A 2Y0EA 3QTTA 2WWTA 1TW2A 2AOXA 3VZSA 4KFCA 2QM4A 3NHAA 1Q81W 4OIFA 2XCQA 3KJFA 4GI2A 5K3FA 3TAUA 3V80A 1XTPA 1K0UA 2IQQA 1NJIW 3DO8A 3NDPA 4M1OA 1EUZA 4WXEA 4EGFA 5A5VA 3I9FA 4MCHA 1ORDA 3SDBA 1DRKA 1HNWO 1JHZA 1FTQA 1NVWQ 4BVSA 2X22A 4N5IX 3U49A 3QOXA 4MYTA 2CZWA 1G6KA 1P7WA 3CCRF 1OFUX 4NYIQ 2GCGA 4GI5A 4OIMA 1KJNA 1V3VA 2QTBA 1SUSA 1WJGA 4O6VA 3MINA 5BW5A 5B6PA 1WSDA 3IEKA 1EX9A 4GMDA 3E5RA 3GY0A 3WWOA 5KQMA 2AW5A 3A26A 3L06A 4EKEA 3DDNA 2ZCEA 1A82A 3KE8A 3LKVA 3WP0A 5C32A 2PSFA 3K70D 4FYHA 4K28A 1T8YA 4J7AA 3AUAA 2CVQA 2H51A 4XVRA 1JT9A 3DAOA 1G8JA 5EE1A 3EIQA 4A1OA 3RAFC 1VXRA 2IYEA 1DC4A 1T35A 1QPGA 2GX6A 2P91A 3KOOA 3LHSA 4R2IA 2V4MA 2QBYB 4MRPA 2GXAA 4RDXA 2WYHA 4KPUA 4J2TA 1J2JA 3V48A 1XR3A 3KDSE 3R9WA 5J2TB 5L3EA 3IC9A 1YJWF 5KEIA 3H19A 5LD2B 2XAFA 3E1GA 1GZ7A 2ADMA 5J23A 4KWIA 4KXXA 2FSIA 1K3UB 1SIBE 3ONNA 1RE1A 5ALTA 5DX0A 4DC1A 3L5KA 3C9TA 1OC4A 2BEWB 4EEZA 3H0CA 2QP9X 1R0LA 1DHTA 4GPTA 1JDZA 4NQRA 3W8DA 3OIYA 3RYCB 2AFHA 4R41A 2EIKC 1OLUB 1ORVA 2C1XA 4HZUA 2QKCA 4YJ2A 1BHBA 1RI3A 1UT5A 2D5BA 2JC3A 3Q7RA 1HZZC 5DSTA 3NTQA 4J8PA 2D5LA 3HB3B 2DN9A 3A6EA 3KSRA 4IDOA 2PKYX 4MWZA 1OYOA 1GJRA 2HGSA 3CB4A 3M1IA 4KAFA 1G5RA 2YVLA 3BK1A 1WZCA 1WU7A 1GP2A 1Y8RB 2V65A 2ONJA 1U43A 2RSLA 1H7MA 2JGFA 3DC2A 3FBGA 4K87A 3HKEA 1OFUA 4H18A 1G9SA 1M7BA 3QHQA 4E07A 3AVWA 3E8HA 2GPBA 2VUTA 5FPYA 4TZ0A 3ELUA 4UASA 2O8NA 3O8NA 5EXDA 2P5UA 1JT2A 1A04A 1UC9A 2X76A 3L0YA 1PG5A 2X8JB 2C4TA 1SBCA 4L5IA 5K4GA 3HR8A 4J0KA 2ZSIA 3KHTA 2DHDA 3RS0A 1GGHA 2WWXA 3FB6C 3V00A 4E7PA 4OK5A 2XT9A 3G2NA 1IVSA 2YXZA 1R18A 3AI3A 5DTJA 2VPYA 4G0NA 4RUKA 1E18A 1UPFA 4M9SA 3DF7A 1QIKA 4H0NA 1KFBB 5BYBA 4RVNA 1T1IA 1XZJA 4IQ8A 2ADQB 1R5OA 4GP7A 3MZ0A 4UUMA 5CYOA 3T99A 1TJ5A 5EWJB 3TQOA 1QV9A 4OFZA 4WJZA 2AN5A 3TJTA 5TIIA 1PR2A 4XPZA 4ZEXA 1WCYA 3KYCB 1J8MF 3EWSA 4XDJA 3HUEA 1IBRA 1HI9A 5CA0F 1C8KA 3AGPA 4JXJA 4E5PA 3B9PA 3MHSC 3C9UA 4AP5A 4C7UA 2CAZC 3A4NA 4DS3A 4LF9B 1YZHA 4DRZA 1Y8CA 4AB1A 2CFTA 2JGRA 2SKDA 3OEEG 2FPSA 2JA2A 1K8QA 4FFOA 4GMHA 4HRAA 4UNQA 3AHDA 3EGXA 4K3UA 5KQRA 4EI8A 4LCBA 4QTTB 2J6BA 3E05A 4M0DA 1AY0A 4RANA 3TM5A 1CPYA 1MUUA 3WGTA 4BLSA 4QX6A 1YIDA 1UBMS 3E9YA 3MELA 5JWPA 4XJTA 2AOUB 3SR4A 4F4CA 1RXWA 3N6RA 4BNUA 5C5CA 1G4HA 2D62A 2QWOB 3JX9A 4G5FA 4RETA 2E6KA 4X65O 1JD1A 3PDHA 2ZSFA 3UB2A 4I1YA 4C6SA 3F3MA 4V1CA 2J9XB 1LJ8A 4MV0A 1TYCA 1X9IA 3D8BA 4ESVA 3PJSK 4KR6A 1GR1A 3ZWXA 2XKAA 1XE3A 4EJ0A 5KO2A 2LW1A 1DV1A 3CWQA 5HCUA 1O95C 3T5MA 1D09A 2ONZA 2AF3C 2BFOA 1IY8A 1YR6A 3AM4A 3ZY3A 3WP1B 1JBQA 5ALVA 1QHIA 4C0WA 3WB2A 4YONB 3Q8HA 3IDAA 1S2NA 1Y74B 1GKUB 1VSTA 2V5UA 5AK5A 4I3GA 1D8TA 1D4AA 1I3OA 1AP5A 4TV8A 2H48A 2QN6A 1LDEA 1YEWA 4CR6A 3O2SB 1KR5A 1QZUA 1JR6A 1XK6A 2O2CA 4UTPA 1COMA 3Q4HA 4OQNA 5ALRA 3ADCA 3W06A 1O96A 4KLNA 2RIPA 3PHIA 4L07A 3ZOZA 4FT4A 1HBJA 4HP8A 4FFWA 1QGAA 1PV1A 4TXJA 5I8PA 2HO4A 3J81M 4MJXA 4N8EA 4EW2A 4E5YA 4YROA 4FE7A 3QK7A 1CEEA 3R6DA 1L4MA 5ILOA 2ROQA 1JFLA 2EFHB 1G38A 1P84F 2O59A 2ZOVA 1X7WA 4H2DA 3JAKB 2IYRA 2JEOA 4HAYA 4ZI7F 5BQ3A 3O8CA 3E70C 4JQCA 3R1IA 3RC9A 5L3QB 4ZIRA 1N78A 3K4PA 4C4XA 5TSDA 2NU7A 3C1TA 3C1UA 3DXYA 4OI0A 5JSUA 4X1KA 1E1CA 1YR2A 3C3AA 2QUIA 4HZIA 2EFEB 3MDSA 3VHQA 3X1MA 1NI3A 3CCUF 1Y4ZA 5I7AA 3VR0A 3C8HA 2QPAA 2ODMA 2J3IA 1UC8A 2P9ZA 4EBBA 5ED4A 3CVUA 1LDYA 1I8TA 3DQZA 4GKKO 3SVZA 3KDPA 5K0CA 3BYZA 3GLIA 1A8HA 4JSRA 1YO6A 3PV0A 3HKDB 4GZMA 2XCIA 4E6EA 1K5DA 1PV4A 2CL7X 4QE7A 2IUSA 2JLCA 4YJKA 4BNWA 2XYVA 4D9MA 4YCSA 3U5ZB 3D54A 1WXGA 4I6JA 4QUGA 1TM2A 2FZGA 2XF8A 2CLCX 3BE4A 1CK4A 3HR0A 3LP6A 3QX8A 2W71A 4XSHA 4YCJA 1RZ3A 3NPAA 1WMEA 2PJZA 1OSNA 4FD2A 4KHPB 4BCDA 1XDCA 1OW3B 1HRKA 1E6UA 5BYKA 1VPWA 4D25A 4R0NA 3DBHB 4L72A 3JCZA 4MKZA 5CH5A 3TNDA 1L7PA 3P0EA 4BEBA 5B5EZ 2QZ9A 5TC4A 1U7PA 1CDOA 4OLAA 3HCFA 3FTQA 2FN4A 4PZAA 4O2BF 4P3OA 2MW2B 1QE3A 2W4MA 2P4EA 1XJCA 3IYLW 2DOSA 1YAHA 2REQB 4DF3A 3K04A 4YP0A 1TQ6A 4EHDA 2CSXA 3MRTA 1G4AE 2DTEA 2HP0A 2C4MA 3SFZA 2W2TA 4R7CA 5AVYA 2IYVA 3BY6A 2VBFA 3S2EA 3OCUA 3QELB 3RUPA 4BIUA 5TEWA 3SPXA 2BELA 2D5CA 3LY9A 1DBWA 1RSOB 4ZI7A 1W4RA 1YACA 3CJQA 3MS2A 4ILKA 3WKAA 1GM5A 3W79A 2G36A 2CTWA 4QUIA 4DA6A 1MABB 1WVIA 3KD2A 4JX9A 1RLGA 4XWTA 4DBZA 1ONPA 3DFIA 4Y1FA 5BXYA 1RPNA 1O3YA 3OIDA 4M1MA 1K4MA 1QFMA 3TZBA 4IV8A 1KGSA 3UJBA 4L8JA 3Q2OA 3PT9A 4HBNA 4PANA 3VXKA 3E9MA 3Q0TA 4YRLA 4HNGA 2R1ZA 4R9NA 1ZVQA 4FYYA 5J3JA 3PGKA 1LTHR 4PR0A 4OUDB 2OO5C 3E2IA 5TQ0A 4CKXA 8LDHA 3KZXA 5JZVA 2ZRFA 4B3DA 3I37X 1O0BA 1KYXA 1U2QA 1B74A 4OG2A 4Q6BA 4D9GA 4LC0A 3AG2B 5LA6F 4CM8A 3JCUZ 2X2EA 1FP4B 3OICA 2G9NA 3A3YA 1EWKA 3NYQA 2ORYA 1M34B 4H59A 5FPQA 1BSVA 5BNFA 4UCQA 2ANCA 2NU9B 4ZWNA 4U7OA 4OHFA 2UZ0A 3C45A 4DLBA 2XUAA 1HM5A 3EUWA 2EWWA 3DV0A 3ICPA 4H4EA 4L4ZA 1VP7A 3IC7A 2Q3MA 3LNTA 3M5CA 1SRYA 2OBXA 1C7QA 1SCUB 1U3UA 2ZJYA 4LCJA 4L5YA 4LV8B 1PTJC 2JIZG 1DZIA 3RJ5A 4YUWA 4S3MA 3PHLA 5EZ6B 5DEDA 2L19A 1Q3TA 3WWEA 2NYAA 1QDEA 3IS3A 4Q9JA 1T0UA 5EKUA 2XNDA 4D80A 3BD8A 4QPDA 2W7TA 1V8DA 4XWYA 4K81B 2B82A 2GCPA 3OE7A 3EDYA 4RVDA 1X14A 2JFGA 1W87A 5FPRA 1M1XB 3M1LA 3SHOA 1TCCA 3GJ0A 4ZD6A 4DADA 4ES6A 3VYWA 3I5MA 4XWKA 4Y2UA 5SZHB 4UV9A 4BBZA 1NVPB 2ZIOA 1PL4A 2O7SA 3W7AA 2AQ8A 4ACAA 1DXOA 1N5DA 1QZ3A 2EF1A 2OSBA 4IXMA 4QQKA 1QZTA 1AK2A 3F5FA 2RNBA 3ABTA 2QUJA 1AHNA 1FFEA 3H1JH 1OBCA 1ZONA 2ZRBA 3MXTA 1GNQA 1GPMA 2OFOA 3H9JA 2EAUA 3OFSA 3WKBA 1YGPA 4NG5A 1ZPDA 1O97D 1FTYA 3I23A 3GIDA 3PDWA 5E6UB 3WIVA 2C7QA 4NATA 1SMKA 2RGRA 3ZE0B 2WM9B 3EODA 4IJVA 2JCSA 2ETVA 3K5IA 2J30A 4NTZA 4ASUG 2XGSA 3FKJA 5SY9A 1ZJWA 4NBWA 3UANA 4E4YA 4CEHA 2HY7A 5CR9A 1OPXA 1H2SB 1ZGCA 1A72A 2HQ1A 2WSYB 3AR5A 1XTQA 3P4EA 4CLEA 3ADDA 2QLBA 5DN6D 4OSOA 4E5MA 4MVZA 2WSMA 1E9DA 1PN3A 2F8MA 2DWCA 2H1HA 1Y7TA 1E2FA 2VWKA 4G8BA 1GGEA 4LXUA 3WOVA 1XZBA 3A11A 2ON6A 3KTFA 4GR9A 4BFCA 5G4LA 1PGNA 1I4EB 1K9VF 2YVUA 1DWUA 5HCIA 3OLQA 5HXAA 2ZWIA 4O4HF 4Q3NA 1GUFA 2G9VA 2WYIA 1UJ2A 2NU6B 4HWGA 2C7OA 3NORA 4V0NA 4HXYA 4RAQA 3KFXA 1LBTA 2O2GA 3G0CA 3UC9A 4V38A 4PZ9A 3MTJA 4XH9B 2B21A 3FOAA 3EIHA 1VQ7V 1XZEA 2D06A 1VP3A 2CZGA 1RXUA 2RDMA 1K7YA 1RMTA 4YJFB 5EE3A 5A04A 3CRCA 5IT9A 5FWYB 3TZLA 3GMIA 3DW1X 4D4LA 5F1PA 4MUJA 1ZOIA 2B5VA 2NPIA 3VO9A 4FK8A 5K03A 3AUJB 4H6VA 2HMSA 1K6IA 2HTEA 2Q9CA 2VHCA 2YWXA 4MXDA 3CF2A 3OQIB 2I1VB 2ZS8A 4LWPA 4PSDA 4YJHA 3PEVA 4JCOA 2BM8A 4BJ6A 1Q0PA 4Y2JA 5LDHA 1JHOA 2WEKA 1X9GA 4C78A 1JR3D 4TS4A 4B0PA 4QTYA 3CKYA 4CQMD 5EE0A 1XZHA 1N0WA 4E3ZA 1F8FA 3IV9A 1EWRA 2BY4A 4KR9A 2IEIA 3CR3C 2D13A 3KQVA 4WXHA 3G5AA 3RO7A 4Y67A 1L4LA 5D01A 5F1OA 5H4GA 1MPTA 2PUDA 4P0TA 1LBQA 3D3WA 4BNMA 4CFSA 2ZSEA 4ESOA 2HF8A 2QORA 3OLZA 3D5QA 4PA6A 3DCIA 3P45A 1Z0AA 5CB8A 1ZAYA 1PL0A 3RW0A 1NE2A 2COUA 4TV9F 3V1YA 4RYDA 3U16A 3HDJA 4OLBA 4A36A 2NSHA 3M70A 1WCIA 3TH5A 4N39A 4PN3A 1GDDA 1IPFA 3ZV3A 4DYHA 2Z2ZA 3L7BA 4HNQA 3PI7A 4UVEA 4AFNA 1XCMA 1ZUNB 2CW5A 3N0TA 1Z08A 4GIBA 3S68A 4BQSA 4P0QB 1VQ9V 1KYIA 2OGZA 3LCRA 4NMLA 3O47A 3Q15C 8GPBA 2CXTA 3D5TA 1ZSPA 1YB1A 2HR3A 2YHAA 3ZWNA 5AXDA 3M9LA 5DX1A 3CZAA 2A94A 3QXCA 3EZFA 4GWLA 3CE6A 4BWAA 2FZ5A 4BYMA 3DPIA 2O1XA 1F60A 3EPKA 2QR3A 2Z2YA 4II3A 5THKA 1UZNA 3KKKA 4MVJI 4UARA 4ZT2A 4OK6A 1XA4A 5LMNB 3LHKA 1P9OA 2HCTA 2QVZX 2Q5ZA 1UFVA 1GPJA 4YH1A 4TQDA 1RJFA 2WB2A 1N34O 4BQOA 1Z6QA 4LF4B 1H2LA 1NXPA 4F6RB 2HA0A 4I5FA 2QKYA 1NXSA 4KR3A 1CUIA 2IUTA 3RBXA 1KZHA 2HFKA 2P7TC 3QLJA 5DCUA 1JJ2U 1JN1A 3T4XA 3LSTA 1ODIA 3FIJA 3BBLA 2QD3A 5JD4A 1A95A 1TLFA 2LD4A 3DPSA 3LA8A 3RNOA 4LJ9A 2V6FA 4PNPA 2X4IA 2QTSA 1M6WA 1AKMA 4JF3A 3B12A 3I72A 3MCUA 4EGJA 3SU8A 1G4UR 1NZDA 1SVUA 2G9RA 4KTTE 3RJZA 5CPBA 2BGGA 1MHPA 2H9IA 4R9SA 1YIJV 4OH1A 4XGKA 3SKVA 2OQRA 1YTFB 2ITCC 4NZNA 4EKWA 1U0OC 2O0HA 3IQHX 3I3OA 1Y67A 3L6DA 3RS7A 1HDCA 4IGIA 4BMSA 1TKAA 3GWGA 4FHCA 2ORED 1RJ9B 3BGDA 4Z1MD 3QFFA 4JUDX 3WA7A 4YRBA 4L8YA 2XUKA 3SI7A 1W46A 3EFOA 1P9RA 4WAUA 5DWQA 5JPIA 1DIOB 2AZ4A 3K05A 1JQDA 1QRRA 2PCJA 1ZDMA 3LBFA 1FXKA 3QLTA 4HGNA 4L1KA 4LGVA 4LYYA 1LW6E 3WGMA 2QJWA 3JQBA 3QLVA 4RHXA 4WFQA 3WDMA 3CURA 2PHZA 3DR5A 3ILSA 4EI7A 3OOSA 3FHJA 4Q02A 1IN8A 1RCUA 5TT0A 4P7BA 2B8TA 4ZIRB 2IU0A 1MOQA 2DUMA 2R9VA 1BN7A 1E6EA 3MC1A 4FZVA 1D2NA 4JQSA 2HIAA 3AT1A 2HWXA 4L4RA 3P3PA 4MVCA 1B8PA 2ZETA 3FCCA 2DPHA 3OQPA 4C6TB 1GPNA 5FXMA 2C2GA 4IGGA 3DAFA 1W88A 1POWA 3Q98A 3ETGA 3BFKA 2BWJA 2GVZC 3ADOA 3BE5A 3HR4A 3KB1A 4QHTA 4C14A 2W5UA 4FLZA 3DMTA 4Z54A 1DC6A 4XKJA 1M6HA 3RVZA 2JHPA 3EEFA 1E96A 1UJBA 1D5CA 2GPYA 1KE1A 3SJZA 3TLAA 1PT6A 1N36O 5ELXA 3C3SA 3HKCA 4HWRA 3I53A 1E66A 2Z5GA 3O4HA 4H4CA 1N6RA 1EQUA 5JI3E 5LFAA 1OOEA 2JS5A 2ZR9A 4YN3A 1K5HA 1TK3A 3MGAA 4U02A 2JGMA 3LK6A 2ZBRA 4F1JA 1KJWA 1YR7A 4NOLA 1F9AA 1C4WA 1NBIA 3OPYA 5B8FA 3AKYA 4TM7A 3CZCA 4D42A 4BIMA 4LPSA 3Q3GE 5KZMB 4MAMA 1GZHB 4WK2B 3ZU3A 1KNJA 1CUWA 5CM2Z 1SBQA 3V4FA 3EXHB 2AJLI 5KAMA 2GOYA 2Y92A 4UMEA 3RIMA 2JCXA 1NZ6A 4B4OA 1YBHA 3OPNA 2P2LA 2HVYD 4DDMA 1B2LA 1I6KA 1Q95A 4EJMA 5K3CA 3BK2A 3TE6A 3IPAA 1BFUA 2QTWB 2CYAA 3PITA 1S5JA 1G2QA 1W76A 1YS6A 4IVPA 1V95A 4DMCA 4E1AA