3HKDB

Tubulin-tn16 : rb3 stathmin-like domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 115
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkdB01
1W581 3HKDA 4O4JA 3R4VA 3N2GB 3HKEB 5JH7B 4O4IB 4X20A 4FFBB 3UT5B 3JALA 5JVDB 3HKCB 5CA0A 5CA1B 4DRXA 4TV8B 5LXTB 4ZI7A 2R6R1 4TV9A 4F6RB 4O4HB 4ZI7B 4LNUB 1RQ2A 2Q1XA 5ITZB 5GONB 1JFFB 2VAWA 3JAWA 4HNAA 4DXDA 3ZBQA 5LA6B 3WGLA 4IIJA 5LYJB 5J2UB 3JARB 3VOBA 3HKBB 4XCQA 2BTQB 5LP6A 4U39A 3M89A 2VXYA 4E6EA 4YJ3B 2RHJA 2VAPA 4X20B 5IYZA 4FFBA 3UT5A 3N2KA 3RYFA 3ZBPA 4X1YA 3N2KB 4ZHQB 5JCOA 3V3TA 2BTOA 3VO9A 4ZOLB 4U3JB 1TUBB 5MN4A 3HKDB 3C8LA 5ITZA 3WGJA 4IHJB 5EIBD 5JQGB 4O4HA 4IHJA 5EYPB 4EB6B 5JQGA 4WBNA 3JALB 5LOVA 5IJ0B 5CA1A 5LXTA 4KWEA 5M7EA 4EI8A 1TVKB 4IIJB 4ZHQA 3RYIB 5IJ9B 4EI9A 4I50A 1TVKA 5MN5A 3JATB 2RHHA 1W5EA 4I55A 5C8YB 4O2BB 5KMGB 2RHLA 4I4TA 4LNUA 2XKAA 3JASB 5EYPA 4EB6A 5LP6B 3RYHA 2Q1YA 4O2AA 3JASA 1SA0B 3HKBA 5CA0B 5JVDA 4ZOLA 5LYJA 1TUBA 5JH7A 3M8KA 4O4IA 2VAMA 4O4LA 3RYFB 4X1YB 1W59A 1FFXB 4X1IA 2RHOA 3VPAA 4O4LB 3VOAA 5EIBC 5KX5B 4YJ2A 3E22A 3VO8A 3ZIDA 5EZYB 4TV8A 5BMVB 3JARA 5CB4A 1RLUA 3RYIA 5IJ9A 1W5FA 4O4JB 3CB2A 1FSZA 5GONA 3JAWB 1SA0A 4HNAB 4WBNB 5LOVB 1Z5WA 4EI7A 5EZYA 5BMVA 3RYHB 5MN6A 1W5AA 2XKBA 4O2BA 4I4TB 1OFUA 3JATA 3RYCA 3N2GA 1FFXA 4X1IB 3HKEA 5FNVA 3RYCB 3WGKA 5LA6A 4M8IA 4YJ3A 2R751 1JFFA 3WGMA 4TUYA 3WGNA 4TV9B 4TUYB 4F6RA 3HKCA 4DRXB 3E22B 1RQ7A 5KMGA 1Z5VA 5J2UA 5KX5A 4I50B 4X1KA 5FNVB 2GVIA 4B46A 4X1KB 5IYZB 4B45A 5CB4B 3RB8A 5IJ0A 4O2AB 3JAKA 5J2TB 5JCOC 5LP6C 1W5BA 3JAKB 5J2TA 2BTQA 4I55B 4YJ2B 4U3JA 5C8YA
chains in the Genus database with same CATH superfamily
1OVGA 1RKQA 3BT7A 4WOJA 3WL4A 4IIVA 4WOKA 4EG6A 1QO0D 5DHQA 1XCBA 1BN7A 1Z7GA 3COSA 3WO0A 3WY9A 4GI3A 1R9JA 1S2MA 5CLLA 3OQBA 3DDNA 1FJ2A 2I7CA 4DRXA 2QK4A 1G8MA 1TNDA 5JDCC 2GJ9A 4ZI7A 3K5PA 3KCQA 3MTEA 1BA2A 4UQOA 3WJ2A 2EIKC 1Y6JA 3P71T 4JUIA 5DN9A 3JAWA 3K12A 1O95D 1T8PA 4GSYA 4AAYA 1VI6A 2GPNA 2D54A 3E3LA 1IBKO 2NZVG 4N0MA 2GHYA 1SKAA 3QU4A 4IUDS 4LSGA 4EATA 2W58A 4LYDA 1KSJA 5E3HA 4A7PA 4TWKA 3I28A 3MT0A 1JWAB 3MWDB 5FWXB 1GTVA 4L0DA 4NV1A 221PA 3OJEA 3L49A 1VE7A 1EU1A 4WFAV 4TOIA 4ZOEA 3UCEA 3ZLVA 2GS9A 5JXHA 1Z6QA 5CVUA 2PZAA 3CFYA 1ZWKA 2PV0A 1W85B 3C3WA 4AUEA 3RNLA 2FZWA 3DHYA 4ZU6X 2H9YA 5LQJA 2JS5A 1C7QA 1J22A 1LF0A 2Q5HA 3CX8A 3MGKA 4KQGA 3B1JA 5ALTA 2XADA 4X92A 1TJPB 3DMHA 5K9ZA 1GGKA 3MQFA 2VK2A 2VZLA 1KA9H 4IYJA 3GZTB 4NCNA 1D2MA 1VE3A 3C3SA 1A9TA 1JQ0A 3HGQA 1N9KA 1ZNYA 2LDXA 3H2BA 5GJBA 2Q6KA 2YEVB 4EUFA 2ZUSA 1IOWA 5EYPA 1MR3F 2NVUB 4OJNA 2HZBA 2Q69A 1E7MA 3NFYA 3G8BA 4FK8A 3RHSA 4KLRA 1HLGA 4ZOLA 4FCWA 4DLWA 3JD4A 2CL7X 3ZDDA 2FA9A 2IHUA 2KE5A 1KBHA 4GAEA 3IXQA 4HGNA 4OBBA 1KJYA 1UKZA 2HP0A 5JD5A 4QGPA 2ZJ8A 2F43A 3BGIA 2OO3A 4WDRA 2G1PA 4J42A 4QE7A 4LDRA 1KVRA 1GU7A 4D3FA 1G6OA 1L4MA 1DGSA 2CKDA 3AG5A 3LV8A 3F6YA 3NMUC 2Q9LA 1RYDA 4B7EA 1YZNA 1EBUA 2O7VA 4RAQA 1VPVA 3TM5A 4JL6A 4EKNB 3I09A 2QPTA 3BIJA 4BQPA 4R1TA 1US6A 5EWJB 2GGSA 4Z9FA 4EM6A 3FI9A 2H54A 4HLCA 1Y1KE 2G4VA 2J3MA 4IUYA 4B34A 1VJDA 3HDYA 2Z0AA 5HJ5A 4RXMA 4CDNA 2NZUG 3MDOA 2YIAA 1GRJA 2A78A 3OFNG 1YR3A 2FX3A 4P3KA 4RQTA 4B7CA 9GPBA 2GK6A 2ZJ6A 3PHLA 3WLHA 4DVGA 3WB0A 4QUGA 2JZOA 2EARA 3ETQA 3HGMA 2W6IG 2GZDA 3OQMA 1RYEA 2XCOA 4ETNA 5MGNA 1V8BA 3CCJF 2AG0A 2IBMA 4TPKA 4BNKA 1V0JA 2AEJA 3BHIA 1YS2X 3PUVA 4OEHA 1ZN7A 4MR8B 4CETA 2ID4A 5BPFA 2OZPA 2H5JA 4Q6BA 3Q10A 4JR2A 4L78A 1KYOF 1P1RA 2CMFA 4IW3B 4UAVA 5EGNA 2VPQA 3T3OA 1P44A 3VRHA 3T7RA 3TTXA 1P73A 1XKLA 4JBGA 3BXOA 4ZT2A 3VZPA 4TVSA 3VDNB 3L73H 3ETJA 4MAAA 2ACVA 3RRBA 4RCYA 3TQFA 2JDID 3JQAB 3Q7EA 1D04A 3V4DA 4K6OA 4P53A 3BE5A 3HR7A 1DHRA 3EMDA 3F0FA 1M1YB 1P2GA 5A3QA 1IZ3A 3HFGA 2QTMA 1SC9A 4ER3A 1OV6A 2VP2A 4R8RA 3LX6A 3FUVA 2IHVA 4BDSA 1N3LA 3DLCA 1N4CA 1UMCA 1P1HA 3DXYA 3P2MA 2WOOA 2R8YA 2YFKA 3TSZA 1YZTA 1ZMOA 4GX0A 1CVLA 2ORWA 3CHYA 3HA3A 2OYRA 4BNUA 3EASA 2WJAA 1SBQA 4KP4A 1Y1RA 3D8UA 3QMMA 4P1ZA 4EG1A 4RLQA 2YFHA 4F5ZA 5CDFA 1TUGA 5IEJA 4Q4LA 1YIJF 1OXKB 3TQRA 4UUJC 3DTTA 1F6WA 2FN3A 4XX0B 4BLTA 2H57A 3CISA 3ZRWA 2H8EA 1IY2A 1CSEE 1V54B 4BGEA 4I1RA 1TA4A 4CH3A 1W48A 2I7DA 2IYQA 4ENSA 1F2UA 4D82A 3LDGA 3VKUA 1ZW6A 2HDHA 3CNNA 2UU9O 3RC7A 5H4GA 3DF9A 3PEWA 3KHTA 3OE5A 3OFJA 1M7GA 5T3YA 4WCVA 2X6BA 2VP6A 2OP1A 1KAGA 5LBTA 2PKCA 2VUIB 5D5PA 3PF8A 5SICE 3L1IA 2PQMA 4QM6A 2H9AA 2REBA 4UD6A 5K0TA 3FRHA 4K88A 1KMMA 1WMDA 4N3NA 2FSVC 5CHEA 5FOTA 4EKGA 3N9IA 5GINE 1OKKA 4JLBA 1DT3A 4ZDJA 3ZWQA 1LVGA 1W49A 3NPMA 4MCIA 2P2LA 2I29A 1N4AA 4L7QA 3MQ4A 1CUSA 1DQZA 3AR4A 3WB2A 1UIRA 4NE9A 1YH3A 3O8OA 3TAXA 3LT1A 1QMPA 1DKOA 3D3WB 4LDJA 4E4YA 2F1JA 4GR5A 4X66B 1TUEA 4ZQHA 3E7PA 1P8AA 2OCXA 2XUHA 3ZWMA 1DXYA 2ZYIA 2D00A 3DUWA 3CW8X 4EJMA 2HYIC 2O3QA 2Y1FA 3O3NB 2WPDD 3ETHA 3MCVA 2XVMA 4PZLA 3QMWA 4H7JA 3C1OA 4FOSA 2HEPA 4ZZ2A 2XHZA 4RMHA 3B1VA 1T9KA 4IV0A 4ZCQA 3TSAA 4XFDA 4AQDA 5JISA 3PTAA 1D7AA 1Z82A 2HHLA 3TFWA 3X2FA 4FYYA 5HSGA 4EABA 2W6JD 4NDZA 1BNCA 1Y7TA 2IYWA 4WZBB 2RGEA 3S55A 1CUZA 2I2WA 4MWEA 5C31A 4PG6A 3P8ZA 4HTAA 4AULA 1C1XB 1PS0A 1RXSA 5J43A 1E6LA 2AS0A 1O6BA 4K28A 4YBZA 2WM9B 4ZQGA 4YMLA 2WLIB 5EC8A 3Q11A 4G28B 2HQSA 2QYOA 3VQYA 3BAFA 4DIKA 5JS1A 5B1BB 1GL3A 3V34A 5A9TA 4FWTA 4FZ0A 4KLAA 1OB2A 1YGPA 4J9VA 4B80A 1XKXA 3FDJA 4H3SA 2EJCA 2F1HA 2P2ZA 3KZKA 4ID3A 3UVEA 3FB4A 4RDCA 4YR9A 4Q3DA 1PL6A 4D9IA 4N18A 1E2JA 1YC2A 1BVUA 1GU1A 2Q5OA 4GNKA 1DP4A 1UZUA 3AZPA 1DTOA 4MYUA 2MDTA 3H17A 1VLLA 1NOIA 3R0VA 1Q50A 1J4AA 4Z8XA 2EEPA 3VYUB 3NTRA 2QLMA 1X2EA 3W5IA 1H2MA 4G07A 1I3OA 2HF8A 1J1ZA 1U4OA 1PVVA 3UMBA 2JH9A 2R2AA 1MX9A 3IMFA 5BNFA 4DG9A 4HB2A 3PBKA 2GYWA 3EUEA 3PDWA 5FPSA 5I7WA 3AVTA 3KYIB 4BMNA 3UJPA 3HSSA 4Q9JA 2NV2B 1BX3A 2FQWA 2NTEA 3BFJA 2W0MA 4TYPA 4MQUA 4BRUA 3UT5B 2QVXX 5B6IA 2HW8A 5AJZA 4Z6KA 3WBKA 1M0TA 1PNOA 1QOQB 4RWZA 3WLRA 1JIKA 1QQTA 4FWBA 1IXSB 1YI8A 1N0JA 3PRJA 4E32A 2ZDQA 2XWJI 3WR5A 1M5UA 5JJBA 5JYBA 3ICOA 3FFWA 4FQ8A 3MWFA 2QPOA 3AI1A 2QTWB 1Z2EA 3OESA 4FR0A 5DTEA 1IQUA 1VIAA 2RKOA 2AC7A 3D7MA 3H11A 3K1ZA 4NLLA 1T0HB 4TYQA 1M74A 4KW7A 3WU2Z 4WTOA 4UPEA 5I4KA 1RJWA 4MDHA 2AFHE 3QVSA 4L0QA 4NG5A 1NSFA 4A6DA 1M34A 1J8FA 3CVVA 2YKGA 3CCCA 2OPHA 4DQ0A 1CRQA 2BFMA 2NSHA 2A30A 5TPZD 3O9MA 3V3KA 2QUAA 1JJ2F 1D4OA 1VIDA 4XDKA 4YUWA 1SUCA 3G2OA 3FYUB 4IMIB 1HDJA 4YUVA 3PQ2A 4A2CA 2WM8A 3TCKA 5CW1A 2A9RA 3FCCA 5BV7A 5EUCA 3SXUA 3Q7QA 2JLYA 3WJQA 3WJPA 5J1TB 5L40A 3HBMA 2VYND 1H1TA 1Z7EA 1HZJA 3QUTA 1CZHA 4XWGA 5KVAA 2ZZMA 2PKEA 3TEMA 1EUZA 2OGSA 4IH4A 4EQ6A 4KG7A 3SPCA 1Y42X 1U2TA 2VXOA 3UMJA 3PUHA 5AVQA 1AS2A 2JJMA 5T4EA 1JAYA 4RHFA 5EXXA 4KXNA 1RRPA 3A1EA 4BKOA 5AW7A 2A9FA 10MHA 5JVDA 2CSUA 4LF8B 3HTNA 2XNDD 2GV9A 2C83A 1U11A 2Q3MA 5COAA 5BN5B 3H4MA 2JVDA 1Y7LA 3FD6A 4F21A 2IC5A 4LCEA 4MTCA 4WMLA 1Q7RA 3VYWA 2BFFA 2OAGA 1FRZA 3CN9A 2O06A 3PIDA 1VLZA 2FN9A 1T5BA 4RC9A 2AOXA 2VCYA 2QGNA 4ZVTA 3HM9A 2DWQA 4J2TA 4TZTA 2XVXA 1YMQA 5DW0A 4YQZA 1JVSA 3Q7SA 2G1UA 4LF5B 2G0NA 2JVJA 1SIWA 5ECGC 5AW9A 3ZWDA 4ETMA 3HUDA 1RAAA 3FFMA 2WU4A 1LKZA 4RZHA 3MJDA 1W4BA 3TBFA 3VJLA 1VCOA 3SJ7A 2Q6TA 1JT2A 1GG2A 2VTEA 1J00A 2HM7A 1BO6A 5AKZA 1OF1A 3CG0A 4QA9A 1ISJA 1GT91 2W71A 3OIDA 4N7RA 1GUDA 3VH1A 4DLRA 5C1DA 1BT8A 1C3JA 2V6FA 5C5CA 2M6RA 4KQ6A 5ERYA 2H1OA 2WT8A 3ZJUA 3H6GA 5IAJA 3WZLA 3FZYA 1LJLA 3CY6A 1EUYA 4QBKA 4QGSA 3JWJA 3P45A 2GZ1A 4LDAA 4CLOB 1JKFA 2AHYA 1QM5A 1RRFA 3DE1X 4JK3A 4R31A 2NU8B 3NNDA 1I1OA 1O6ZA 5GAPK 1TQDA 2BISA 2J67A 2GJ8A 5TQ0B 3TIVA 2JS3A 2OBBA 1MHTA 1BQ4A 4L73A 1JHRA 4X6YA 2EG9A 3VJRA 2UYGA 2VDUE 2X3FA 2BFPA 5AVXA 5DVZA 4DDUA 4L57A 5FUXA 2J7KA 3PEEA 1WUYA 1Z25A 1H42A 5FL7A 1PR1A 4A10A 4D9BA 4RQOA 1VKZA 4E5PA 2A0LA 2OV8A 4Q4HA 4DNOA 2C95A 4KTVE 1VHJA 1NUUA 1WW3A 2VJCA 1CUUA 1PUXA 3IV9A 3VKVA 5HRAA 4IXTA 1GUZA 1X7YB 4H0NA 3BVPA 2DQYA 1MABG 4LQDA 4CEHA 1FBNA 1U3CA 2R4UA 1T6XA 1ZKDA 4I6JA 1BFUA 3C45A 4F1JA 1W94A 1K5GA 3LXMA 3Q85A 1QLHA 1W40A 2R00A 3V4ZA 2UYYA 1M93A 1EIZA 3JW8A 3K0SA 4HLQB 1Y1PA 2WD8A 4X85A 3P1JA 5JOQA 3AILA 2LIVA 3U7IA 4DIUA 3K0BA 3WYEA 3V7WA 4IEFB 3UENA 2HMUA 3OQPA 5F1YA 1YSCA 4CR6A 1DC7A 2YWGA 4NU5A 3UYKA 3PLAE 3OFSA 1OBCA 2WG1A 1BMQA 4URXR 3I5YA 1Y1TA 5LJIA 2NIPA 5JC1A 3OHPA 3PT9A 4RQFA 5DSTA 5KINB 2VAPA 1BE1A 4E21A 3CMAF 4XH9B 2XEDA 4JCOA 2W6ID 1FLNA 3NYWA 1ZUNA 4HDOB 1S72F 4JEHA 3LGXA 5IJWA 1KS9A 1X42A 1XRMA 2NZYA 4JBNA 3PJRA 1UXJA 1U02A 2RJOA 2B92A 3M99B 5BQXA 3O82A 3FNIA 4J2HA 3WLMA 2CNLA 5EY5B 4G0QA 4LJ7A 4P30A 3DOFA 1QFYA 3WFIA 1AP6A 1XHOA 2TMGA 4OKSA 3V4LA 4HFNA 1EB8A 1IPHA 1IY8A 2OFOA 3IEIA 4YJHB 5BSGA 1UAGA 1FFWA 2OSVA 3ZHOA 3OT7A 1N1GA 1G2PA 3UF0A 4PV1B 1H23A 1P45A 3HXTA 2AKEA 1KQ3A 1IX9A 1IJKA 4LFAO 1C9NA 2EAUA 2J3IA 2QM0A 3C3CA 4BIZA 1Z34A 3NS7A 3VHXA 3V2IA 3BFPA 1H0RA 4LXIA 4GW3A 2W6PA 2GD1O 1M2JA 2F4VB 1YQNA 4COKA 1U2EA 3R40A 3CKYA 4UMFA 4DS3A 4EFMA 4AWBA 4BLUA 1I3KA 4MQFA 3UA4A 4EHDA 1NN3A 3RBZA 1Z8HA 2Z8ZA 4KDRA 3CVXA 4P2ZA 2ALJA 2LGQA 3IDFA 5L3QA 3BMCB 1DCMA 5E9WA 4A0SA 1VLQA 4G09A 4MR8A 1AI5A 5B1IA 3FYUC 3P4XA 1KYXA 5DOZA 5DNCA 2JLCA 2XWQA 4BTVA 5LIRA 4C3ZA 2PRZA 2BM1A 2ZJ1A 3EQ6A 1QVFF 1HGXA 4CWAA 3DOUA 4Z5XA 1WBJB 3F1KA 3MHPA 4DIEA 2BDEA 2D7JA 1UT8A 1UFKA 1W1UA 1Y5LA 4UUNA 4HQOA 4KQWA 4N5MA 3F6MA 4RY9A 1I1QB 5EPEA 1JALA 2UXBB 4RDHA 3R3XA 1TMGE 3WWPA 3U6BA 3NTUA 1Z73A 1BS2A 3UAVA 3ZVLA 3L70H 2PL9A 4E5NA 1WP7A 2N9UA 3QBVA 1YITV 2DJ5A 3MWGA 4PZYA 4WFEA 1XMOB 3LWOC 1TO1E 1ZISA 4Y0NA 1ENYA 1PWZA 2O2DA 3OEYA 4H31A 1C9JA 2XMSA 4GZ3A 3ZN2A 3SDLA 3P9NA 4DHWA 5IABA 4NCAA 2IJHA 2VXCA 3C5VA 2CDAA 5B2ZA 5FOQA 1IZYA 1YU6A 1ZK2A 3BA1A 4G2NA 4NHEA 2VBCA 2O8FB 1IBMB 4A8JB 3WKCA 2GSDA 5JAQA 2NQ2C 5KHOC 3Q6NA 3RADC 3RB8A 2C7OA 4M6WB 5IJ0A 4G5XA 4CV0A 4KE9A 4W9NC 2XB8A 4LJ5A 3QX3A 4MEBA 3D3JA 4YJDA 4ECEA 5EMJA 3USCS 5FJ4C 3L4KA 3VV2A 7ADHA 1Q19A 1K7YA 1W0JG 3CR7A 4DG5A 2VGMA 2CZGA 1F8YA 5ALRA 3SU8A 3QIAA 3BDVA 4Q18A 4Q00A 2GDJA 2QR4A 1PDWA 2JBAB 4U2BA 4ZU1X 5FB3A 4LN1A 4AIIA 4BAUA 1XJCA 2VH5R 1DUSA 3JWPA 4B79A 3M4SA 1DI0A 1VIMA 2VPXA 4R7ZA 3IKTA 1G4UR 2J6CA 2XH8A 1HK7A 4Z9YA 5EBWC 5ENDA 5I5EA 3EIUA 4MCJA 1JEQA 3ME5A 4NZOA 4X84A 1RYBA 4A1OA 3ENZA 4Y9SA 2HYDA 3PNOA 3P10A 1UDBA 3O8QB 4QRHA 4QUHA 1U0JA 4WESB 3NHWA 5EXDA 5ILGA 5JS2A 3G49A 3L0OA 4XCQA 4C4RA 1CZUA 4Y2QA 1R3DA 1U1DA 5BQFA 4KE6A 2ZAUA 3EGEA 3AVOA 3FW1A 2ZCVA 4YV1A 5TS3A 3ZV7A 3GLIE 1D4ZA 4JBXA 5GIPC 4GXTA 3KHKA 4QQRA 2YBEA 3VJMA 1L5FA 3R5XA 2CNBA 1NXSA 3N2KB 4AMUA 4LWOA 4QVGA 1ENOA 3PDIB 2J5RA 3T7KA 3W8RA 3I45A 1HKHA 2RAUA 4HXYA 3OD1A 4JVMA 4MPPA 1E2NA 4I5FA 4E1BA 3AI3A 5FORA 5AVZA 1A9RA 2P5TB 3RVBA 5HCNA 1O96A 2PGAA 5TDHA 5CA1A 3RGGA 3NH9A 4DEXA 3K9FC 3AERA 2WR8A 4AO6A 2JBAA 2ZJ5A 1SOVA 1DT9A 1BW9A 4J0KA 3ZEDA 4MTOA 2BGRA 3A6DA 3K94A 1L5OA 2VCEA 4LJSA 1JTFA 3UUEA 2HT1A 1MPXA 4JI8B 4X97A 2M32A 5C8YB 1UKVY 4OI4A 5BOSA 3QVNA 4HLUC 3IHKA 2CUZA 4TQUS 3W4KA 3F6EX 5EWMB 5KNCH 3DZIA 3OIWA 3I04M 3GP8A 1FXHA 1O8BA 2AYXA 2PR7A 2SECE 4LHWA 1PFQA 5EHXA 4CQJA 4DCTA 4WVFA 4CF5A 5H9VA 2Y0DA 3OH8A 3Q4GA 3UAZA 3IAFA 3E5NA 1KBOA 4GI2A 2X8JB 3ZNNA 1I2DA 3PK0A 1N8NA 3EG9A 3LHIA 4HN2A 3LDHA 1L9KA 3ITDA 4E2XA 3PDUA 5PNTA 5D6NA 5KX5F 4F86A 4UVHA 2KB0A 3CRW1 2VP9A 2IS1A 1DKRA 3MPUA 2VP5A 2PI5A 1BW9B 4B3RO 2QZJA 2GVZC 1GHTA 2VKQA 3GZNB 5HXZA 3QFFA 5DYYA 3W5BA 2EU8A 3V5NA 3FFBA 5BYAA 4XQCA 3FTEA 3ST7A 2IP2A 3OOEA 4GL2A 3AU8A 4WBNB 3AWDA 4HP8A 4W7IA 1ZUIA 5CCEA 2WJJA 1VSUA 1U4NA 3ZC3A 3FSGD 1NVPD 4PG5A 2V0CA 2OHHA 4Y6PA 4EO4A 1ML3A 3UYLA 1EP1B 4N1AA 1DBQA 1XTIA 4M1TA 4D43A 1J9GA 4TXLA 4D9JA 4B6SA 1Y4ZA 2OYSA 3CC7V 2PHZA 1M66A 5ELXA 3OTWA 1RZUA 2GAIA 1FLDA 2QQ5A 3PF9A 1RWWA 4JUCA 4PZAA 2CLSA 1KPIA 1EB9A 3ICWA 4B1FA 1UPXA 3UMRA 1EJ0A 4QPKA 3ICQB 4IIHA 2P0EA 4ABTA 2Q6VA 1Z16A 3CRRA 1JG6A 1WZUA 2XTNA 2O2YA 3E22B 3SXJA 3ZTWA 5I5GA 3PDCA 3RGBA 2XDQA 1U3LA 3CRCA 1U7HA 2QNRA 4K40A 3C16C 4RK0A 4C8EA 2EFCB 4X1KB 3CHXA 4XLLA 3BXXA 5C1PA 1H6AA 3PQ6A 3EDCA 5K20A 4O2AB 3BEDA 5E8RA 4W1PA 1X7ZB 2BMWA 3AK4A 4E5KA 4RSHA 1MP0A 4EFNA 1CJBA 3HO6A 1TKAA 4F4FA 2YEVA 2NV0A 1E2IA 1W581 4FWIB 1NA5A 1AXGA 2QTRA 4G0NA 1QHHB 2PTHA 4RZIA 2V1UA 1U0NA 3GNTA 1M1XB 1RM1C 4O4IB 3BL6A 4V2UA 3SPXA 1P75A 1Q14A 5IAOA 2IWHA 4OA5A 2QGFA 1DKQA 3IT2A 1P7BA 1N2SA 2C7PA 1NI4B 2O1EA 2GEFA 1LPBB 2RHTA 1RNLA 3TTTA 3WXBA 2GCOA 2GM3A 1JL3A 4TLEA 3W05A 5HY4A 4JP2A 4Z8YA 4DNXA 4NTWA 1DMSA 4B3XA 5JAHA 2Q4RA 4FEGA 3C6MA 4GUAA 5I8ZA 1M8KA 2QSUA 3WO1A 1Z8FA 4GQAA 3GD7A 3GO4A 3H9UA 3SLGA 4DSNA 4EUKA 2CFTA 4P93A 2B9ZA 1EVKA 5DM4A 4DVJA 1GWNA 1T2AA 1UCFA 2GZHA 5TARA 3X2QB 1QPZA 4GOJA 3F49S 1JE1A 3LIIA 3IOBA 1AQUA 1TRHA 2AJTA 5JV5A 2FPXA 1RLTA 1KEZA 2V5AA 4AF8A 5KAIZ 1TU4A 2Q4OA 2V7QA 4LVUA 4E2YA 5L3SB 2GZSA 4Z2AA 1Z0IA 3TH5A 1CNMA 4LXHA 3LYHA 1KOGA 2OM2A 3A0UA 2HLNA 2HMAA 2G80A 5KCZA 1SDSA 1NI4A 2GEJA 4B6RA 2RMKB 1P2UA 1ZCBA 1K3FA 1E7KA 1U9JA 1Z63A 2EZTA 2BKEA 2HWYA 1DWUA 2XOEA 4Y6RA 2AQ8A 5C8DA 3JQQA 3AFGA 5DM6V 2VDNB 1S4QA 3OU7A 4EL5A 3MRVA 3Q7TA 1OB5A 4QTXA 3H8JA 2XD4A 3LFTA 1A7KA 2R87A 1KEWA 2C3UA 4XUDA 1COWG 3I6YA 5DLPA 1L4BA 4JEMA 1HYQA 1DL5A 5DTRA 4QLBA 5FAKA 3IUMA 3AL0C 2XZLA 5CA0B 3RFRA 1YS7A 2QUHA 2IU0A 2JGEA 1V7CA 1FPOA 1VGVA 2XMPA 4YP5A 2VAMA 3VIUA 4YP9A 1V6SA 3AY7A 3ZLUA 1NMUB 4O4IF 5DHFA 3HXOA 1NJIH 4P3XA 1HBJA 4RJ2A 1L5GB 4M9CA 3VR2A 3AQ4A 3UXEA 5ED0A 4LZWA 2PWPA 1PTJA 3N6VA 4KXQA 4DOMA 2ZJBA 3T1VA 3OI7A 4A15A 4V03A 1F2VA 1VHDA 4DBVO 2EWWA 3OX1A 4LXUA 4IRXA 3USES 4PLPA 1CERA 2UYQA 3DCIA 1Y3AA 4WZBA 1PV0A 1HE8B 2ODWA 4D6YA 1PSWA 4LIPD 3ZK8A 1L0LH 3CB2A 3JVHA 3BMNB 4HH1A 2Y69C 4IJQA 4AJ9A 5F23A 1GEEA 3RABA 4FM1A 1D1SA 2AEEA 1FP7A 2B8JA 3MXOA 2IHKA 4WY5A 4YRGA 1OH8A 4FILA 2BD0A 4KR2A 2PJZA 5JARA 1KHHA 4KR0A 2Z6UA 1W41A 4TKZA 5KJFA 3IR7A 1A2KC 1TT7A 3RRXA 3SFVA 5CVTA 3IEXA 3LCVB 2VRWA 1X14A 2C8JA 2IEDA 3HXKA 1HSZA 2VNHA 4MUFA 4PM4A 3RIEA 3ZHQA 2IYSA 2Q99A 3GFRA 4YEDA 2QN1A 2BOBC 4WLNA 2A5FA 3LYBA 3D54A 3DA8A 3PG5A 3Q5DA 5HYVA 1X86B 2O1SA 2CK3A 1DC3A 2PPLA 4FC7A 4X6LA 5CFPA 1OH7A 1PKXA 4D3XA 4X9XA 5FA6A 1G3UA 4Q3CA 3NHMA 2A9VA 5FNVB 4K8XA 1E0DA 1SUDA 3DLBA 1USGA 1ZD8A 2E75B 1SCAA 2H6EA 3GYGA 4B6JA 1UP6A 2FWRA 1QBKC 2XOKA 4PZZA 1TPZA 1G6KA 3DT8A 3VOSA 1A9YA 2ARHA 3U56A 1NC3A 1D2RA 5LCXA 4B7XA 4HXGA 3O0TA 4PAQA 3H1FA 5IWAB 5G0SA 4H1HA 4QDTA 5C8YA 3WGHA 3EW7A 1ILEA 4ZAGA 1G1AA 3EDRA 3PJFA 4MOWA 1MABB 2GLUA 4LV6A 2WV9A 4CUKA 5KTRA 5KYXB 1EGVB 3TPFA 4ACBA 3KQTA 3DSQA 3DP9A 3T4DA 2A0FA 2MR6A 3A4YA 4Q82A 2K1EA 1B00A 1E1CB 1YU9A 2AEMA 1OCOC 2QXYA 2VDPB 3HK2A 3ZCUA 3DOEA 1M6VA 4TQGA 1H69A 3I56F 2X23A 1YA4A 4GVXA 4NZ9A 5DHTA 4D6XA 1WNSA 4EA9A 1K9MW 1OLUA 2QOEA 3FOCA 5THKA 3F3YA 1GGFA 1PLLA 1SQQH 2GZLA 1L7NA 2HPHA 1YT5A 2KHZA 3GPBA 1OFVA 4IDGA 4I6GA 5EZSA 3ZWOA 5LP6A 3AX6A 3CBGA 5DCYA 1M34B 2CHGA 1ZEJA 2HRRA 2IZ1A 1ND6A 2HP8A 3F98A 3FF1A 4PHTA 3U3MA 1YUMA 3UW3A 1UZNA 2ZE7A 1QS0A 3UKJA 2GK7A 3WL3A 5CJPA 1KEEA 1N2IA 3EXEB 2A59A 2EKLA 2IPMA 2JIBA 2ZAGA 3S06A 2WWXA 3AF3A 4NOMA 4NH4A 4ZHQB 3G82C 3TCUA 1T6ZA 3N6RA 4RHAA 1U1CA 2IE8A 5LNK6 3OJ0A 3PUXA 5G0VA 4NIMA 1WUJS 2TSYB 3SF8A 1UOPA 2JZNA 3W5DA 5EYPB 3DL2A 3GGOA 1GCGA 3MXTA 1PX0A 3PN1A 1E5DA 1RC8A 4RQBA 4LK3A 4B0PA 3KZVA 1ZSVA 4C4AA 5AJXA 5K03A 1IRXA 3DGEA 3APOA 1NNSA 4J0QA 1FUKA 4G27B 3TXXA 1HZZC 2RBEA 3DTVD 4RPHA 3CUKA 4GPZA 1TQHA 5JH7A 2B34A 2W2KA 4OHPA 3EZ6A 3TTWA 5B3JC 3H5VA 1W59A 3ZUGA 4EITA 1BL8A 2NX2A 3QVKA 2ATEA 3OMWA 3BJZA 4M1YA 5KX5B 2BGTA 3S2UA 3U9SA 1SB9A 1TAEA 1OV9A 1CUXA 2AYYA 1QLWA 3NFRA 4ITRC 3RUFA 4DEYA 1P9WA 1E60A 1QH8A 3L04A 4MI9A 1XAJA 1POWA 3JSXA 3VU1A 4XQ0A 5DCVA 3MBKA 4WSOA 1TTPB 2DKOA 1OX4B 5DCWA 1EQAA 3JSNA 1I2CA 1I14A 1UBSB 2JJ8A 2O8FA 2IYVA 4KPFC 2FFHA 4G4YA 1OUMA 4NONA 2SCUB 2R4TA 4RVCA 4U7FA 4AKTA 3CIOA 1MQSA 1SA0A 4O1IA 2NUTA 4HFRA 1JZTA 3ZD8A 3B1XA 4KQ1A 5AOBA 5M04A 1M57C 3RC3A 2XNDG 2O7QA 4DL9A 5BUQA 3AJ9A 3EPKA 1RJ9B 1A9PA 2XNKA 3M83A 4CCAA 1JG1A 2WLJA 2E49A 3DOIA 4X7RA 4EY7A 1EM6A 1OR8A 1TYAE 3ETCA 1E5LA 1P29A 4D0RA 3W2GA 3W6NA 4PQYA 4H7PA 4HS4A 3WWCA 1FDRA 4KFUA 3ZOZA 4AT1A 3O9OA 3Q40A 4W5OA 2ZIGA 1K8ZB 5E0OA 1THTA 1I4EB 5KVQA 6YASA 1NKTA 2OFPA 4EF4A 1S8AA 3VVCA 4ZDKA 1K3UB 5JNWA 2CL0X 4RGVA 1U2PA 1AOXA 5JZSA 3ECSA 3JRXA 4DJTA 1XDGA 2V45A 4CBCA 1V45E 4DBLE 3AUTA 2I9PA 1TZJA 4PBTA 4NXMO 1TECE 4LA4A 3GJXC 4RK6A 3ZXIA 4OYLA 5HA5A 2PGIA 4GMGA 4WBSA 5COBA 4ZT7A 1A9OA 5JE8A 4BFTA 2KB1A 2WJYA 2QGZA 2ZSHA 1PHPA 3I42A 2UVPB 2QLFA 4KB5A 3V7UA 3AF4A 4AS3A 2JLRA 5CVCA 3VPBA 4C22A 4NBKA 4PJ0Z 2ABWA 3L4JA 2R00C 3L40A 5FI3A 2PWZA 5CX1B 5JVDB 1U1IA 4Y2RA 4MR9B 4ZOAA 5F3WB 1EVEA 3VAZA 4TRMA 1PNLA 1C9EA 1PF7E 2XXBA 5B1AB 3EJWA 5CU7A 3PICA 4MVWA 4ENPA 2RD2A 2B9EA 1OA0A 2CLHB 4M0CA 1JFLA 1JJFA 3S8EA 2IQ5A 3BK2A 1X3LA 3IAHA 3L7IA 3PWTA 5AXDA 3VHQA 1CDZA 1XZNA 2RI6A 4M36A 4LOAA 3C3MA 1ZNQO 1CQZA 4DWWA 5I7VA 3CC4F 1ZAYA 4BNDA 2FY8A 1IVNA 1WDKA 2OGUA 3DAFA 1NU1H 4FS8A 4M9XA 4RYLA 1FFYA 2R1VA 3F3MA 4LNHA 1MLDA 2HK6A 2VZ0A 1P8JA 3BCRA 2UZ1B 1RSOB 1GU0A 4P9PA 2GN2A 4CHGA 2XWBF 3O92A 4CM7A 3M1AA 3ZGNA 1P1KA 3FCXA 3WXMB 4CI9A 1UKAA 1J9ZA 4ENVA 2L6LA 5AM3A 3G4SV 1Y98A 1VPEA 4JZ2A 4JHLA 1UZAA 3I8OA 2B7BA 3TZQA 5JJCA 4PAWA 3E9EA 2JHPA 3OPYA 5CX1A 1G3MA 2JFOA 4AU1A 1M33A 2V55B 1THMA 1OC2A 1YNSA 2IXEA 3SS7X 2W8BC 2FPKA 3IQFA 5JBIA 3TGLA 3FJYA 4ZO7A 4I55A 2FDCA 3G9UA 3DKIA 1LPOA 2ZBEA 3TZLA 4A8TA 1RI3A 2ZXWC 2VEOA 3JZIA 4ISBA 4LBYA 2H8PC 2C7RA 1Y33E 2X9QA 5K8TA 1MH9A 2F4VO 1BHJA 4YXWG 5FHRA 3RJMA 5IJXA 1DKUA 3ZP7A 1R9MA 4X64B 1NJ5A 3KZCA 4DIMA 5E79Z 4F11A 2EHJA 5HZHA 5LZ2A 2PHNA 4HG2A 3K5NA 1B76A 5ICMA 3GLIB 2RHOA 2GM9A 3HJFA 1FDUA 3J80A 3IDQA 5KHIA 1MV5A 1QUFA 1TCCA 4Q4HB 2GH1A 4DLUA 1S5PA 1ISPA 1XLWA 3EZXA 5D3ZA 1U3UA 3ZDXB 3D2CA 1K4KA 2XCTB 4K0RA 2NO6A 1ZONA 2CFCA 2AN9A 1JR3A 2KBFA 3RT7A 2J7PA 3ONDA 2MMGA 1IMOA 1HYGA 1X1TA 2WKRA 4ZI7F 1SQ0A 4HNAB 1FCJA 3OHMA 1OTXA 1O96B 1H3FA 4DR5B 1Z5OA 4YMSA 3WYFA 1VCIA 3K73O 3JS5A 4FW8A 5CYOA 4IGFA 2HIMA 1AQLA 4HX9A 4AKIA 3OQNA 1JJOA 2PTGA 4DT1B 3BJIC 1WETA 5FUVA 5H6QA 1DTSA 3B7GA 1G2QA 2E89A 4YNBA 1ORVA 5CUQA 3ROZA 4OYHA 2ZRDA 1T2VA 4MINA 2B8EA 5FUMA 5CXSA 2DPLA 2GN6A 4QOHA 4HR7A 3ZWCA 1E1NA 1D2AA 1JD1A 4FJ0A 1JFFA 3DKVA 2D5CA 4MVJF 4TN1A 4TN5A 5DRTA 5BNWA 5KO2A 5TGTA 2R7KA 1Y8RA 2AN5A 4DV6B 2Y1XA 1TD1A 2GT1A 4LBVA 4PZEA 3BCCH 2AWOA 3RIYA 3KPVA 4B81A 2ZE5A 4JI6O 2WLLA 2WUVA 3N0XA 3HCPA 1Q15A 3OM8A 2QRZA 1Q8IA 3MLBA 5AM2A 5FPOA 4B45A 4DKJA 1RP7A 1P2TA 2BFAA 2VBGA 2GLXA 4Y2HA 3VVBA 3W78A 4HATA 5CX4A 5IDYA 2YV4A 2PH7A 3DZCA 4NDNE 2IITA 1FP2A 1RM0A 3F5FA 3LRTA 1Y3CE 3ZQJA 2FR0A 4HDNB 2TRSB 3EHBB 2PXHA 2ZD9A 4MPTA 3RLIA 3TEFA 2WWGA 1T6BY 4W6ZA 5JAUA 2PD4A 1SC6A 3U40A 4ABMA 2KPOA 4HDMA 4A5OA 4LVCA 3T34A 5M5BA 1N9GB 4L6IA 5EAZA 1GKUB 1S8OA 1S5JA 1ORTA 1ZOOA 4LMAA 1ABBA 1B6RA 2GTIA 2WHXA 2OM6A 3AESB 5TNXA 2XB6A 1DAMA 3H5LA 3PNVA 4BKMA 4Y2JA 5FHQA 1GNQA 3RU2A 1NQ5A 1N2BA 2L0XA 3ED1A 1YCGA 1F4MA 2EFGA 2C94A 5HJ2A 1KZHA 3V00A 3ZHBA 2ZRNA 1AB3A 1NULA 2E5LB 1A2OA 4KIFA 1XP8A 4EG8A 1D2NA 4BTEA 1HLPA 5KYXA 4K35A 3NLLA 3DE2X 1N33B 1GGHA 1U8TA 3EXAA 2FSFA 4RPIA 4Y9DA 4C87A 4JROA 4ZARA 2CF6A 5K6RA 4X71A 2HCRA 4WACA 5ANRB 3VU9A 4B3FX 3U7GA 5C7IO 2PI4A 4EGQA 5LL6Y 5FKJA 4XRGA 2BGUA 2Q0HA 4KWCA 1NL3A 2XMQA 2RSLA 4C01A 3HP4A 5F5XA 4C0SA 2WG2A 2GTAA 3RYTC 3K9SA 2Z1TA 1C30A 2MIIA 1TB4A 4NJOA 1P84F 2PANA 3B7WA 2OG2A 1I5EA 3C3TA 1VYTA 5AUOB 4MKZA 3CZQA 2ECFA 1WA8B 1S3GA 2UKDA 2I4MA 4DUPA 4E2WA 1QIJA 1H2EA 2YL2A 1N6OA 3K15A 4I9FA 4MITA 2RJZA 1II0A 2N04A 2J33A 4LCBA 3VC2A 4Q6GA 1Z26A 3HVRA 2CV0A 4L15A 3WVNA 2JBWA 5I51A 2FWJA 2OD7A 2Z9BA 3ET4A 5F2OA 3SYLA 3U3XA 3WGOA 2EG5A 2IIPA 2QIOA 4PC1A 4QBGB 4RVHA 4G0WA 3VI4B 1Z4LA 3ESYA 3IE0A 3IUPA 1YJWF 2PZKA 2HIHA 1APBA 2A0WA 4XWAA 1KEPA 1ODSA 5KWSA 1QGUA 2Y4NA 3O21A 3B85A 2CVFA 2BP7B 2CNOA 3E7XA 4MWBA 3A0BZ 1ZD2P 2P9ZA 3ES9A 1BGWA 1AGYA 1UJ5A 2ZTUA 2X4LA 4FDLA 4IVQA 1DOHA 5KLVH 2EXXA 3ORQA 2FR8A 2ZBRA 4Z0HO 1K9SA 1XZHA 3LKDA 4LBZA 2AG5A 1M6EX 2OFFA 3CXCF 3I5DA 5AOVA 2FH5B 4CV2A 1A5AB 2EGHA 3IVMA 2CHSA 2O0JA 3K4PA 2P9BA 4MJLA 3IKMB 4ZYXA 1LUAA 1IY1A 2V3WA 4DR3B 4UOEA 3HMKA 3QOYA 2BZ1A 1W0KG 3RS5A 1GPBA 1BMFD 1Q22A 1ZCFA 2QJTA 1NUQA 1R0BA 3DTYA 4ZCSA 2V3CC 2BHSA 3S3WA 3GRVA 2N75A 5LIPA 2ODQA 3PFIA 2FEOA 3RYCB 1N8SA 1FMTA 4G84A 1P4GA 3PFBA 2CCKA 1B93A 2C4WA 1VRWA 2MSKA 1I6LA 3NHBA 3PNSA 4GD3Q 3NOXA 1UM8A 2RHMA 1Y8RB 2G9VA 2J3DA 3NANA 4U7HA 4CN8A 5FBHA 1SVUA 3CCQF 1NVVR 2P1ZA 3H5IA 2FKNA 4R41A 1QWOA 4UUPA 5KWIA 1F17A 2DSTA 4MP8A 5LFAA 4OPAA 1N32O 4HEQA 4LF7O 2G08A 1GPDG 1Y1SA 2JFGA 4G01B 2CYCA 5DCLA 2R96A 4G0OA 5DPMA 2Z1FA 3ELDA 3H9JA 7MDHA 2JI8A 5DV9A 1KMIZ 3PJDA 3KKMA 2I0FA 2VP3A 1UOEA 2DFPA 2P9JA 2Y77A 3OTGA 2VHJA 3A1VA 3BBLA 3BMNA 1U7PA 3LL7A 4G5FA 3KOMA 4K6GA 1U2DC 1XLTA 1XDCA 5BV2P 2G9UA 3HXLA 2F9MA 5H6RA 1JVBA 2F6RA 2LUOA 4Z0TA 3TSWA 1ECCA 2ZTVA 1YB7A 3RJTA 4L9WA 4UEOA 1IVSA 4BFYA 3NHPA 3ZU2A 4RSGA 2I8LA 3FDIA 1T5EA 4QE3A 5AHWA 2H2WA 4DV3B 1OZ0A 3E15A 1RHJA 2HJVA 5CA3A 1VC2A 2OFXA 3L7LA 5T5QA 4A8JA 3DNMA 3KVRA 2OECA 2HSDA 2IV3A 4G88A 2CXRA 2QW1A 4MP6A 3HBJA 4GP9A 3U19A 7AT1A 3CLTC 3B1KA 4W4LA 4DHEA 3KHNA 2WB4A 3LL4A 2IBSA 4JVSB 1M8JA 1M90W 1FJGO 2X4GA 1GSAA 1R12A 4R1LA 2I3AA 5FTKA 1MOFA 4RSMA 5EPOA 4AQYO 4HWOA 6GPBA 3CG6A 2QL6A 4RVNA 1GZ5A 2OTLF 1WCIA 1CUBA 4FEEA 1N6PA 1N34O 2HXGA 2UU9B 4PD4F 3CJHB 2XGOA 5C32A 3WA6A 3VYUC 5EC2C 1CE8A 3I7TA 1QGED 2IX9A 2AG6A 1CQJB 2GERA 2IZ7A 2XIQA 2M1XA 2YH2A 3I2HA 1Y3IA 4MUEA 4RE5A 3SHFA 3MHTA 2ZI6A 1FTYA 1MORA 1KWGA 2XDWA 2PGLA 3Q8MA 3BSFA 1GNTA 1ZH4A 1R7RA 2IYRA 3DEJA 2JPDA 3IV6A 4B76A 2IXFA 1ECBA 2Z3VA 1KO8A 1KYZA 4CV3A 2C2MA 3OECA 2V1DA 2HEGA 2XZDA 4UCRA 4E88A 3TZCA 1SKVA 4PE5B 4Q6WA 2DETA 4DO2A 4MVSA 3E6AA 3LDUA 3R9XA 4LZPA 1NIJA 1QIIA 3C3JA 4IS3A 1KRXA 1XMQB 1DZ3A 1DEAA 2O54A 5LZ5A 3VOAA 1RAGA 1Z62A 2XDQB 4YFVA 5EFZA 5CDUA 2GN1A 4KQKA 2YVLA 4MW7A 5HUQA 5FPKA 3CCFA 4AC9A 2Z9CA 3VC7A 4F4IA 5E3JA 4N7BA 1L7BA 1OZFA 5D87A 4WLFA 2IS6A 3Q4HB 2Q9UA 4HV4A 3U3RA 4B08A 1LBIA 1N1EA 2CE4A 1I7LA 4HWGA 3AIKA 2WYHA 3JXEA 1SQVH 2QIPA 1JQJC 4BE4A 1YZHA 2WC1A 3OMIB 1Q1AA 4IIBA 3IO3A 4I0XB 4INPA 1JLRA 1FX1A 1WMAA 2CHTA 1GRCA 4PYLA 3AUXA 3PNKA 4UZEA 4M38A 4EMBA 4HDKB 2VLIA 5G41A 4JLMA 5J5CA 3VYSC 5L7WA 4HDRA 4YAWA 4C0BA 1PW7A 3F67A 3QV1A 1DJOA 2XF8A 3EVKA 4RHEA 1WB6A 2XNCA 5FL3A 3K0CC 4I1IA 1NX9A 3ZE1B 4B73A 5I4IA 2QD3A 4OM7A 3OCWA 4ONEA 4MLZA 2BZ0A 1B06A 3OAAD 5J40A 1CY4A 2JVIA 2FWPA 1RJGA 2G71A 1KY5A 2OBMA 4OQLA 2PQ6A 3L9XA 4BP1A 2AI2A 1AD2A 3C3EA 4AURA 1TLFA 1WKBA 3NBMA 2ZBUA 3U3JA 4YAJA 4IFIA 3DXZA 3WP0A 1CZNA 3L1UA 1NRIA 1SHTX 5HDQA 3PQ8A 1UKCA 1XQ8A 4C7MA 3E1KA 2DMRA 1AB6A 2R70A 1C0EA 2CXQA 5DM60 3GT0A 1BIFA 1KVSA 1WE2A 2WM3A 1OCCB 1RBYA 2H48A 2IU6A 2WABA 1AHIA 4GI7A 4YRZA 1R9NA 3BWYA 3L79A 2I4RA 3S5UA 2F23A 4AP5A 4BX0A 3AETB 5JMTA 1KECA 2Z5GA 3JQRA 1G5FA 2O3RA 1T2UA 4YT5A 4EO9A 3N87A 5CA0A 4HI0E 1JDNA 2P4HX 1CPYA 1D4FA 1JS1X 1NWCA 5LMCA 3MCWA 1IXZA 3BQMB 2VAWA 1LRLA 3FM9A 5HRUA 4BT4A 4EW3A 3C8ZA 4BP9A 4HAXA 3A32A 2HA7A 4NYMR 2RHDA 4OMDA 4U00A 1U1EA 2AJBA 2FMUA 5ES4B 4H77A 4L4SA 5E6RA 1FU8A 5SY6A 1QG4A 1Z0JA 1B8OA 1ZJYA 3NG1A 4RQAA 1H48A 3NV7A 4OQDA 3SZOA 2HSJA 4B31A 5I3CA 3PPIA 3SSOA 1LBTA 4MGIR 4YVFA 5BR1A 3KTAB 3DEFA 4KKVA 4WNAB 1J8MF 1GO2A 3E8GA 1M8FA 3H1LH 1R0RE 2GCIA 4WGFA 2HUPA 3FLEA 3NKVA 4RLSA 5B12A 3AOEC 2ZR9A 4FKBA 4KX3A 4BO0A 1AHPA 1WDTA 1QDLB 1ZVQA 1VYHA 1M2HA 2ECOA 2OCIA 3A2NA 3EXFB 2EFJA 3DXRB 3V4RA 1YF3A 2FSIA 3E58A 3Q41A 2X5NA 2RAVA 4AP9A 4RIEA 4B4KA 4MT8A 3V7NA 1DINA 1I0LA 3EGVA 2W8BB 5LYYA 3BORA 5IDXA 4LISA 2Y1LA 1HFJA 2WIDA 2XAAA 1Q57A 1Q43A 1TVKA 3QUWA 1Q16A 1R3KC 2QS9A 1JB9A 4FNOA 4I55F 4OCZA 2OLEA 5I7UA 4RULA 1EHIA 3MGCA 2A06H 3OEWA 3RRYA 3THWA 5K3FA 2B2XA 4RJLA 1K4MA 4RAIA 1VK3A 4TQFA 4MVCA 4ZI3A 5JEEA 4WDQA 3AHHA 3J7AU 4WY2A 2HWKA 4NBTA 4ZYVA 4FNAA 2P2CA 1Y5RA 4LP8A 4JLNA 3B4SA 5CM8B 4UNQA 4X3OA 2PUJA 4EYEA 2PL1A 2XYQA 1KMHA 1CQPA 2FPSA 2HL6A 1IBLO 1GT6A 4RZ2A 4O3MA 2F48A 4DMRA 3BYQA 2RH5A 4KLZA 1XDDA 2EX4A 3EFHA 1SKUA 2QD1A 2C3MA 1HYEA 2VWHA 3HUUA 3N59A 2H92A 1J2YA 1ZW1A 2GBPA 2JK1A 5KHGA 2QQ0A 3OJCA 4JDUA 3Q8HA 1NP3A 1R8JA 1ST3A 3D8HA 4ADSG 4RTNA 2ZE8A 1SZDA 3U9LA 1NNEA 2IUSA 3QYPA 1U7TA 1JXAA 1RTTA 3ILYA 1VF6A 3DDSA 2COUA 3A4MA 2OQVA 1G6HA 2VFAA 4JODA 4FFOA 5FL7D 4IRUB 3ZW7A 4FE3A 4LF5O 3I2JA 1AA6A 3QEMB 4QOSA 4Y1EA 1A9XB 1SCDA 1CY7A 3S03A 1VQ9F 5BPHA 2NU9A 4KUMA 2PMCA 3RGWS 5CFQA 2HLDG 2Y0EA 3FB7C 4Q1FA 4L75A 5EJ4A 2UUBO 1X8LA 2I65A 2PZGA 2QW8A 3FNQA 2VNKA 3PC3A 2HRUA 4JBWA 4M1MA 4TKVB 4RANA 2K4MA 2ZSJA 3ZTTA 2V7TA 1Z6GA 4B0OA 5D2CA 1TC2A 1Y4SA 3L8YA 3LIPA 4JEUA 2QKYA 4X8LA 3GB9A 2CWJA 1VHLA 2R5WA 1ZL8B 1SUEA 4U4AA 3BXHA 4B17A 4WN3A 2ZAOA 1E3JA 5CFNA 4GGOA 2DVMA 3V9PA 4JGGA 2GYUA 5KWJA 3L7QA 5KYUB 4FGSA 1JEEA 4CLDA 4R9SA 4ZO4A 4EHNA 1G98A 4GOKA 3QRWA 3C5WP 4KVGA 1X19A 3OPYI 3A3OA 3ABLB 3L6CA 3H7AA 4YUAA 2C7VA 5H82A 5FWNA 1JF8A 1YRHA 3SYQA 4FE4A 1H8HA 4ZRMA 4ZKDA 4KR3A 1KFBB 5DDIP 3ACDA 1QSGA 4BZPA 4DLVA 2V6GA 2ZB7A 3F6RA 1KJQA 2F3UA 2J30A 3NIBA 2WOJA 1G4AE 2PAAA 2IYAA 4IL5A 2BGWA 4OM8A 2XQFA 5KREA 3CS3A 4I5EA 3ZGYA 2NUAA 3JU3A 3K6SA 1TC1A 2QY6A 3OTHA 1HH4A 1BCCH 2XNJA 1QB8A 2HX0A 4GBMA 2HUNA 3G3EA 3NJ8A 4XTCS 4PLWA 3VOBA 1O58A 1MB0A 3EF0A 4I81A 3IDOA 1MRSA 4FMCB 3II6X 2W0XA 3SPGA 1HDXA 1YK1A 3LCUA 1EFRD 1UFYA 1YQ9A 1K4DC 2HOQA 4KHPO 1H6CA 1Z22A 4KFMA 3I6QA 1UEXC 3QFSA 3IPLA 3WL7A 4EGFA 2F95B 1RP3B 1PZXA 2WJGA 3KKNA 3MINA 2BI7A 1KGSA 1QHSA 5BW8A 5HX7A 2P35A 1UADA 3ZVMA 4JYZA 5CPFA 1DBRA 3DNPA 5DEIA 4FYHA 2BOVA 4F4DA 2XR1A 4X3PA 2AMFA 5TXGA 1EDZA 1SELA 4ALMA 3FMFA 3MJ4A 3N4ZA 3NI2A 2J0QA 4D7TA 3LX5A 5D3KA 2VDJA 1R2QA 3E48A 4HHEA 1DG9A 2GNAA 2ZR3A 4TS1A 3ND8A 5HKLA 3N2ZB 3DWEX 1SD1A 3ZGLA 2JD1A 1R0LA 3EPPA 4XYGA 1UXOA 3F8SA 4UHFA 5A6VA 1YKSA 2JGJA 3RVSA 1M0WA 1CNFA 1XCLA 4WBXC 2VT7A 5FA5A 1S96A 1A76A 1XV2A 1H93A 4ES6A 4ZIRA 5AVYA 4AS1A 2A5DA 2P0YA 4XBFA 1K27A 2G67A 3INNA 3KKPA 2IH3C 4TT8A 1WCV1 1I0HA 3LQ1A 4BT3A 5KYWA 4D25A 3AR7A 2RE8A 4C4PA 4UVIA 4GI5A 4TYMA 4X90A 2R7AA 3EXIB 1JQAA 1I01A 3KLOA 1BSVA 1FXKC 3BH6A 4IGKA 4P0TA 4Q4CA 4YMUA 1EXDA 4KGDA 3UG7A 1LX7A 1PJRA 3ACCA 4QSHA 5ILOA 3A1WA 3HJRA 2LP4Y 3E3AA 1E3DA 3C48A 1IZ9A 3SE0A 1USIA 4LGYA 1PJLA 1TF5A 1CTQA 3RREA 1WX1A 3CMCO 2BGIA 2HLPA 1Q6HA 4QE9A 4TSFG 3RBVA 3IJ5A 1GQ2A 4RTPA 5IS2A 4LNAA 1C7EA 2IH2A 1C3OA 1GRQA 1DX4A 4YAKA 4G85A 1RQRA 3QLEA 2Z98A 2OORA 3VDQA 5HP8A 2IS4A 4HEJA 3FROA 2ATKC 2CBGA 5DP1A 5A9RA 2XUOA 4Q3LA 1U98A 3HNRA 2UV8A 4UTVA 3SJBC 3WFVA 3WGNA 4RK7A 2D8MA 3EIOA 3OJFA 4BNDB 1Z5VA 3N7AA 4OHWA 2MMCA 5DU2A 3VOUA 4I1UA 3EZYA 2J6BA 3TLBA 1I7QB 1E7YA 1RR6A 3B6NA 1KHTA 1M5TA 3W7UA 3D64A 1E1MA 2J87A 5IYZB 4KXMA 4BECA 5I9NA 2AOUB 2OV6A 4C2UA 1QYWA 4PPQA 2FMXA 3GRRA 5ALMA 3P0JA 4OJMX 5E2AA 3MJTA 2A3QA 2EKDA 2J08A 3OX3A 3PL5A 4C7OB 4WCEV 2J5QA 5KYYB 2NUTB 4HOYA 1KTVA 4JN6B 3WOHA 3TI7A 4CCYA 3V8PA 1KKUA 2EBFX 1K8XB 2RH4A 2W6QA 1UMKA 3G7UA 3IPYA 3SEQA 3IQGX 1QCZA 2A9KA 3D8TA 3W3AA 3FPIA 4WXEA 3MNFA 3L8MA 3T1TA 3UNXA 1U7OA 4UXJA 3A0HZ 4JI5B 4DXDA 1KMHB 3IBSA 4MO2A 4FIDA 3NTLA 3JCMM 1JQBA 3HCWA 1IV3A 4BNJA 1U8FO 2G5CA 4GZ6A 3UCXA 1I7SB 4DA7A 3I9V1 2RHGB 1E5TA 4G37A 2RJNA 2GEKA 1NVMB 2XE4A 3EY9A 3QENA 3RU3A 4C04A 4E3WA 1CW2B 4MDFA 3K71B 4R6ZA 4LDZA 3CT6A 4RPLA 3DAYA 1UDRA 2XITA 5K05A 1NGSA 4K9KA 3B77A 1NDHA 5B7QA 2YMPA 5IYZA 3WYBA 1TCAA 1LUVA 1Z37A 2OXRA 2Y6UA 4PA9A 4JUBA 2VDOB 4JLVA 3V1UA 5KNBA 1FFGA 1W8IA 2VHWA 1QHIA 1TUBB 2X41A 3DGEC 5G4KA 4ZQIA 1DFHA 4HPJB 3J81M 1KK0A 4I8XA 2X0IA 4WUVA 3SM3A 1T5TA 4JXXA 2EYUA 1N32B 1QP7A 3HDQA 3RLFA 4K9OA 4RADA 3MMZA 2ZKOA 5F3RA 3ROKA 4CIXA 3ZS8C 3FKSA 5CFMA 5I6DA 3FZQA 4CFYA 1F4VA 2PM8A 1FXWA 1E9RA 3HADA 4K9MA 1BE8A 5F5NA 3U80A 4KIUA 2ZI5A 3OZDA 3WBBA 2ATIA 3S5JA 1ANKA 1GPYA 1TF2A 4ZEXA 2PMBA 2CVPA 2QYSA 2WA1A 3ZW9A 3UMCA 3F9IA 1UK8A 3UPDA 4TT3G 1R6TA 3T5DA 2F8TA 4LDQA 1HNXB 4N0EA 3K05A 2KBEA 1OX5A 1ZMRA 3KJXA 4M9RA 4AN4A 1QH0A 4CEHB 1V96A 3W7BA 3D01A 3EOBI 5FLEX 5JQWA 2YZMA 2GK3A 4G81A 4QEZA 5K6TA 2GSMB 1DIBA 1JJIA 3RWOA 3G8AA 2CH7A 3SIUA 1TEHA 4KSYA 5HM6A 2VJOA 2UUAO 3PCXA 1F3OA 1QFMA 3ZH2A 5LMZA 5CLFA 4Z9XA 2RHRA 4UAUA 1Q3KA 1I7DA 4UFNA 4PWZA 1R16A 4EYSA 3TW4A 1Z15A 1MC5A 1PO7A 1VLJA 1N3YA 2FX2A 2VQSA 1E6WA 1LU9A 4R3WA 5DISB 2C3YA 3K08A 4EG7A 1Y9JA 5KHJA 3EGOA 3WL6A 4B4OA 2N1BA 4EB3A 5C8XA 1OFGA 2XMDA 5GONA 3M1IA 4B3MB 3RIGA 3FOWA 1GN6A 1Y5NA 2ZWVA 1IZ7A 4LAFA 2FE4A 4UC0A 4ZAWA 2EZOA 3BB3A 4WOPA 1B6SA 2O23A 2OCYC 3OETA 4UM9B 4WFHA 2I5PO 3N8DA 4PHGA 2C04A 5ELLA 1VG8A 1UXGA 4YWJA 5K01A 1MCZA 3FCOA 3OKAA 2ESRA 4BO5A 4BXOB 1Y4MA 3RV4A 1DEOA 3GLGB 1CR4A 2AQIA 2I7VA 1IHUA 4ICIA 2BV3A 3ABQB 3MW8A 3B9RA 3U1TA 4F5EA 4JV5B 3NDPA 2YXYA 1GOTA 1DO2A 3EVAA 4MKIA 5KCMA 4BASA 1C1DA 4H7IA 1GL7A 3ANNA 2PWYA 1ZLZA 1YI0A 2TMKA 4FLTA 1KFJB 2H1IA 3LXUX 2H3OA 4IJVA 4P4SA 4WFJA 4ZVUA 1SN7A 3DLHA 1YHZA 3K8QA 2O4UX 1H94A 4FEYA 4Z7OB 5I7OA 3WLNA 1SXJE 1XTRA 2O3TA 2WBLC 3DEIA 1YD7A 1GCOA 4IGAA 2WM2A 3R6TA 4RVOA 5A05A 1ZH0A 1ULAA 1Y3DE 1M75A 1K5DA 2EQ5A 5ERXA 4AROA 2FZKA 1WZEA 4DV7O 3G0GA 1SULA 3IKEA 2ZIAA 1NQAO 3P19A 4AJOA 5CEEA 4MHOA 5HOQA 1FNNA 2ZJYA 5C8YF 3CD6F 5LLTA 3G4SF 4P22A 1GGJA 3HKEB 2BBTA 1MEEA 1CJUC 5CW2A 2FVXA 5H59A 4M54A 2DR3A 2KQXA 2Q4PA 2RAFA 1A3CA 2YJ3A 3PQCA 4QU0A 1H22A 4EI2A 1TKRA 1IU9A 5ALOA 1ORRA 3IAS6 5GZ1A 4E6PA 3AJRA 1WMEA 3D9QX 1WXQA 2YN2A 3R0XA 4V0NA 3VZDA 3MFQA 3URMA 2FE1A 3WSTA 4EJSB 1E79G 1QV6A 4PFJA 1VQVA 1GPMA 4RTRA 5BRJA 4IQGA 5IAKA 2LBWA 4IWNA 1BD4A 2BDUA 3CLSC 4NEQA 5TVKA 4EBBA 1SB8A 3I9MA 1E3QA 1CUHA 1WXGA 3UJ3X 2JJ2A 5FBWB 5C8VA 2KJQA 3OLVA 2Z6QA 3H5RA 3UBTA 5FWYA 1PT7A 1YR6A 5CYPA 4BIUA 1G0NA 3M33A 2RQ6A 1N6NA 3CRZA 5HZKA 2C8VA 3HTXA 2W9XA 4YP0A 4DUZO 1VH8A 2AJCA 4Z0NA 1OXBB 4LC0A 4EY4A 4E12A 1BCSB 2UXCO 3GGJA 3KJIA 3O8NA 3ZWNA 3SHVA 3NK6A 2XMGA 1TYZA 4UCOA 5SY9A 1L7AA 4UEKA 1U1FA 3W7VA 5HF8A 3NDBB 2C4TA 2DQZA 1KAEA 2JAUA 1ISHA 2VKTA 2VZEA 1BROA 3OX2A 1ICEA 4QDXA 5IHXA 1LD3A 2P1RA 4J16A 2KW5A 3K9BA 4U2CA 3R6DA 3VBEA 2NTNA 3VKGA 1NBME 3TYXA 4CC5A 5B36A 3DBRB 2R9AA 1E6UA 4M87A 2HA2A 1UMDB 5HXUA 2BUBA 3PQFA 4MQEB 4G4SO 1H2AS 2W5UA 1P49A 2XUDA 3NEYA 3MT9A 2HHHO 4JB2A 3GXBA 2Q07A 1S2GA 3H2SA 2ZWPA 3HY6A 1VPDA 1LDEA 1K88A 2E4XA 1NC1A 3HPLC 1VMKA 2WAAA 3BS4A 2BM0A 3LX8A 3NBQA 2PJDA 4IOLA 4R6WA 4DDWA 5BMVB 1STOA 4BO7A 2FPWA 4QOJA 2HQSC 3LSSA 1FDSA 3M6AA 3P2JA 4K1LA 4MJ7A 2E4UA 9LDBA 3VC3A 3W5UA 4M99A 1QD9A 4JAVC 3FOAA 2YI8A 1KIFA 3EQ8A 1OBVA 4HC4A 4LRUA 4RSRA 3ZDZB 4UW9A 3HEBA 2NSYA 3OE7G 3V4VB 3HEMA 4C6HA 5MGBA 3N8IA 1OI4A 3G2QA 1RLOA 1XHEA 3SKXA 1KTIA 4N48A 3E9RA 1P80A 2D74A 3IDAA 3ITEA 4I99A 1CUYA 4LOHA 1GAWA 1Y6ZA 5D1HA 4UV9A 3O03A 3V1LA 1R4MA 4DV0O 2N46A 3B3GA 5HXAA 1PLJA 4EUEA 3RRZA 5FLKA 4AK9A 1YRWA 3LZ6A 1GARA 2DLNA 5CFLA 1HYBA 2FR1A 1N2OA 4QYWA 4RUKA 2QWOB 3TWOA 1U65A 1QORA 4YRAA 4J91A 4HO1X 4N6OA 2Y93A 1D8AA 4HMOA 2AXTZ 1NONA 2ONJA 1VQ7V 2HP0B 3DZHA 4U7GA 1CP2A 1JPUA 5E8JA 4C0AC 2EZPA 2K7FA 3ELYA 3R76A 2MSCB 2YJZA 5L7YA 4NYIR 1ID1A 1Z12A 1GUBA 4G5YA 4QLAA 3IJEB 4O3FA 5T4FA 2OT3B 2ZUUA 3LDFA 1I5OA 1QTNA 1O6FA 3NXSA 4ZTBA 5I9SA 3I62A 5LP6C 3K96A 1DEXA 2FW1A 3WLLA 3CJHA 2E74B 4PR3A 2EBOA 1H38A 1JAZA 4UASA 3ZVRA 3JD3A 2NQ8A 4JI1B 2JNWA 3K9GA 3QVUA 4RGYA 4CF6A 4F8JA 3VKHA 1CXZB 4W5HA 2O0LA 2Q2OA 5BRNA 3WLFA 4PFKA 2FJ0A 3FB6C 2QPAA 1P9RA 2OBXA 3ZHYA 1V7QA 1AZSC 3A6ZA 3UAOA 4ZCLA 1KBZA 4GIBA 4HNVA 2J07A 2B3TA 1AJEA 5B5EZ 2Q5EA 4PWYA 4QHSA 1HQCA 2YJTD 2V7EA 3MOIA 1MG0A 4MXDA 4U0KA 2QSAA 1YB6A 4H16A 3R0PA 4DYVA 1IUKA 1GFIA 2H85A 2FRVA 4QLOA 2QE7G 1HDRA 2W2KB 1ZH6A 3OQVA 1MTOA 4BQNA 5AKXA 2ZVQX 3M89A 3AP2A 1AM4D 2JGMA 3CCVF 4AZTA 4AJEA 5EE5B 1P5RA 5KOHB 1YI2F 1H1DA 1NW5A 4BV9A 2XASA 3AFIA 5BRAA 4LF4B 2E18A 3G13A 4OFXA 1Z06A 3A9CA 4W7SA 4YIHA 3U9TA 5JD3A 4JB3A 4MV9A 2NP7A 1PT6A 1A82A 3TBHA 3FYIB 1AKWA 1WKCA 1RVDA 3A58B 4Z4EA 1QZXA 3RTDA 3JSAA 3QVVA 4OI2A 2AWNA 1TW3A 3CE2A 3GDWA 5EE9A 3NVMB 1ZL0A 2G09A 4LZLA 3G0BA 4IDCA 3V4PB 2DPGA 4BQSA 3K8ZA 4NEHB 5DBHX 4OKNA 1FDVA 1NS1A 1NYRA 2RGYA 1X1SA 2GJKA 2H2FA 4FGWA 3H86A 2P8JA 4JOSA 3IXLA 1OI3A 3R5HA 2WQ7A 3WWOA 2OZVA 1SVMA 2H16A 1YTLA 1GD1O 5JJEB 1VHWA 1N25A 1YZLA 2FXIA 3N0TA 3QUBA 5FOSA 3ZMSA 2WJ3A 2C99A 4GYCB 3C98A 5ALIA 3V8QA 4EAAA 1FS5A 1QG6A 2D5LA 1LLDA 1G2OA 3BGOS 4HAWA 4P5DA 4PIVA 1EX7A 3V1KA 3CRAA 1VQKF 4GL4A 5DYGA 1GTZA 3U61B 5GM2A 4O4IA 1B6QA 4RX1A 3VR2D 3TLGA 3H4TA 1OGYA 1ZN9A 2XYVA 4PC2A 2D4AA 4OUDB 4HAOA 4Q7KA 5BO5A 5CHYA 4UUAA 3K9CA 5HK9A 5F7ZA 2J48A 4MIKA 4DUZB 3GZ4A 5L3BA 1QANA 1HTBA 5JSKA 1BKDR 3QEAZ 1GM7A 3CEAA 2HP3A 2RB9A 1E2EA 3OCZA 1Q3TA 4D2IA 3UWKA 4EPXA 1AUVA 3RUAA 3OM3B 1JHZA 1VB5A 4Y2PA 5HUJA 3UJ7A 2VC2B 3GN1A 1H2BA 2BEJA 4UCXA 4CMBA 3ER9A 1BGVA 3DZ8A 3KTOA 4A2PA 3AXTA 2Z95A 3RU7A 4EJSA 1DEKA 4KHPB 3BJRA 4DGSA 3EVGA 1CUVA 1NF2A 2XX3A 2FOIA 3CMEF 4GQIA 3DZDA 5I4CA 3P2IA 5J63A 3U4GA 4I4TB 2GN9A 1T3HA 3ZE0B 3NWEA 5JYEA 1Y81A 1N75A 1BQZA 1ZG3A 2PFKA 2C92A 3ZD9A 3TLGB 1U6IA 3WLJA 2PUGA 1YEWA 1QC5A 2C61A 1UJ2A 1W3EX 2QR5A 1GTOA 3U4CA 1AJPA 1XMQO 2RMKA 3SK0A 1ICIA 4J0EA 3T8YA 4JNKA 1OHHA 5EAIA 1JA9A 1WU7A 4B5CA 3ZHVA 1XTVA 1VP9A 3BHNA 5EPUA 5GMOA 3E1YA 5JCZA 3AM5A 4Z54A 2QG9A 3BWXA 1G20E 3GJ4A 3B6JA 2PUWA 2JBHA 1F6BA 3N6XA 1U8AA 1A4XA 4IGIA 4OSEA 1V8PA 2IKSA 2JRIA 1CVIA 2PXCA 3EA4A 4BRSA 4XVUA 3O2JA 3OEEA 3AHGA 4E4TA 4CKWA 4KFRA 3BB1A 2RAPA 1UDXA 5K6AA 2WE7A 1VLVA 2LRHA 3R6LA 1T9GS 1XXHE 4IX9A 3TSCA 4X8AA 1Y63A 1MEJA 2Y66A 4BKPA 4E5YA 1PAUA 4OQFA 4ETWA 1FTQA 5IDWA 1Q21A 1QK3A 1YJBA 4PYIA 1E1QG 1PYDA 4JBLA 3A25A 4KL8S 3W1EA 4CH4A 1HOXA 4H60A 4PVDA 4RA9A 4ZAXA 5EKUA 1IWPB 4RESA 1I51A 1VQNF 4XJXA 2P91A 2JKYA 5EB1B 4HF7A 3RIMA 3P9SA 3ZX4A 1IB0A 4G0YA 3RFUA 3M6LA 4GOXA 2JJQA 4TM7A 1WR8A 3PB3A 3P9QA 2ZKIA 4IV5A 4PQEA 2FZ4A 4FM0A 3KYJB 1E9AA 3OY2A 1RJFA 1OI2A 4MUHA 4BAGA 1EIWA 3OT4A 3RIHA 1S1CA 5C5IA 1B3BA 3QJGA 3C3XA 4UAGA 3ZE8A 5KZMB 4XWWA 1SUWA 4J11A 2VUUA 3IVGA 1HDOA 4KMRA 2G38A 4QXMA 4QEDA 2R44A 2Y67A 2LTAA 3M4JA 4JLAA 5AK4A 1LY1A 2FTKA 3FB8C 5K4AA 2QRJA 2Q0AA 4DV6O 3IT0A 3JQBA 2PKQO 3BIWA 5K3CA 3R7DA 3ZYZA 5IHPA 3FFQA 4L4YA 2H1RA 1OFUX 2CHEA 1UWVA 2ONZA 1KYYA 1FX0B 1FDTA 3RVJA 4IIJF 1YTUA 3BTUA 3FNFA 1Z3IX 3OPVA 4P6VF 2C1EA 1E9FA 5LD2C 1JIUA 3S44A 2CK3D 5LUBA 1FTNA 2Q2WA 5LWHA 2F4NA 4EOGA 3AH8A 4RV4A 2P22C 5F1OA 1EE9A 2AF4C 3GEGA 3OEHA 3E8SA 1R6KA 2V74B 4RK4A 2A1TS 2PGNA 4CIAA 4M7PA 3B53X 1C1XA 3AIIA 3N8HA 4IS2A 5FAXA 4EW1A 2CMHA 4J76A 3T4EA 3H01A 4PDVA 2JFHA 2JIZD 4G5QA 1LWNA 1ZX1A 4KXYA 1E89A 4TXJA 4X91A 5LZ9A 2E4YA 4BGVA 3GV0A 3AHEA 4TMKA 5JCPA 3N3AC 1NT2A 2Z56A 3U4DA 1A71A 2YQ4A 1OOEA 3IKFA 4X8HA 4JVOA 4HQKA 1NDUA 4JI3O 2SKCA 3HSYA 1REQB 4GUDA 4JBYA 1XZFA 3T3PB 5EJFA 5CDTA 1NZDA 5K0SA 3U0ZA 3K3PA 1F23A 3KE1A 5ADUS 4S0XA 1H66A 5LZ4A 3H1TA 2QF7A 1L8LA 4WGGA 4N5LA 5TJHA 4AYXA 2H7YA 1VYUA 1FMCA 3PC6A 2C9MA 1B8VA 2WMYA 3UMVA 1AGRA 1KXZA 4UNSA 5CK5A 3MILA 2EWMA 3R8FA 4EQ6B 2QLNA 1TXGA 2JJ1D 3BMQA 2JGRA 3JAMA 3UAGA 2APJA 3MAAC 5JJJB 3QE9Y 1NAIA 2QD5A 3IUQA 1EP2B 3R9KA 2D2XA 3E2IA 1UBJS 2TECE 1NVTA 1NYTA 4GBGA 4EJ0A 4IOJA 1DZIA 3A2FA 3P2EA 3ZE6A 2HB6A 3ZKAA 1Q3HA 1ILWA 2DY0A 1AKTA 1P9OA 1Y8QB 2DOKA 3KJNA 3P7MA 4Q9KA 4R5HA 1O8CA 1ENZA 1SOWA 1XWIA 4G1MB 4H2DA 5GVRA 2XUFA 3VTIC 2Q5JA 3PNPA 4NATA 5GJWC 4FHGA 5JG7A 1YCDA 1LR1A 2R6HA 3K14A 1VHAA 1C0LA 3LW8A 2QG4A 5H3LA 5JLAA 5KU1A 3DO8A 2PLRA 1IC6A 5TF0A 1BC5A 4JZGA 2P67A 3K9AA 1Y9EA 3DULA 2MSNA 4TTRA 4YJGA 2G07A 1YOBA 2B82A 1XB2A 1YZKA 2VLBA 3IRVA 3FRIA 1DTWB 1SCKA 5FFNA 3WDMA 4C6TB 5JROA 3GJQA 3NEJA 1G16A 2V4UA 4RCVA 8ATCA 2BAGA 3FUTA 1CIJA 4KQMA 2WHEA 1K73W 1D5AA 4PIPA 4C5AA 3CLUD 1ZXLA 5BVHB 4JFRA 4K3VA 1KQOA 2JASA 2OYQA 2R6R1 4L08A 3VPFA 3H6KA 4IVNA 4BO4A 2FRDC 4QPJA 2EJTA 5JVDF 1X8XA 2PGOA 3CCQV 1SOAA 3FYTA 4FDAA 4HB3A 2AUMA 2IOYA 2O8VA 5D5HA 3G02A 4C0KA 1N0IA 4FJ2A 3HABA 5CIWA 3V8EA 4JT8A 5HRCA 3TG8A 2HBZA 3WMXA 2J32A 3P4UA 4TLBA 1CG6A 1QJCA 3BDAA 3JZAA 5TGZA 4EELA 3FWHA 3FLBA 4TYWA 5CNMA 3IUEA 4DQDA 1F0KA 4J9YB 1NFQA 1TQ6A 2BGMA 4X5OA 4ZMSA 1DCFA 3P52A 3WIOA 3AKZA 1SCJA 5LKAA 3ANYB 4X3CA 2X0EA 1X9HA 1FRVA 1UJBA 1HA3A 1SIUA 3IUBA 4MLCA 3CSXA 1W55A 1E7QA 1C8BA 4FHDA 1J0BA 2ZYSA 4C1NA 2NPOA 1F2TA 3RTAA 3U7JA 4B4VA 5ITZA 4IXDA 2GWRA 4NX2A 4YI5A 3WGIA 2JIPA 1D2GA 1H0KA 3UG6A 4C0WA 3ZRXA 1KZ9A 4TMFA 2HF9A 1L3BA 1F12A 1UFQA 4MVJD 4GE3A 4IINA 1JILA 4MVJI 1KYTA 3VSEA 2JJ1G 5FLXM 1E4VA 3JAMN 3LHFA 4HS9A 1QV7A 3DAPA 3U7QB 1GFSA 2XVZA 2XYPA 3GUYA 4RKFA 3NOVA 2CL6X 3DHEA 4GLFA 2P65A 1NG9A 1V4VA 1EQUA 1HF3A 2C4MA 3A6GA 3LCJA 3EOAI 1NW6A 4HX5A 5EQJB 3S3TA 4BFZA 4C6SA 4Z2YA 3VXKA 4KRXA 4RHXA 3GAMA 3WKEA 4Z49A 1KI2A 4X93A 1QU2A 5KYNA 1DF4A 3C3DA 1HKUA 5CT4A 5IARA 3WKBA 4C0QC 1QIFA 4L9RA 4DR6B 1NJSA 2PTMA 2BMVA 2UYOA 3AG6A 1YKGA 3REGA 3SBOA 1HPLA 2IQQA 1U90A 4KWTA 2VT6A 4XVQA 5K1XA 4BO6A 2OR3A 3MOSA 3G6EF 2XA2A 1IY0A 2Z43A 4PQFA 3W9SA 1CX9B 4IDHA 4OQMA 1L7RA 4R8LA 4OH1A 1Z5PA 4NZZA 4WF9V 5HTOA 4DJ5X 2AX4A 1L7DA 4MAFA 4DMLA 3GJZA 3ND7A 2D5AA 4AYWA 3TZKA 3GJ7A 2BZSA 2P1DA 4PZ0A 4QO7A 2O0KA 1PG5A 3QXJA 3TLMA 5CXUA 3VQWA 2HTFA 3NBKA 3WLAA 1GY8A 3IBYA 4OP1A 1AXEA 2ZRPA 1NZJA 1WXHA 1XBLA 1VSTA 2O14A 4GRAA 5ETJA 3V32A 3K7EA 3E7FA 3GRAA 4B2LA 4IPTA 4LY0A 3CX6A 1FLAA 3OFNA 3SSMA 3QG1A 3G23A 3QKUA 3T7JA 4D4KA 3BHJA 5DGDA 1I2MA 4JI0O 4ZIRB 3FOZA 3I23A 4AUMA 3LY8A 2VTBB 3AEYA 4NL4H 1T4DA 1Z5ZA 1KMNA 4YT4A 3KQUA 2CJWB 4IOKA 5GJVC 3KWMA 1DC4A 4BPBA 4N01A 4NR1A 2HMVA 1Y6RA 2LW1A 4MQMA 2HIGA 4X1KA 1XHZA 1XFAA 5K45A 3EFOB 2FYTA 4JI3B 3LA6A 4KCGA 2FETA 2VP4A 4MP3A 1KRHA 4PGGA 5FR1A 1G7SA 3SQWA 4P83A 2B1IA 4JTAB 3BGVA 1U8UA 3HB1A 4LQ4A 4LS3A 5B1HA 4LRWA 2D06A 1D6NA 3R4CA 4QXPA 3AB8A 2V58A 1CU1A 1MRZA 1NXOA 2AJDA 2TMYA 5LP6B 5DHSA 3R4VA 5IKEA 1ZOIA 4K81B 4ZJPA 4OI0A 4TRNA 4Q93A 3K2EA 4HFMA 3M49A 4AY2A 2OCDA 3KCNA 4WFIA 1VKOA 3KNZA 1S7CA 1B0PA 5DRYA 4BUZA 2YOHA 4GOLD 5BSRA 5CA0F 4WXHA 2ENUA 2ZYWX 2I03A 5HBGA 1JW9B 2R4QA 5IASA 1KDPA 3AL2A 5K2MA 5BY1A 2HAEA 1HTWA 4O4HF 2X6CA 2M98A 3VU8A 2AZXA 3QF7A 2GBCA 3M4NA 5HIKA 5K8IA 4RTSA 1BRTA 3QBJA 3E7DA 2PGXA 3H9QA 4PNPA 1PJ3A 1AGXA 3SS9X 4D9KA 4F38A 1AKYA 1PHRA 2PSHA 4BY9D 3K0HA 2AD1A 3R8XA 1CY8A 3HI4A 4LJ9A 1GM5A 1KEVA 2LE0A 4YCMA 1AU9A 1QPBA 1DKLA 2PRKA 2B4QA 2RHJA 3JX9A 1LI7A 1ZXBA 2B3DA 4LVOA 5DWDA 3DCNA 1XNJA 5EQDA 2ZUCA 1NTZH 2IZOA 3DT9A 4G5GA 4Y6LA 1XMPA 1TK9A 4QOEA 1SESA 4UHBA 1F7VA 1W35A 5C93A 4DT1A 1A4RA 1QCYA 1BYUA 1RXEA 2A0YA 2O2EA 3TD2A 1B6TA 4IKEA 1M1UA 4B3RB 2C3PA 2YI9A 1AKEA 1DFIA 2BZGA 4JMLA 9LDTA 2DN9A 1Y6XA 3OJOA 4EGCB 1MJHA 4QVKA 2FWMX 1N5MA 3D6FA 3GLGA 1XRPA 4E51A 3INRA 2DH6A 2YN0A 1T4CA 4WJLA 1JHDA 1SCBA 3RR2A 2VYFA 3X2QC 1H4TA 3RW9A 1U2GC 1FNMA 3PGA1 5BV8A 3TW6A 3FPAA 4LNUA 4MVRA 1K92A 1SQBH 1IBKB 1HMYA 1I36A 1XAIA 4A92A 5KI6A 2F43B 4AZ3B 3FSEA 3SR0A 1SA0B 4GEGA 2O8EB 3VX3A 4Q4JB 4RPJA 3IIEA 2Z58A 3OW2F 2P9GA 4KSCA 1JHXA 2Z0MA 4RZSA 4G0VA 1B4DA 1K5HA 1ZDMA 4M53A 3X2SA 4ZEVA 4G25A 2DPXA 1X6VA 1KI3A 2YOFA 1CE8B 5IJAA 1WVMA 4WE3A 5CLGA 4DDMA 3QJ5A 1MOZA 3FD8A 1RPAA 1GNVA 2QTNA 1U7ZA 3BH7A 3FPKA 1ZI8A 3H16A 2HF2A 1U3WA 3KJEA 4LGVA 1RM5A 1Z2PX 2AE1A 1X25A 2LKCA 4J29A 4HVCA 4BRWA 4MZDA 1YBHA 2OWEA 3G6KA 1GG8A 2FEXA 5JJIA 2J9GA 5CBFA 2E1PA 3D3KA 4FLXA 4EI7A 2D59A 4D44A 1NKDA 4S1WA 4US2R 4NCBA 4RKQA 1Q6ZA 3BG5A 1ZAKA 4LFBO 3USZA 4ARZA 1RWNA 2BHNA 2XAFA 3JD1A 1VSBA 3KKLA 2D6FA 1ULBA 2GBGA 4NOLA 1MTZA 2G6TA 1V9LA 3LC7O 1DPFA 3D8SA 3Q3EA 4L72A 1QGYA 1W85A 4I46A 1P5FA 3D3WA 4BW5A 3MTIA 3PQ5A 3V46A 4TVBA 4U63A 3ZV5A 4DXAA 4IDPA 3TCXB 4KACA 3T5BA 1ZICA 1CEZA 2BY4A 3ROPA 1QDUA 1VPLA 1KGDA 1JJVA 3ID6C 3BL5A 4H7EA 4MRAA 1P5HA 2QSJA 1LS6A 1EAMA 4R5MA 1YNOA 1SQSA 2CLDX 3FNHA 3TZ6A 3EBOA 1WBBA 2DE0X 4D4HA 3R7NA 5EP1A 4KO2S 3LQ2A 3F4KA 2QNBA 2D5IA 3AMVA 1G7CA 4KPUA 3VPHA 4GM0A 4A0GA 4C0XA 3KKOA 4F84A 2YWCA 1RWQA 1Y1QA 3WMRA 4CMEC 4XA8A 4DJAA 2YIDA 4DV4B 3EXFA 3OZVA 1RTKA 1SVOA 3KQLA 1DG1G 1OU4A 3E9QA 2I76A 4I4CA 4JD5A 1VKJA 1Y5MA 2A9PA 2X40A 3QTTA 2PGJA 4K8RB 4RKRA 5EEHA 2H2AA 4PX5A 3HG7A 2HVJC 2YXZA 1UM9B 3IAM1 3TZEA 4G4XA 1HM5A 2PLFA 4A91A 4RHUA 1NXWA 2JFBA 3ISTA 5C4GB 4DLTA 4CKCB 4K9DA 3GQBB 1ADJA 4QFDA 3VPXA 1L4EA 4UE6A 4D7SA 4YO8A 2R2GA 4FINA 3EDQA 1A9SA 1JG2A 3GELA 3BGDA 2PH5A 4F3NA 3BMCA 1K98A 1N7HA 1N2CE 2XTJA 4JYYA 3I3SR 2VQEO 1MA0A 1YS1X 3M4ZA 4CEIA 3EXHB 4PLFA 4JENA 3T35A 1JCHA 5A0TA 3KD2A 2FUG6 2IEZA 1O87A 5DK4A 2QD2A 3I5MA 3ON1A 4REQA 3IOCA 1PQPA 2ADFA 4I4TF 1QX4A 4NU6A 4UNPA 1JTEA 2G9RA 4YJ3B 1HSOA 2BGJA 4QRDA 4QT0A 5BOSB 3WPWA 1P7GA 1KFCB 3EAFA 1XJ5A 3ONNA 3EXG2 5A5EA 5IMSA 2GXSA 4BVJA 3ADCA 3QVOA 2Q6OA 1M6YA 1T8YA 5T8KC 2ZUEA 2OCKA 4OU4A 3ICXA 4J8PA 3WDLA 4LFCB 1OLXB 2OCPA 2ID9A