3HKDB

Tubulin-tn16 : rb3 stathmin-like domain complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
428
structure length
420
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 115
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkdB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkdB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkdB01
4M8IA 5JCOC 3N2GB 3WGMA 5CB4A 1SA0A 5KX5A 4O4IB 4DRXB 1Z5WA 1JFFA 5JH7B 5ITZB 4O2AB 5KMGB 4TV9A 4TUYA 5IJ9A 3JASA 5LOVA 4I55B 4YJ3A 1TUBA 5LP6A 5C8YA 5J2UA 1W581 1RLUA 5CB4B 1SA0B 4IHJA 4LNUA 2BTQA 5CA0A 5KX5B 5LP6C 3V3TA 3JATB 4I50A 4X1KB 1JFFB 4TUYB 2R6R1 2VAWA 5EYPA 3JASB 2VXYA 5LOVB 4EI8A 1FFXA 3WGLA 4YJ3B 1TUBB 5FNVA 5J2UB 5C8YB 4IHJB 4LNUB 5CA0B 5JH7A 4ZI7A 4I50B 3JAWA 1FSZA 1W5BA 4I55A 2Q1YA 3HKBA 3RYIA 5GONB 4F6RA 4U39A 3WGNA 5MN4A 5EYPB 4EI9A 4O4JA 5EZYA 1FFXB 5JQGA 5FNVB 2RHJA 2RHOA 3JAKA 3JATA 4X1KA 4X20A 4O4LA 4ZI7B 1W5EA 5LXTA 1RQ2A 3VOBA 3ZIDA 3JAWB 5LA6A 3HKBB 3RYIB 4F6RB 3HKCA 4O4JB 5EZYB 5JQGB 2XKBA 1TVKA 5IJ0A 5CA1A 3JAKB 4B45A 5J2TA 4X20B 4O4LB 4X1YA 5GONA 5LXTB 5MN5A 3M89A 5LA6B 3E22A 3UT5A 3HKCB 3JARB 4E6EA 5M7EA 3HKDA 4O2BA 1TVKB 5IJ0B 5CA1B 2RHHA 5J2TB 1W59A 4WBNA 4FFBA 4X1YB 4HNAA 5MN6A 4YJ2A 3E22B 5EIBD 3UT5B 3RYCA 4EI7A 3HKDB 4O2BB 3RYHA 3N2KA 4ZOLA 4O4HA 3VO9A 4WBNB 4B46A 3ZBPA 4FFBB 3JARA 3WGJA 4HNAB 4ZHQB 4YJ2B 3RYCB 5BMVB 3JALB 3N2KB 4I4TA 3RYHB 5LYJA 4ZOLB 4O4HB 3VOAA 3VO8A 4U3JA 4KWEA 4IIJA 3HKEA 5IYZB 3RB8A 2R751 3M8KA 1OFUA 2VAPA 2XKAA 2GVIA 4I4TB 5LYJB 4TV8A 4ZHQA 3VPAA 3RYFA 3CB2A 4U3JB 1W5AA 5JVDA 2BTOA 1W5FA 4DXDA 4IIJB 3HKEB 3C8LA 5BMVA 3JALA 2VAMA 3WGKA 1RQ7A 4X1IA 2RHLA 4EB6A 4XCQA 2Q1XA 4TV9B 5IYZA 1Z5VA 3N2GA 4TV8B 3RYFB 5IJ9B 5JVDB 4O4IA 5LP6B 4DRXA 2BTQB 4O2AA 5ITZA 5KMGA 5JCOA 3ZBQA 4X1IB 5EIBC 3R4VA 4EB6B
chains in the Genus database with same CATH superfamily
4JELA 4IJUA 2CHFA 2PVCA 4HNHA 5C80A 3K35A 1VDMA 3P0EA 5DW0A 5J58A 5FI5A 2I67A 6Q21A 5JPDA 4AMBA 1JJOA 4O6VA 4QUKA 2XE4A 2VT6A 4KXUA 3NHAA 3NBMA 3B8MA 3L46A 5G3YA 1GSHA 3DOEA 4XJSA 2JGKA 2ZJBA 5JCJA 3R0ZA 1WTAA 4MSWC 1U31A 3FOBA 2ANCA 4MP6A 1WPGA 4IZHA 1DDOA 4LH7A 3K6KA 1KEEA 4XIGS 3RANA 1UF9A 3BPSA 3DMNA 1CE8B 4WLOA 2CFCA 4YV0A 5E6UB 3DAYA 2N04A 2JIDA 1T5TA 3KKEA 4ENVA 421PA 3W77A 1XD9A 1QSGA 2NYAA 1JIQA 1GPWB 4U3JA 4HB4A 1HX7A 1WA5A 3I3FA 3R6LA 3T1NA 5SZJA 2GEUA 4KXVA 1EINA 4HVAA 1LVUA 3OZXA 2PCJA 1R5BA 4NZOA 1PSDA 5KTTA 3N28A 1Y3AA 4HDNA 4M0UA 4Y1EA 3U3JA 2JAQA 4JI7O 4ETWA 2Q0AA 4WN9A 2Q1WA 1ZGBA 4PX3A 1I32A 1PT6A 5IASA 1WBJB 1P1CA 4PLGA 5BQPA 2X5NA 2I3DA 3B89A 2AJLI 2WIGA 1IURA 3KDAA 3HCRA 4CEJA 2PSEA 4B3CA 2PTMA 4HR7A 5DK6A 4GOMD 2ZB2A 2WWFA 4MQFB 4FD3A 3KTDA 4UEOA 5GTHZ 2I29A 1V1MA 2IW1A 1ADGA 4JZYA 4DWJA 2ZIVB 3BEHA 2P4VA 4KGDA 1M1ZA 1CY7A 4PSKA 2G0TA 2XUZA 3I2YX 4TTRA 4DW0A 3H2HA 1KJWA 4FBLA 2YQ4A 2JFPA 4CMIB 2EEZA 2LBWA 4Z1MD 4K86A 1Z28A 3P4XA 4Q3DA 1RSOA 5H82A 5LYJB 2JVKA 3K4QA 4M1EA 4BO1A 1I14A 1J5XA 1P84F 2ANBA 3KQSA 1Y6ZA 3B9PA 1UQRA 1CS4C 4Y2HA 4F91B 2OTJF 3I53A 5HP4A 2ACEA 4ZU3A 3JVHA 2PH5A 1M0TA 4OA5A 1O1YA 1DAOA 5EPUA 1EP3B 4YMWA 4LYGA 4BFCA 2NM0A 1IV2A 1XRNA 1OAAA 4HFMA 3V5NA 1D2CA 3F71A 2NU8B 2BFEA 3RFTA 3QPUA 1BQEA 3H8WA 2X5XA 2G4CA 2OD2A 2QGFA 3D5QA 5DNWA 4JOCA 3GA5A 1NDUA 3HBLA 4DANA 3UOWA 1K4CC 3GUHA 2NO4A 3F78A 2QRHA 3FNQA 1Z0KA 4FWTA 1T4GA 3KXDA 3WLSA 2BZGA 5HIKA 4MUXA 4YK7A 4D80A 4PHTA 3H7AA 2Q0QA 1WEKA 3FVTA 1CFJA 1AHHA 2JGLA 1Z62A 5C2JB 3CXHF 2D2XA 2ZYVX 4E5SA 3PUXA 1U7XA 5KVVA 4M38A 3IMCA 2C98A 4I5DA 1YR8A 2X8LA 3GX1A 4J42A 4Y6OA 5AJWA 2IDZA 5CFMA 2XTZA 5LJIA 2JFVA 5TPZD 3RG8A 4YONB 1Y1RA 5C1IA 5IEJA 2Z3VA 3D8CA 4CIYA 3L9WA 2FEAA 5FQNA 2ZULA 4G4IA 2WPDG 4J10A 2VHWA 5ADUS 3RJTA 2PHZA 2P06A 4OBEA 5EMJA 2Z2JA 1QB8A 2Q3CA 3A6HA 2AEMA 3S4YA 2KTVA 3DSQA 3HO1A 3E1SA 1HT1E 2O3UA 1R6XA 5ER9A 2ZCVA 3LGAA 3TLBA 2JHFA 4OKSA 3MAAC 5DLPA 3HJAA 1USKA 5CJ2A 2DULA 3CRAA 1FNCA 3VSBA 1JR2A 2XRFA 2C8VA 4R81A 3QX9A 4LIPD 4UATA 4D2IA 3ZQ4A 2VTEA 1WMFA 1KYOF 4OJMX 5AI6A 2H4FA 3ZQKA 1PVDA 4LHWA 1BS1A 4L3WA 5KJ6A 3GN1A 2HU2A 4JYBA 1UC9A 4N76A 3N87A 4HAUA 4AG3A 3L6EA 5K3OA 2JKVA 3CCLF 3SJCA 4MVMA 2CLMB 1YDHA 3K79A 4XRGA 2C1ZA 1B1CA 2N74A 3OOHA 4YAJA 1AIPA 4ITUA 4B6PA 2CFRA 1YQTA 1ND6A 3VOTA 3IEQA 4NJOA 1PUJA 1X1AA 1IPHA 2F4VB 1U8ZA 3A11A 1IXRC 4ZIRB 4CKBB 3S8YA 2J3JA 1CV2A 3F0EA 5TEVA 1H8EG 2DKOA 4O4LB 4HHEA 2A3NA 5HY0A 1LS6A 1K8AW 3CVVA 5J9PC 4ZJYA 3QUWA 5EO3A 1GCIA 1UXHA 2L17A 3GK3A 3ACBA 4Q05A 1MAAA 4NJEB 3G8AA 4U7GA 4QXQA 4LYYA 1PJLA 2Q2OA 3F9RA 3BWBA 4MW6A 3P3PA 1RM4A 3WQSB 2AN5A 2JATA 4NFSA 3I6IA 3UY4A 3O91A 4YUWA 4HS9A 3AVPA 2CD7A 5JS6A 4L5BA 1J2UA 2E74B 3M4ZA 1J8FA 3WRXA 5HJ5A 4G27B 1W34A 4U2KA 1OUMA 3GFSA 1DAMA 2MSKA 4LJLA 3IAYA 4ZI7A 1PR0A 2H8GA 5D85A 5JS1A 1Y37A 1S2DA 2XBMA 2QJWA 3V1KA 3KQNA 4JP1A 2IGBA 2RAVA 3S2ZA 4EJSA 4WA8A 1MSDA 1M2KA 1UWKA 1Z06A 5IDVA 4BVJA 1U0JA 1OLUA 3IHWA 1ZL8B 4N21A 1IJEA 3MFQA 4GOXA 5C5CA 3BN3A 4BV8A 1DIRA 3GT4A 3IUJA 5LPNA 1WPQA 2KBEA 1C7QA 1NMSA 5G1OA 2EOAA 4OGQB 3T4UA 5TS2A 4ZHWA 2YWGA 1LRJA 1E98A 2IZOA 1VQNF 3LOQA 4KX5A 3ZCRA 3MBMA 1JQKA 5DIFA 5JNWA 4RHEA 3I32A 2WLSA 5LQDA 3OPNA 3U44B 4LGCA 1SBYA 3QX8A 2QMYA 2Y0PA 3OTOB 4YAGA 5IAKA 4DV3B 4MW1A 5C4GB 5LQMA 4TMXA 4BNWA 1DC4A 4IX1A 5JG7A 2PV7A 5AVWA 1YQWA 5AM1A 1ZUNA 4B79A 5KOIA 3IQZA 4KKVA 4UNSA 4JQOA 1F9AA 1TMYA 1SHTX 1G2OA 4EGJA 1M1YB 2E85A 3P9XA 3L82B 2DCUA 1D0SA 4IFBA 3K0AA 4HDRA 3E8BA 1W0CA 3SHOA 4C7KA 5CFOA 1XMSA 3EQZA 3VDQA 4NTWA 2BGKA 4CLXA 1UAGA 3MWEB 1XR3A 2OM6A 1C9DB 3LPDA 3ZZ1A 1R0LA 2X9QA 1NPTO 5G3ZA 4D7SA 4MGIR 1WRBA 2LW1A 3G1TA 2R00A 4DRXB 3OZSA 1DQYA 3D7MA 2XNDD 3BYQA 4ZHSA 3C3JA 1RWMA 3HSKA 3BDVA 3NVKI 3TBFA 2PLWA 3GFRA 1OC4A 4UMFA 3DZKA 2PV0A 2C5GA 4KV9A 1QHTA 1CE8A 3UQZA 3IVCA 4UHJA 2ZT8A 5E6UA 2VQ3A 3FI9A 3ANMA 4WDRA 2PQ0A 1W47A 4OQ4A 1GRRA 5FTKA 4YUYA 4K87A 4DHWA 4D97A 5CH3A 1G63A 1S2GA 2IUTA 3BSFA 3TRJA 1TM4E 4C76A 4XH9B 5KNDD 2CC2A 4BRUA 1Y89A 2ZJ4A 2ORYA 3OUTA 1OXKB 3TLXA 1YQXA 4RKYA 1CR4A 1STOA 3FWHA 4EUSA 1CVRA 2RH8A 5IAGA 3CNBA 3FTPA 1APBA 4DCNA 3LC1O 4DUGD 5T8KC 1JHPA 1CK4A 1KQPA 1HOTA 1WB5A 5JH7F 4CFYA 1SC6A 4DIEA 5K0JA 4X1KB 4PG4A 1PJ8A 4C22A 2W83A 3EC1A 1P3JA 1TUBB 2YWJA 2BMEA 1P7BA 5FBHA 4OF4A 4MQFA 1CDZA 2VHEA 3IPXA 5FNVB 2R72A 4RE6A 3T0GA 5LMUB 4Z53A 1L5NA 1DMRA 5KS2A 2RKOA 4BYMA 4CQJA 4EBBA 5A7FA 1NBEA 1W96A 1SNYA 3ELBA 1U7UA 3ROMA 4FZ1A 1DZ3A 3B12A 1II9A 3B60A 4OAOA 5EHGA 1Q81W 3FTQA 1VECA 5BUQA 4UEKA 3GLQA 3GJ7A 2AR9A 5DWVA 5LYJA 1N1EA 1B93A 3CBQA 2DPLA 1WL8A 3OP1A 1H6DA 3M4NA 3H2JA 5K9ZA 4OX9Y 4JC0A 1CP3A 4OL0A 3O2JA 1RQ7A 3W05A 1GU1A 2O50A 2QB5A 1NMZA 4NIMA 4B6GA 1DKOA 5GZ3A 2PGLA 1O9GA 4HYTA 2NU8A 3EF3A 1P7CA 2R48A 3OQJA 3T94A 4P3XA 4A36A 3HL4A 2GZSA 3CZ4A 1JPVA 4G0PA 2V5UA 4OHOA 3F73A 2VBIA 2HP8A 1S4QA 4FEAA 3HCAA 2XKJE 3EK2A 1NG1A 5I45A 1F2VA 2RJOA 5DYYA 1GGFA 3M9LA 3GRPA 5EJ8A 2E4UA 4HQ6A 5I8ZA 1U7WA 5CM8B 3QVJA 1T26A 2C2XA 5CNMA 4JJ4A 3IKVA 3VPCA 2KYRA 2MOKA 4OXYA 4TVKA 4GECA 1U65A 3EUWA 2IYYA 4D82A 2OA0A 3OFND 2F9LA 1M8FA 3MJVA 1EJ6A 1YQ9A 3ZD6A 4C03A 4IEIA 1SAYA 2H2DA 2HXGA 3ZWYA 4KIJA 2R70A 1FDUA 5I3ZA 1I4DD 4GGMX 3PTAA 1X70A 2FZCA 5HM8A 5KEIA 2H8PC 4L4ZA 1E5DA 4TRNA 2Z1FA 1UOQA 3SBOA 4X1IB 4DV0B 1L7EA 3L4BC 4GR9A 5D86A 4TV9A 4YT2A 2I4IA 3I2HA 1IZZA 4E08A 4Y3UA 4LG1A 3U17A 3T1HO 1R0BA 1NZJA 1W48A 1SO8A 3R7FA 1DCTA 2HKOA 3O26A 4NUTA 2HYDA 3NEJA 1R9GA 4PWTA 1O95A 2EYQA 4MW3A 3TXQA 4RPJA 1IK4A 2P9ZA 3AM1A 2WTXA 2O8EB 1HDEA 3BSSA 3RG2A 4B3RO 3JQFA 1CQWA 1A04A 2CBZA 5F9MA 5FWNA 1BTOA 3IP6A 4P93A 5FYQA 3ADCA 1ZH8A 3KQLA 3FN4A 3HNOA 3S68A 4HZGA 4WLVA 2QEXV 1PD3A 4P5PA 5EBWC 2WK1A 3HABA 5CTJA 4EW2A 5BWLA 2GXAA 2F8LA 3KD2A 2GLZA 5DV9A 3IR5A 4Y1GA 4D7TA 2CWWA 2KSQA 3FYUA 3EEOA 1BKSB 1YR6A 5TC4A 1W2HA 2EP8A 1JJAA 1B2LA 4BFLA 2GM3A 1GLNA 2QMHA 5FH9A 1YZBA 5SYNA 5AK4A 3ZCCA 2Z4SA 2C2ZA 3C1TA 2NYRA 3ZDCA 3O93A 1QK4A 2BONA 3TIIA 2I9KA 3A04A 3K5LA 2B35A 2X9GA 1K3EA 1RI4A 1ORIA 2Z1EA 4AP6A 4LQ4A 1KMCA 4F4UA 1RZVA 4CKBA 4MV9A 1D7AA 2WTMA 2OWOA 2REBA 4O4LA 2ILMA 3CCQV 1I0LA 1I08A 3EWAA 1RKXA 3MUOA 1A8PA 1G7SA 2REXB 3AK4A 3VVBA 4NJEA 4IV5A 2OCKA 2EP7A 2BF4A 1BG6A 3NXKA 3BGVA 4X64B 3DLAA 3RD5A 4FDLA 4DAOA 3DYBA 5HJ7A 4GX1A 3IVGA 3GEMA 2QUJA 4KAFA 3A58B 1NW5A 2ZBPA 5B6IA 3DFUA 3W4JA 4IDAA 1K27A 1OWMA 3FXAA 4OQZA 3V1TC 2IFTA 3IQGX 2Y27A 3ITKA 3BERA 3R0JA 5LDGA 2Z3ZA 5CDGA 2YICA 2VZLA 2AD1A 4UCVA 4IJMA 1P2GA 3PPXA 3MTDA 2Y4UA 4KK3A 3A4IA 1SZJG 3H65A 3JRXA 5FLXM 5CDFA 2XIJA 4B3MB 3INGA 3ZRVA 2ZE7A 3BFPA 1TI7A 1UEIA 4FNMA 16PKA 1QAOA 3EA5A 3FRJA 1GG8A 2QT9A 1ZL8A 4B73A 3ZO8A 4CU2A 3AUXA 3G2IA 1T8WA 3TQIA 5KHKA 1QNLA 4UVEA 1P5ZB 2ZREA 3C4JA 3C3TA 3V7FA 2PKYX 4RORA 1R88A 4HNVA 3TZBA 2DFVA 4MGYR 1W5FA 1Z83A 3SDSA 4KBGA 1AKYA 3BK2A 4LJSA 1JL3A 3OM9A 4XVUA 2JLXA 3JQAA 2V4MA 4X84A 1L4FA 2CUTA 3UOGA 1JU9A 3U44A 2BFMA 3D6FA 2LR0A 2HG5C 3IMFA 3LM8A 4ZI3A 1L7DA 2BM0A 4CV2A 3EW7A 5B1IA 1V9LA 2RB4A 5IJWA 3G9ZA 1U5AA 5F33A 5B7QA 2HBQA 1A71A 5DBOA 2CNWD 4NZZA 4RTQA 1M1YA 1L0BA 3AMVA 4OJYA 2P8SA 4I4TF 1TX4B 2JCGA 1J9EA 3GZTB 2XSZD 4BO8A 1AR4A 3HDVA 2P1ZA 3QNUA 3ZU4A 2VCHA 13PKA 3N8DA 3QITA 2L0XA 2J48A 1OX4B 3OPQA 3MWEA 3VV3A 3P0HA 4ZQEA 4WLFA 4YUZA 2XCSB 3AHIA 4F21A 2AXNA 3ES9A 3RF6A 1DHTA 3W9UA 3GLIB 4DRXA 1B4DA 1QCCA 1JLMA 1E1QA 3LL7A 4F04A 4JFRA 1NJGA 3H19A 4PFQA 4BQFA 3O85A 2HX1A 5DNYB 1GN8A 3PSAA 2BFOA 4BP9A 1E2GA 4DADA 4TWRA 1VBNA 2IG8A 3KVYA 1YRYE 3PRJA 3GT3A 3QJYA 5DBIA 2HWXA 4WE3A 1ORTA 5J4LA 2Q67A 3LWNA 1F6WA 2XVXA 3VH4A 1EVZA 4ZT5A 2AE1A 2JBWA 3GNLA 2GR9A 2FEXA 1A7UA 3MW8A 3B53X 4HJRA 3ID6C 3F9IA 4JYPA 1W30A 4LZPA 3PQ8A 2IHUA 3UM7A 4H18A 3UB4A 2ZT5A 3ZQUA 4LF6B 2H17A 1G1MA 4ZCSA 2RD2A 3FD8A 5HRCA 4B4WA 2J9GA 4DEVA 2C20A 3ECSA 3IDQA 1YJ5A 2Z2XA 2PGNA 1JA8A 1TDJA 5FOQA 2D06A 1O0BA 1MZPA 2H2GA 3R4VA 5CVUA 5ALTA 1UBRS 3AFNA 3U7HB 3ZGVA 3OQOA 2V1DA 1TUBA 3LQFA 4H3KB 4ALNA 3B78A 2ONCA 3GGJA 3B48A 5FNVA 4JI4B 3ZYCA 2DMXA 2WABA 2ZRJA 3FCSB 3ZJTA 3H75A 2B37A 2GBCA 3P2KA 3QYJA 4RPCA 4B3FX 4D0RA 4ZC1A 3ABUA 1PWZA 5K20A 5GY7A 2BBWA 3W7WA 2CUNA 2Y92A 1I5EA 3UC5A 2JDIA 1O5OA 2V65A 2VNSA 1N5DA 4AQDA 1Y7PA 4UZEA 1IXMA 5JRZA 4BVHA 3KL2A 4DJDC 4B7ZA 4PXSA 2OLJA 4RJKA 2Q46A 1FTNA 2B8NA 1CRQA 4AULA 1Q92A 2BMFA 4EL0A 3M82A 5AKHA 3DQPA 1EFRG 3IP5A 2ZBVA 1P0MA 2GETA 2GBOA 3NHZA 3G17A 4RV4A 3ZE7A 4D9FA 4IF6A 4C2TA 3OJWA 1IPEA 2DPYA 2OXTA 4NEHB 1A88A 1MO4A 1CN7A 5AK5A 1TUEB 5AK0A 1T4BA 1N0WA 5C18A 1N6LA 3KB6A 1G4AE 4NYIR 5CUQA 4CV1A 3DHVA 3DM5A 4MHTA 4X3CA 3V32A 1DKNA 3GXOA 3CNEA 2X2PA 1WUIS 4EJFA 2OQ2A 3OE7D 3DMTC 4GBJA 1KC8H 3C0KA 4QE9A 1QTIA 1EUDB 4E4YA 4B3BA 1HC7A 2ARKA 1Z3CA 3WQQA 4LJ7A 2ZIFA 1PDOA 4ZOBA 4ZWNA 4J1QA 1XFAA 1MC8A 3M8AA 4YT5A 4GMHA 2AFRA 4X1IA 1ABEA 3RYFB 3PICA 4BW9A 3ML0A 4PLTA 4W9NC 4WCFB 4N9WA 2JG3A 1OW3B 1YJXA 2JAXA 4ESVA 1PNVA 4C7XA 2JGIA 1XJ5A 4M8IA 3E2IA 1RP7A 4O4IB 1BHQ1 4KOEC 1N6HA 3L0BA 4PNHA 5EGSA 5CHEA 5KC8A 3MEQA 3DXYA 2C2MA 4PICA 4ZYWA 2FFQA 2XGSA 4BY9D 1IY8A 1XKXA 2FSVC 3VDRA 4J80A 2YC2C 2R4TA 3AFGA 2O8EA 2Z58A 1OHHA 3OTOO 4H7IA 5FPKA 3GRCA 1IMJA 3V42A 2NNLD 2OUIA 2GA8A 5KB3A 4DV3O 3OUFA 1RM5A 1Y74B 2XDWA 3ZHQA 2R1ZA 3TM5A 3R0VA 5TJ9A 4JI3B 3K57A 4GKJB 1E0AA 4Q7LA 4JTAB 4BU0A 3LWQC 3X1DA 1EK5A 1FLVA 1AZLA 3TE7A 4NFLA 5LWHA 1FFBA 1NE7A 3OF3A 4EO7A 1CUJA 2IX9A 1TE2A 3DP9A 4XLLA 5F73A 1SXJA 1BU5A 1Q44A 4N0DA 2H0QA 3VJLA 4U0KA 2NNUA 5KNCD 4TQFA 3AB8A 1TEHA 4RZSA 2QX7A 4V0OA 1SA0B 2IL1A 2YZ2A 5GINE 5EHZA 1C14A 1GZVA 3NONA 4JN6B 3NH6A 5FJ4C 1TEXA 3L49A 1I2CA 3A1NA 3K2QA 3W8NA 2I4TA 1V11B 3EFOA 2YZMA 3QE3A 3UZUA 1U9JA 3OWHA 1U7HA 4XFDA 2GKOA 4UREA 5JJNB 4L8FA 4GNKA 1WMEA 4BC1A 2YNMA 3JWJA 4XSGA 4QX6A 4C89A 1QZ3A 5ARBA 2VSNA 2VQEB 4P3PA 3CSXA 2BGWA 3CNHA 1S2LA 1S3FA 1UXKA 3OCVA 2Q4DA 4B82A 1FK8A 3D0KA 4XR4A 5EE3A 1EYZA 2J4DA 1N8RH 2CF6A 1QGUB 2A84A 5KNBD 4CGZA 1X2BA 3DM9B 3M4SA 4LDQA 3L7BA 3TX6A 1GTJ1 1AXGA 4DQLA 3FAVB 3CVWA 2WI8A 3SYQA 1V95A 3SM9A 1WHSB 3SYAA 4YDHB 2HBZA 1A2KC 3BPZA 4J1TA 2YZ7A 3GWGA 5CB4B 2VDMB 4I5GA 2HCTA 4X7MA 1AQJA 2X8BA 5B4UA 2BFAA 3LVQE 1H0SA 2QLLA 3SBXA 5J9FA 4CMHA 2UYCA 4Z4EA 1J5EB 1JIJA 3QPAA 4YCLA 4PSUA 4M89A 3AO0B 3WFIA 3BHMA 2D7JA 2LCFA 4REOA 4R6WA 1Y1QA 1UQUA 5LMUO 3G02A 2H5EA 3BH6A 3HZRA 1F9EA 4EGCB 3JCZA 3ON5A 4QNRA 3QLUA 4IMPA 2BOCC 3VAYA 3Q87B 1F14A 4WKCA 2CXQA 5J4HA 4YRRA 4PYKA 4KK4A 5DGHA 3USZA 2IEYA 1PJCA 2BEUA 3WFVA 3FWYA 4MYHA 4H2DA 4B6EA 1KC1A 4KQCA 2VDRB 1IAQA 4CL8A 3G1UA 3H86A 4L74A 2FMTA 2EF1A 1RVV1 1PJTA 2AS0A 3NEAA 5L3CA 1ZNXA 8AT1A 5IEBA 3ZJ4A 3STUA 2XQFA 1NBMG 4HX5A 1RACA 8MHTA 4PC7A 1KEEB 4JZKA 2J9RA 4AO6A 4EI9A 4DAEA 4L51A 1QR2A 2QT1A 4QXOA 3AHJA 2H08A 5FL7G 3NUZA 1U0SY 3FPLA 5DM0A 1FYDA 2EV9A 2Z1MA 1PFKA 3S3XA 1G0NA 1O6FA 1OX4A 3NLLA 3P0ZA 3IUSA 3L5KA 3EGWA 1B6SA 4ECAA 4DL9A 4EG1A 3LXUX 4BRSA 2FL4A 5IG2A 5CT4A 1KPGA 1NVKA 3GLIA 5GWXA 3L9XA 4M8LA 2QX9A 1QHYA 1L4NA 2PIDA 4GVPA 3VIUA 4J0EA 1W1WA 3DKKA 3Q1LA 3ZCXA 5HXAA 3AF3A 3EUEA 4CG3A 3UFXA 2NV0A 1RLUA 1ZWZA 4DV0O 1A8SA 3GVMA 4EVQA 2UYKA 4RESA 4KE8A 3L7AA 3NTXA 3LT1A 2GZRA 3ZS8A 2VP9A 3EY4A 3OLYA 1EFPB 3CYOA 3DOOA 1U0GA 3LUPA 1KC3A 2FMLA 5JYCA 1I6KA 4RGQA 2WB2A 4NF2A 1FQJA 3H5RA 1EHIA 4TTSA 1T35A 1RSOB 2H6LA 1QYVA 3NVAA 5KYUB 3GUUA 3DBIA 3U0BA 1MGOA 4P0QB 3OI7A 1H9AA 1KFJB 1RLIA 5IYZA 5I7SA 1M90H 3OOSA 1ZK1A 4PC2A 1JHYA 5JC8A 4Q3EA 3EIWA 5CR9A 4BW5A 4ZJPA 1PR3A 1KECA 4J1NA 3ZWOA 1D2DA 4CG1A 4WADA 4NBSA 1R1DA 3KETA 2HNKA 2YX1A 4AB1A 2OVFA 4P6VF 3E7FA 2JLZA 2R9RB 2V6IA 3C6XA 3ZK7A 2RBEA 1D8TA 1A97A 2GZMA 3RSSA 1VARA 1G5HA 3BEDA 4D0NA 3ND5A 2I6QA 3AG5A 4QE7A 2OXIA 1QJCA 3G80A 5JNUA 2C3OA 2EIJC 2ECPA 3G2JA 3V4RA 2EQ5A 2VSXA 4A8PA 2CHQA 1QGOA 5CVJA 5DYTA 2IXGA 2E3CA 1NNUA 4WAUA 3ZV6A 1YRQA 2XGJA 5G40A 2C9YA 4X64O 3TE6A 2IKSA 2GZ1A 3EJ6A 5I4CA 2ZDGA 3VDXA 5JAOA 3IPCA 3HY4A 3NMUF 1B6QA 1PNTA 2LO1A 1YV9A 5THKA 3TTYA 1Z74A 3GLFA 1HPLA 4RDCA 3A1VA 4DLTA 4QPDA 3EDCA 1TUEA 3ZHOA 1JA9A 3P97A 2GMWA 1X8JA 4G28B 1IN6A 2QE7A 1KEWA 4W5NA 3R5SA 2YN0A 1CHNA 1Q90D 1SC1A 3UMGA 1NN1A 2XYRA 3INYA 4J7XA 1T9CA 4JQSA 4HP8A 3IAXA 3S29A 5ALSA 5G4VC 3LW8A 1CQZA 1KIMA 1ZXXA 2YYYA 4B3MO 5CFZA 2PT9A 1XZAA 2GHYA 4U0JA 1WZ2A 1HYEA 2ZR9A 2RNBA 1ZNQO 1KJJA 1QAQA 2JRIA 4EMTA 1JXQA 4HNTA 1P1FA 5KYWB 2QM4A 1TYZA 4HQFA 1XIVA 4HEA1 3RB8A 5L3SA 1QPZA 3ORYA 1H2WA 3RYFA 3ODPA 4K05A 3L01A 4WCFA 1EJBA 3B3JA 5CCDA 2WD7B 1QLWA 4O25A 4O4IA 1CUAA 5B57C 1OH7A 4QAQA 1EK0A 3V2UA 1USUA 1LDNA 1YA8A 2H1SA 1DFGA 2CLOB 3HZOA 1F4LA 3AVYA 1SCIA 4MS1B 1D8AA 3IA7A 2IZ5A 1S8OA 4YTEA 4G8CA 1POWA 2R8ZA 3AUKA 1JV2B 3BL8A 3P9SA 2EW2A 3R7SA 3GVIA 1JX6A 2VHQA 2PYJA 1I2MA 1LC3A 2RB9A 1RC0A 2ALEA 3NBZC 4LF9B 4K26A 4X7PA 4JUIA 1Y74A 4XGKA 2J6IA 3ICWA 2QVYX 2SICE 4BS9A 2GWHA 2WYUA 1IY9A 1XZMA 4LMPA 5JYEA 4HZUB 5FTNA 3EMDA 1SRRA 1G59A 1G20A 4K8OA 9ATCA 4J3FA 3TRKA 4J2TA 2NZJA 3K03A 1MX9A 4E46A 5F1YA 2A92A 4W6QA 3PX7A 1II0A 1ZVJA 2QRKA 2QKCA 3PXXA 4NS4A 3Q7SA 2Q3HA 1YIAA 4A2QA 2G38A 1SA0A 3SP1A 3FUWA 3PUKA 2WAXA 4LMRA 1EFCA 1X52A 3SEFA 4RH3A 3GEIA 1ZINA 4HXGA 1JQBA 3KJZA 4QGPA 5CB8A 4R41A 1V11A 4C0AC 1RZRA 4R2LA 2R47A 1OI7A 1SXGA 5AO9A 3TCKA 2ZRFA 3I6YA 1PK7A 3NH9A 4B17A 2DFNA 3DVRX 3GPBA 4RK6A 1OLUB 5CVTA 1E9SA 4N41A 4CTKA 1RAIA 3GJ0A 4P3YA 2WOJA 3AG7A 3CC7V 5C32A 1OCZC 1KY4A 4NZMA 1E3DA 4WQMA 1U2GC 4DIDA 3QTTA 3COVA 5TB5A 1VJTA 3NVDA 5JWHA 3H9QA 3VU3A 3N05A 3ETDA 1QGUA 3Q7PA 1T1IA 4MYCA 4QGFA 2GVZC 4LF6O 3FAVA 1K73H 3ROFA 3GLGE 3DTYA 1HL3A 1RPOA 1YJ9F 4RX1A 1JG6A 3O75A 1PHRA 3LWOC 3AHFA 3V4DA 1KVTA 4LJ4A 5JNTA 2KG4A 1NKSA 5CB4A 1PEYA 3PSHA 1GTG1 2FN7A 1S96A 4MR9B 2IEGA 3U1VA 5EE0A 1TEZA 3QXJA 4E1VA 2BH2A 1XA0A 4KXMA 3AIOA 3OFJA 4PA4A 3ICCA 2WJJA 4JI4O 1ML3A 4CZ2A 2IQ5A 1H66A 3K12A 2BFCB 1YVEI 1SCDA 3U61B 1A5SB 4BNIA 1HZJA 2SKCA 5BSEA 4NSNA 3G82C 1ZH6A 1QQ7A 4DSOA 4HDOB 2A3RA 3SC2B 5JDCC 5COQA 3ZNQA 3DFKA 2B3DA 2PGIA 2PG3A 5JTTA 2FN4A 3C4QA 1SXPA 4ZRNA 4JP3A 1JJFA 1L7PA 4NBKA 4WFBV 2ZSUA 4WN3A 2A88A 4C4TA 1Q77A 3DEZA 5IARA 2NVBA 5KTKA 1WB4A 1EK1A 3U7EB 3RHFA 3RT3C 3VR5D 5LLDA 3CRVA 4PSAA 2AHYA 3A28A 2O2CA 1RI1A 2OK8A 1XKQA 2BHNA 4QRHA 3A9UA 1UEXC 4DQUA 1W5EA 3PX3A 1PPJH 3QGMA 1JR3A 2F9FA 2HW8A 4D4KA 5TY0A 3WJ1A 4BO9A 2ZR8A 3FNBA 1NX6A 4B5CA 1WSAA 2QL7A 4FMTA 3SHTA 4GEGA 2IOQA 1Z9BA 4KDRA 3G9XA 1CY8A 1FZQA 2V59A 4QOIA 3UHAA 1X38A 3LSSA 1VXRA 4K7JA 2RJZA 2YIMA 3EHEA 4JBGA 1IEWA 2WM2A 5E6RB 2AC4A 5GQSA 2VAVA 2V7XA 4NHOA 1D2NA 4EP1A 4XI9A 3WWZA 3TD3A 5SYMA 4D9IA 3JZIA 3JYQA 3UK6A 3RUAA 3HCEA 4O2LA 3N6VA 5GVSA 4R9NA 4EPRA 5DSTA 1UIMA 3FSRA 5D3QA 3BFRA 4DV2B 1EFPA 1O7JA 5E2IA 3QBTA 3JQ6A 4TYPA 4MYUA 3OZWA 4GQBA 2HRRA 2B34A 2WUEA 3T5MA 1F0KA 1PR5A 4I9UA 1EZZA 2NSDA 1J22A 1OI4A 1KQ3A 5KYUA 4RTJA 4GX2A 1WF3A 2WHQA 1XVTA 5KWSA 4ZVOA 4CMJA 1O9HA 1JDUA 1W93A 3GOHA 4Q12A 2SNIE 4CIDA 2G7ZA 2GD1O 1VKRA 2FMFA 3L8DA 4V0RA 1CZUA 4JI3O 1ZUWA 2PSHA 1XI2A 4GKJO 4HFRA 1NLUA 2A9QA 3TGWA 2AZ4A 5SY4A 1YZFA 3CPQA 4NH0A 1T3HA 3Q0EA 4YJ3F 2VRNA 3FDFA 1ZKMA 2X0FA 4X6YA 4EL5A 1IDN1 3S0HA 2PZMA 4LC9A 3KUCA 4ZO7A 4MUIA 1DELA 2WG1A 1SBHA 3K73O 3IALA 1C3LA 5DTIA 4Y2XA 1XZFA 3BEOA 7MDHA 3IGAC 3HJBA 3ILHA 5FOSA 1KBHA 3LF2A 5LQKA 2AUMA 4LYEA 1U99A 1TK3A 2B4AA 5JAHA 5AVOA 1Y9EA 2HF8A 1FBTA 4EG8A 4G0XA 3NM4A 2VNKA 4A5SA 1FSFA 4EOGA 1V6SA 4Q4HB 1B8OA 3OURA 4G5XA 2L19A 4L3VA 2VQEO 4IQFA 2OOKA 1IQRA 2XUFA 4V0SA 4IDHA 1WOMA 2FX3A 3PGJA 2YRXA 4TZKA 1R8QA 1ZJZA 3G59A 1OYYA 4TV9B 1UXOA 1XK6A 3KQVA 3BXOA 3BJRA 3DMGA 5ALNA 3MWKA 3CGWA 1VMDA 2UXNA 2A14A 4N47A 1ZEMA 1Z5GA 1FNMA 2REOA 3E9RA 3OMAB 1G6KA 4I2NA 3EQ8A 1YQEA 4JPRA 4AYTA 3DLIA 3RWBA 3G23A 3H3FA 2J7PD 5HIAA 3IXQA 2ZJ8A 4OHBA 1E0JA 1F2DA 3M6VA 3GUYA 1RJEA 3GP3A 2LFSA 3A8TA 4IIUA 1J5EO 1EXMA 2IZZA 1XD2B 2PSFA 2F64A 1BHAA 1ZITA 2H1HA 2BHSA 5KYWA 1H2HA 1V9SA 4AI8A 3UB3A 1YI2F 3ZX6A 4QGAA 3JPWA 2OO5A 4RK1A 4NCKA 3TFOA 2G1KA 4JZ2A 3FYUB 1GA4A 2GFHA 2WD7A 5FL3A 3ETGA 3AKCA 1JMYA 2ZWIA 3UMSA 3U60B 2HRBA 2C61A 3UKOA 5AHRA 3IRVA 3ZBQA 1RM3A 4RF4A 4MS1A 4FMDF 1KY5A 1DTEA 3C98A 3L7JA 3TB4A 2WVHA 3Q9UA 3TKAA 4S2EA 2P41A 1ZONA 3ZVRA 3CYQA 3K0CC 5I7RA 5TS3A 3AUFA 3VKGA 1N8KA 3C5CA 2YASA 5A0VA 2I1WA 4MCJA 2CDNA 5ALQA 1IZ0A 2V4UA 5E6SB 2UYYA 3ORRA 3I28A 4CCWA 1PSWA 1CUBA 2F43B 3T4XA 2AF3C 2PMKA 2VUHB 2VXOA 3TS1A 1NQWA 3HGMA 3ZIAG 3E1YA 3L8CA 4HZUA 3NHFA 3F6MA 2P77A 2CYAA 5C37A 1QP4A 2VDWB 2BM9A 2NN3C 1Q74A 3SQWA 1CUVA 1BEZA 4BP1A 5LHGA 3ZD7A 4M7RA 4G9GA 4B0OA 4G5GA 2PUEA 3DOIA 3HR4A 2V6FA 3RS0A 5GV8A 1FFYA 3CC8A 1JEJA 3SDBA 6ADHA 4EGSA 3JVDA 3RU7A 1ODJA 3AIKA 2R7AA 3VNUA 3A25A 2FUG6 3CU5A 1BWQA 4MPRA 2J3QA 5FORA 3LVBA 3ABZA 3W6UA 3OCCA 1GN6A 1QX4A 1K4YA 2IH1C 1BYUA 1SR8A 5AW9A 1O94C 1U6KA 3PHIA 2YC0A 5J5AA 5FBLB 1ZPDA 1DIGA 2M6YA 4AO7A 2HQSC 5KWIA 2JVJA 2Q21A 4KQ1A 1S3SA 4PDVA 1YHZA 3EVEA 4A0HA 4NWOB 1UK8A 3DZ8A 3B2EA 4L0MA 1ZC3A 5DLYA 1KKLA 4BFSA 1GP2A 2UAGA 3LSUA 4H7KA 1EBFA 4RFSB 1R8SA 2ZYAA 2H8EA 2NNWB 2H9IA 2G09A 3WXBA 4CR6A 3O31A 4Q48A 5DWDA 3QJGA 3O73A 5C31A 2WAMA 1RXWA 2C9MA 1RVDA 3JQAB 1L4YA 3C3XA 3LPLA 2YKGA 3MQ4A 1P9OA 2OYCA 5LBIA 1QVWA 4RELA 4Y6PA 4B4KA 3QLVC 2RK3A 3WKBA 5T8KA 2BEWB 4MR9A 2DWUA 5CXSA 1KI8A 3OZGA 1E3IA 1G8KA 4EPVA 2YWHA 3GLRA 3HXOA 3C97A 3I9V6 3O9OA 1Z2OX 4J1SA 1R9JA 2BD0A 4X89A 1FS5A 1JDBB 3RVPA 3DLBA 2GEJA 5EEHA 2YMLA 1LBEA 2BFCA 2RGWA 4GX0A 5C7OO 1NVPB 4Q9IA 4NZ9A 4ZARA 1N4DA 1EDEA 1XTIA 3RFCA 1BXGA 1BW9B 3FF4A 1PFVA 4BVRA 2RGYA 2EULA 2D7DA 1V48A 3SC2A 3AF4A 2J41A 3RT1A 4KDCA 2I3AA 4YMTA 2XT6A 4B46A 5KOHB 1PT7A 2VBFA 4H4EA 1KP2A 4AAYA 1H65A 1UP7A 3QMMA 2XUGA 5K3EA 4IMIB 2HR3A 1AILA 5BW5A 5FLXA 2ZAYA 1PL0A 3U0OA 5L8VA 3LD9A 2W6OA 3VTAA 5JATA 1OWNA 2K1SA 3O0TA 4F8YA 1T9HA 3VSEA 1DX4A 2WVAA 3QNWA 1YJ8A 2N75A 4LJ6A 3QXSA 3GHZA 4UOQA 4HGZA 1D6MA 3DDWA 3KEFA 4D8UA 4OI1A 4DABA 2OMKA 1BE1A 1P4HA 1YE5A 3STTA 1KS2A 2W90A 2J3EA 2BFNA 1FKAO 3IAHA 2J0QA 3RAPR 1SG6A 2X4DA 4RK0A 1A2BA 4HVCA 3OIVA 2R4UA 1QHHA 3ESCA 2R3SA 1H4VB 2ZRNA 4QJFB 2DWEC 3SSNA 5K5EA 3G71V 5KTRA 3AF6A 1L4HA 4JLUA 4RPKA 4IUBS 3TGPA 4PA3A 4MW5A 1O08A 3HN2A 4FK8A 1PVVA 3DZCA 4RYDA 3KC2A 2Q3MA 1DFIA 1N3LA 2IY7A 4JLDA 5E6RA 4WD3A 4MJ7A 2VQ6A 2X1MA 5KOYA 4M4SA 4QEKA 4KFUA 3RIEA 1ES9A 1Z0ZA 1E2UA 2P11A 3L4BA 5F35A 3FPSA 3IIJA 1BMFG 2F59A 2WKQA 2ZU0C 4EG4A 3AVTA 4GE0A 4RK7A 3AP1A 2J1LA 2E4VA 1AMOA 1X7WA 2GM9A 5E3JA 2BLNA 4FN5A 1A8QA 1SIBE 2P2ZA 2ZE5A 3EX7C 2FF5A 4DBVO 3WLTA 1D0IA 3E27A 4MW2A 1P3Y1 4PG6A 4DARA 1UFKA 3OTHA 1X94A 5TT0A 3NCTA 1Q8RA 4PAOA 3IR7A 4ZXFA 2G28A 3OFKA 3FDZB 3C43A 3OHPA 5A5DA 1P19A 1E6MA 1WU8A 4EHJA 4HXYA 3BIFA 3O2NA 2I87A 3EOAI 4LF9O 4TM8A 2X3UA 3SX2A 3T9EA 4WLUA 1KY2A 1J1IA 1AU9A 3GMIA 5L95A 5KPJA 4IZOA 4V02A 2HLDG 3LP8A 4HWGA 2YYAA 3DKIA 3L7MA 4CRWB 1MGPA 1M1UA 4MP8A 1OTXA 3ABRB 2GK6A 2J6CA 4KL8S 3OLVA 5EHQA 4C4PA 3M1XA 3H5NA 2HO4A 5AW5A 2PQ2A 4FLYA 2Z8YM 2WSMA 2REQB 3WGIA 4FHZA 1XQYA 2WSBA 1MHTA 4JYCA 3R3YA 3IO3A 1QFMA 1DZIA 4FLZA 5BNWA 5FFFA 1EDZA 3CC7F 4TQ9A 5JZOA 3GVHA 4X5OA 4TKVA 1ENVA 4IZIA 2YCLA 1VQ5V 1GO2A 4TTJA 4EG7A 2FETA 3J7AC 4FCWA 3KKYA 2C83A 4YRSA 2IP1A 5K8LA 4Q4HA 3GG9A 3GRYA 4MWTA 1KI4A 1KO8A 2VHJA 4F92B 1CNMA 3LWPC 3LUBA 1N78A 1YK0A 4RZXA 3VC3A 1U0NA 3W8FA 3DNMA 1ULZA 3I52A 2ERYA 3IOEA 3G0BA 1KBZA 5JVDB 4YR7A 2MYTA 3IJPA 2I7DA 3H2KA 3CW8X 4H7PA 1BVHA 1ORQC 1QDEA 2WHYA 3MJDA 4CIAA 5HXZA 3WB2A 1C7IA 1J09A 4EUNA 3DSRA 3AR5A 1R6KA 2QDXA 2XHBA 1RIFA 5C51B 3FBGA 2AOVA 5IUNC 3CIFA 2EZOA 4MUNA 3UANA 4C0SA 5K8IA 4E70A 5KKCA 3OCZA 4MGKR 4C7JA 1EVYA 3W6ZA 3A1WA 4UQOA 1C8LA 1XD2A 3CPHA 2IBSA 2MSCB 1RP1A 4EARA 3EY9A 2W2QA 5SY9A 3D3QA 3NK7A 2HUPA 3A31A 1X7PA 1SQ5A 3VR4H 5AM4A 3LDFA 4ZVSA 1NA5A 5F98A 2DKNA 5EPEA 4INAA 5CEFA 1TW3A 4YCMA 3AQ4A 2XWQA 3I45A 5IAAA 2AN1A 3HAXD 1MXFA 1D1TA 3VC1A 5DGDA 1SXJB 4WOKA 3R76A 2WPNA 4ZZ2A 1EIWA 1PG5A 4LPSA 2WC1A 1JLHA 3ZD8A 1GM9A 5L7TA 2OZPA 4PC1A 3SPJA 4JP8A 3PYLA 4YCAA 3ENVA 1W42A 3BSWA 1K8YB 4FYMA 2P9QA 3EFOB 1TRHA 5D3KA 4BLUA 3RTGA 5E6SA 1Y8CA 4TTAA 4N0MA 3EVFA 2F43A 2BSKB 3KZ1E 1OVGA 3C48A 4RFLA 3Q8XB 3OLQA 4CM4B 3WWYA 2VDWA 1FMCA 1ZSNA 3TXXA 3LDTA 3PLAC 1TC1A 3TBKA 3HDYA 5LN1A 3SIPA 4K3UA 4URWR 3B20A 3FDIA 5CIQA 4TWJA 2IWHA 4AP9A 4BE9A 4GVXA 5GJVC 4AJIA 2ZJ0A 2QX4A 5JRJA 1E32A 1QO9A 3NQ41 1M0WA 2O7SA 2GPWA 1J5PA 1UPTA 1Z34A 2HA3A 3DXRB 3RO7A 2YJTD 1RIIA 1R1BA 2X3YA 3CH6A 2KB1A 5L7YA 5GOTA 4H35A 3F5SA 4XX0B 2JJ8A 4KVAA 3PC8C 1LUAA 3OU6A 1DKPA 1A4UA 1RXEA 5IVIA 3VTIC 3JAWB 3IOYA 2GF0A 2XODA 1TPYA 4RPLA 2XOKG 4O0MA 1TNDA 5F5LA 5LXTB 3Q3CA 3W9YA 4DV2O 4KVFA 4RJIA 3L6DA 3ETQA 3HB3B 5DGTA 1RXVA 1TJ3A 2Q68A 4QAJA 4RFSA 3KJXA 4DRYA 1H2MA 4AWXA 3U3RA 2BEUB 3G7SA 1JDJA 1WPRA 1EHCA 1UIRA 4ZZ1A 1FDOA 2TRSB 5DASA 1XTJA 2H5JA 3T1CA 5FOXA 2AFHE 1QO0D 1GAXA 4R31A 2FB9A 4DDKA 2ZWOA 3UAWA 2AJDA 1OAOA 3DA8A 2BEWA 2WRZA 1TLLA 1RYYA 2J9FB 1PV0A 4U6QA 1VMEA 1KYIA 2ICAA 2XADA 3L4KA 3X2FA 4BLSA 1PI3A 4AN4A 1GA1A 1L0LH 1ZRSA 4FDVA 4BEWA 4C1NA 3C6YA 1MDFA 3K7EA 4F5WA 3OEHA 3GVCA 4J0CA 1SIOA 4G4VA 1BSVA 1IULA 1BW9A 3QPCA 1Q6HA 2ZKOA 5JFOA 2B1QA 3SYTA 3H1IH 4MW0A 4GF5A 4Q1BA 4F4FA 1G41A 3DEIA 4E5VA 4BFYA 4BX0A 5KOHA 1U2PA 1ZOIA 2V74B 4F6LA 4Z0PA 2EIJB 2ZITA 1YZQA 1UZMA 1L8OA 5HOQA 3ZXIA 1R5OA 2ZYRA 3KFXA 4OBXA 3GFBA 4ILKA 4WXMA 2C59A 2JGUA 1F4NA 4D8WA 3HJCA 1XMVA 1AKQA 3UFXB 4JBNA 3CP1A 2JEYA 3RJ9A 1ETUA 5TLSA 3NHPA 5C8XA 1BEEA 1KJZA 2HIGA 4XWYA 2YINC 2Q9UA 3BGIA 4RZUA 2KM1A 4YJHB 1HEYA 2QHXA 3G2LA 1T1GA 3RI3A 5FBQB 3T38A 4CDGA 1G18A 1MOQA 4K9MA 3UM9A 3ZTYA 1OXMA 1WCIB 3WWPA 4RQAA 2CF5A 2NN4A 3IJ5A 4WBNF 5JQGB 2KPOA 5LYYA 3DMTA 3F2IA 1XQ9A 2JLRA 4TZ6A 1TCVA 4XDYA 3ORSA 2XF2A 2CJXA 1GL6A 3MG9A 1BX1A 1ZSVA 3IPRA 4LWZA 3IV7A 4CKCB 3JZAA 4DLUA 3ZDYB 4FCVA 5FPQA 1JHZA 2VK2A 1ECJA 2ZR2A 1YVDA 4AD8A 5IYZB 2CK3A 1XHEA 5GW7A 4I7EA 1ZH4A 3PGLA 3VSDA 4REQB 2EC5A 4BBJA 3T2MA 1JQEA 4MJ3A 1MTOA 4QC2A 3V1UA 3SICE 2VP4A 3TZCA 5JHGB 2JI4A 4OHKA 1EQUA 5HIJA 2PWYA 1MW9X 4S0XA 1E5TA 4E5DA 2X0NA 1W4ZA 2ZAUA 1E64A 3BRWA 1UT5A 1J23A 1OH5A 5CCEA 3SVTA 2ZE6A 2AG0A 4OSEA 4G0MA 4WNAA 1IUPA 1KK2A 3VBEA 2A0WA 1Y8AA 2P6OA 4D26A 3UAVA 2QVLA 1G5RA 2FSVA 3RTBA 3WV4A 5ALMA 1AI7A 4TKZA 3NV9A 1G5FA 3DW1X 4XVHA 2X0DA 3FDZA 3B7WA 5FNZA 5BWNA 3H13A 4QGSA 1FC0A 4DBLE 1DV2A 3S2SA 1GQFA 3PGA1 3PQCA 3AM4A 1GN9A 3TWOA 1RJFA 1GUBA 5JCZA 1TA4A 1QRTA 3CXUA 4H60A 1G7RA 2B92A 3A37A 4L72A 3TR0A 4IL5A 2XAFA 3OCWA 4G4YA 3T3GA 5HJEA 3A9RA 5LMCA 4DXDA 3GLFB 3NVKE 4X97A 2O2XA 4FYKA 1B15A 4EENA 1WSWA 2REQA 2P4KA 2HFJA 4HN4B 2WIFA 4NDNE 2QPLA 2ZT9B 4XEHA 3FBAA 5B1HA 5EN4A 3HMKA 3NOVA 4OOFA 1OWPA 2HSWA 3VH1A 1K8ZB 1QE0A 4HWSA 1ECBA 4DV6B 1MR3F 3CRCA 5KQMA 3VJKA 5K3SA 3T0FA 5FPSA 3D01A 5C8ZA 1M4UA 1CUZA 2ZVDA 2ID4A 5AJYA 4ZT2A 2AKEA 2A86A 2KX7A 4U5QA 3HCDA 1R50A 1KEVA 3CCSV 4FOPA 1NMXA 4LRXA 1SCAA 2RIRA 2HBRA 1SHZA 1JQ3A 1WY5A 1KMIY 4QUGA 2JS5A 1SIWA 3GRKA 1JSRA 4PYQA 3WFJA 1SKAA 1IN1A 1U1DA 2ZBDA 1NV9A 1OCZB 4CM7A 1TJ5A 5L3SB 4W4LA 3SEAA 3OY2A 4KV7A 1OA0A 4PFJA 1Y9ZA 4DDHA 4YRKA 1CEXA 3LC7O 3TZHA 4B1FA 5DW3A 2LGJA 2QRZA 1GNVA 1EA7A 5JWPA 3FIUA 5JVDA 1Z5ZA 1ZLZA 3W7AA 3HUUA 1NBWB 5C5DA 1XB2A 4FPPA 3EGVA 3O90A 2MYPA 2YIVX 4NYKA 1JNXX 1ZA2A 3IVRA 3QYAA 3C41J 1ZBQA 3WLAA 4ZJZA 3A26A 1O6GA 1GCAA 1JD1A 5KCZA 3CCEV 2C2OA 2IUSA 2A9VA 5F9FA 4RL4A 3MXTA 2CGOA 1XJQA 3TKLA 1BHSA 3JWEA 4ZRDA 2DPXA 2ZVQX 1A9OA 3PPWA 2H06A 1HETA 3DAGA 1LBHA 5BSKA 1H8HG 1XFDA 1QYRA 4G4GA 1J20A 4NZNA 4YA6A 1OI2A 1FVHA 2IODA 1G20B 4OBWA 2C0PA 1WB6A 4FR0A 1HURA 1LC0A 1VI5A 3G8DA 2VA9A 3AJEA 3GGPA 4RD4A 2XKAA 1AHPA 1KGDA 3VQYA 3AL0C 4G5HA 1WABA 1SESA 4H6PA 3N6RA 3GDFA 4YP1A 5I7AA 2R1TB 2QY9A 8ATCA 2DZDA 1LFDB 5JLJA 5A3JA 4B4DA 3DO6A 5JAIA 2BC9A 1V4BA 3W79A 5ITZB 1XRJA 2IHVA 4DYDA 4TLLB 3DC2A 1SM4A 3G71F 2JBHA 4HAWA 3DKPA 2WLTA 3M3DA 4OAPA 1RAFA 4LXGA 3KCQA 2BSKA 4H44B 3LDEA 4Z0NA 1FP2A 2LNDA 4WZAE 4CM4A 4KPUB 1RXSA 5HUHA 2FQ1A 5DMHA 1J0CA 1Z8DA 2DWOA 1T6XA 1Q16A 4K40A 5LQNA 2VT2A 1NR1A 3HL0A 2ZBFA 4JBHA 5H8WA 1DRKA 5AKGA 2HWYA 3WYFA 4G1CA 5CDYA 1VLVA 4WK4B 3GPLA 4HNGA 2DTEA 6ABPA 4TQDA 2GWRA 2ONZA 4K6HA 4TZZA 3DONA 4U6SA 1EUZA 2Z43A 1KO5A 4OQFA 5DM70 4J29A 1YOBA 2VYQA 3PL5A 3C8LA 2OORC 3OIDA 4E21A 2PI5A 3DXRA 4Y2JA 3S5UA 2IOYA 3HWWA 4ZAGA 5I9SA 1KYXA 2WLNA 3GV0A 2JLUA 3OFSA 3SDZA 1D0VA 4XX0A 1GRNA 3C9TA 1Z4PX 1IZ7A 3E18A 4P86A 2QTAA 3I7TA 3KSMA 4MI1A 3D6TB 5GJBA 3JAWA 4KGZA 1U90A 2QVCA 4HOYA 1TO2E 3D6VA 2Z30A 5LXTA 1AR1B 1MEOA 1VHWA 5CP8A 5L40A 4P35A 1MOFA 3SQDA 4GQAA 3VR4A 5HZMA 1K4MA 4AJ1A 3RWRD 3UHOA 3KSDO 4CF5A 3IOCA 3AJAA 1CR6A 4MKHA 1E20A 2UYJA 1DAIA 2HCFA 4W7SA 4AJOA 5A4IS 3MDOA 3C3EA 1MX1A 3VGJA 3WAGA 2Z8ZA 2MSLA 2FV8A 2BTOA 2I3BA 3HKEB 4TSFD 1JILA 1GQSA 4B81A 1MABB 3JSNA 2B9EA 1V71A 2ZEJA 2J9FA 1RSZA 3PEFA 2A0UA 3CG4A 1SETA 3ZI7A 1NOJA 3JCUZ 1COZA 2WD8A 4PA6A 1DUVG 4RKEA 1Z2EA 4LS3A 3B6JA 3H42B 4G5OA 4UCTA 1AB3A 3LX6A 3GGCA 3BRCA 2IXBA 5K6AC 4ABMA 3HP7A 4DPMA 7REQB 2O2DA 5DXJA 1KZ1A 3SS7X 2Y1OA 4R16A 5AQEA 1E3QA 3LQ4A 2EZ8A 5BOVA 3Q3EA 4QDOA 3ONFA 2PRJA 1YDMA 1VJ5A 1XDGA 4UMDA 4BX3A 5EP4A 2V7BA 5A2QM 1IJKA 1H3EA 2YMQA 2RKBA 1J8DA 4FR5A 4GIBA 2R86A 3FHTA 5IM4A 4ZCPA 2LP4Y 4QFDA 2WZBA 4P5EA 1YR9A 4TYNA 3BWYA 3JQ8B 5C3MA 1FNKA 5LDDC 2IP4A 1HH4A 3WHKA 1FLAA 1DWPA 1DPFA 1JXOA 1T2NA 3OKCA 4QBHA 5AVRA 4OI2A 4YJHA 4ISBA 2WDZA 2WF6A 4YLEA 5EHNA 4EKEA 2HVYD 4Q7KA 1E1RG 3U10A 2GLTA 2FFHA 1UMKA 2C03A 2QTNA 3FH0A 2MW2B 1Y67A 5FOWA 2QEXF 2GYYA 2AZTA 4QOJA 2AB0A 5CFRA 3T3OA 1TTQB 1QIHA 4DSZA 1WCIA 1G6UA 4QLAA 5JQGA 4F6EA 4R98A 3BZUA 5DTEA 1A9YA 3TL3A 2FGKA 4OMUA 4G1UC 3Q2IA 4LDNA 4Y2TA 2O2IA 4KNWA 4ZAXA 3WB0A 4U7NA 2CXRA 4CKCA 4YMUA 5IJ0B 4L5YA 4L6CA 5FFMA 4RWEA 1GZ3A 3W5JA 4K2AA 4DLWA 1ZAKA 3AUSA 5H3CA 1TZJA 2BZ0A 3H6GA 3RYHB 3OTFA 4REQA 1Q7RA 3FPCA 3UV3A 3OFVA 3QHDA 1QH1B 3U7FB 3CCQF 2ZXUA 2KSDA 3JYCA 4Q03A 1FB5A 2C00A 4UU7A 1THZA 2VRCD 1KAEA 3ZU6A 2PMWB 2PTGA 4ND3A 1ZN2A 4Y18A 1ELOA 3OY7A 4G9EA 1P60A 4A6XA 3KJNA 4MKXA 2XVMA 4K9SA 3AILA 5FDFA 2DR3A 2DJ5A 2MMGA 2GYUA 1F23A 3B6MA 4JUCA 2IPLA 3OG9A 4GI5A 4MWCA 3N3BC 4IYHA 5H81A 2G17A 1AUPA 3OUUA 2PMBA 2PS9A 4FJ1A 5G0UA 1WV0A 2WVGA 2GN9A 4WFGA 4DKXA 4MDHA 4UTNA 4UHCA 1N57A 3OMIB 5DN6G 4MVXA 3VBCA 5EZ6B 1KPIA 5CH8A 4NEGA 4YXWA 2FN9A 1OF1A 2H11A 4QOHA 5KTNA 3G2MA 4UVAA 3Q6NA 1UKZA 3O4HA 1NRXA 1GKKA 7AT1A 3V34A 1XZDA 4GQIA 4QREA 2WU4A 3A9TA 2Q1UA 3VTFA 2MWMA 1XT6A 5IW8A 3P32A 1IVYA 2QYSA 2K4MA 4F3NA 1SZXA 2WTEA 3K5NA 2GBLC 2YIAA 3TOZA 3SZOA 5B3AA 3FCOA 2MQEA 3AF1A 4LDAA 2QTGA 3QG1A 1P77A 3NORA 3AEIA 2ZU6A 3D4NA 4N3NA 1H48A 3VAAA 1GU7A 2ADMA 4RIFA 3QEKA 3ZK9A 2WU0A 1LX6A 2G1UA 2D2CB 3L92A 1UPFA 1C81A 3PQFA 1JKJA 1WXDA 5FLYA 1NT4A 1U2GA 3L7OA 3QA9A 2ODPA 2NV2B 4E2FA 1E2LA 4W5JA 4BV2A 1QVGU 2VJMB 4FCCA 5LIRA 1E99A 3DE3X 2D5LA 4AS1A 4ER3A 3WIUA 5LGUA 1NF9A 1MB4A 4PTYA 2QTTA 3FCCA 4AICA 4C81A 1ZP6A 3V4ZA 1BOOA 1NOIA 3DOFA 1KQSU 1FS0G 5DM6V 2FWJA 2XD4A 4UU8A 1N9KA 3TDKA 2VPWA 3HFGA 4F11A 3T9DA 2V4DA 5HTKA 3SC6A 2YDYA 1NTKH 3ER8A 2J0UB 2PZEA 3DT6A 4XB1A 3W5SA 2HDOA 1ULUA 1UXGA 4P84A 4I99A 1LNQA 3L84A 1V6AA 3LYHA 1VB3A 3PFNA 1X15A 3ZLVA 5AVZA 4P53A 4FI3F 1EU1A 4I8IA 2C5AA 3PG5A 4CLEA 5JDCA 2F4NA 2E4WA 1QNMA 1T9BA 5JHHB 4NPCA 1OLOA 2PUFA 4EMSA 1V37A 3EC2A 3H9UA 2W6JD 3U4HA 2R1TA 5LR6A 4N7BA 4GZMA 3V9PA 3RC7A 5BRNA 4GC5A 4INPA 1JHRA 5ITZA 3CISA 1JI3A 5H5JA 2UXBB 3T5AA 3DC5A 2IPMA 1E7YA 1O5TA 3PXEA 1B23P 3DHEA 2Q9BA 4MRRA 1X1BA 3QBEA 2CZWA 4EJ0A 2C7OA 3UATA 3L9DA 3AG2C 2QSYA 3GGOA 1YR2A 1EVEA 3H8SA 2ETNA 2ZSIA 2DYKA 2QROA 4S0ZA 4R7CA 2G6BA 3HO6A 4KPUA 4AC9A 1KI9A 2F8SA 5L6LB 1YI1A 3KTOA 3ZWAA 3OQBA 2GAOA 4O2BF 5KTYA 4XDLA 5GMOA 4BVLA 3N5KA 4UNNA 1G9XA 9GPBA 3OONA 2RG7A 5AKZA 3ECAA 1VJ1A 2N47A 4NZYA 1QDUA 1AR5A 2VP6A 4TT3A 1HUQA 1YZVA 2BM1A 4CIVA 3GRRA 4S1WA 4C5CA 1I0IA 3OZVA 1RFLA 4RA9B 3UWSA 1PJRA 1DC3A 5EFZA 4X1OA 3PD1A 4U7DA 4UTVA 4XOUA 2Z08A 4CM1A 3EQ2A 2QXTA 1JPXA 4TPKA 1JOYA 4C21A 3PUYA 1O2DA 3LQ2A 3L73H 1PXWA 5HZHA 1OU4A 2XLBA 5A06A 3VNBA 1J8MF 4U00A 4S12A 1BXGB 2Q1YA 1IE3A 3G2NA 1UL1X 2GNAA 1R5NA 1J97A 2XT0A 1SKYB 4RQTA 1JYSA 4MWGA 1XDBA 4UV8A 4FSHA 4IQ0A 4G0NA 4G4ZA 1M6YA 5DEIA 4C88A 1H3NA 3MQWA 4UMVA 4MP3A 2RGEA 2XAJA 1B06A 2R2AA 3HKEA 2JFBA 1T6ZA 4V0MA 5AI0A 1MABA 3MILA 2WFAA 4XD7A 1Y42X 3WLHA 1O0SA 3UH0A 2WSSA 1GXSB 4PQEA 4NULA 2QU7A 3Q6IA 3UXMA 1NFRA 2AQKA 2OZEA 2R8YA 5KYXB 3AESB 3K0HA 1ADJA 4DDTA 4OCZA 2ZBUA 1QHHB 4I5EA 1X19A 3DCNA 7REQA 1PR1A 3KJJA 1U0HC 2NGRA 1GFIA 3FHOA 5KAMA 1DKRA 3W5HA 5D3MB 1BS9A 3SPIA 1LX7A 2Q5QA 3ML1A 3H05A 4DV6O 1CW2B 5I4KA 2WA2A 2I3ZA 2RC6A 4X3PA 2GCOB 5UKDA 2VJQA 2Y68A 3R8FA 1HFEL 3C6QA 4P22A 1YD7A 2ZYTX 3O03A 4WVLA 2GEDA 3KWMA 1IEXA 4RVHA 1K66A 2ZJ1A 3GWKC 3VOAA 2WNHA 4PLZA 1ZMOA 3AT1A 4JB2A 1Z6PA 1ZWIC 2WJVA 2NO6A 4C8GA 3NAMA 3JQ8A 4LHSA 3EF0A 1IHYA 2RHTA 5MHTA 2ZWAA 4G5YA 4MTLA 4XYGA 5ICGA 3AC0A 1X7WB 3L71H 3PL1A 3T61A 2BM8A 1HOXA 1U1EA 2WQ7A 2RH4A 3PQ2A 2PZGA 4O2AB 4KGXA 3PT5A 1LSOA 1H1DA 1CUFA 5A7HA 1Q7GA 3BS4A 3WNBA 1TZKA 3L0DA 2DQYA 1OZGA 3KKZA 1H2KA 2PZAA 1C1DB 5IJ0A 3QPWA 4ZU1X 2ERXA 4J7AA 4C7BA 5JNRA 3ZHVA 4R1PA 3B51X 2E1PA 2UUOA 4NV1A 1Z7BA 1QHIA 3ZXUB 5EIEA 3RYHA 1JFVA 4B3XA 2ZTMA 3GU3A 4HS4A 3PHHA 1QH1A 4RULA 3WGUA 2H5LA 2AHRA 5IK2D 5T4BA 2GUGA 2X0JA 2DUUA 3ER6A 2G1PA 3A1UA 1YQDA 3S28A 3PRHA 1D9XA 2BR4A 1U94A 3TI9A 3FUXA 4N9QA 1FBNA 3FR7A 2YZGA 3CUWA 2ZUCA 5E3IA 1N1MA 2CZGA 5JV5A 1YHYA 4B6SA 4DXHA 3MT0A 5LUBA 4BO0A 1VCOA 3FYDA 3NC1C 2FF7A 2N3ZA 3PHGA 2GPNA 3ANYB 4QDZA 3VYTC 3K0CA 5DULA 4TKVB 4ANFA 3BD9A 1I3KA 2RKWA 4YIPA 4S05A 1VG0B 1DJMA 2CT8A 1J0DA 2PXHA 5KWVA 4X90A 5IHPA 1JG4A 3AJRA 3LY5A 3SR0A 4F9GA 1U3CA 4G5SA 1LFAA 3EAQA 4H7DA 1K9SA 2O1WA 3X44A 1YUNA 3A1DA 1RWNA 1PL4A 1Q1GA 5DFAA 5JAQA 1JJBA 4I9QA 2M32A 4CH6A 3MK31 4EHDA 1RHQA 4R69A 4BZZA 1OX5A 2PL1A 1XCJA 3I9OA 1UR5A 2RGUA 5BSHA 1QMPA 2PYLA 1X13A 1WMBA 3ZJVA 3WRWA 3EG9A 4K1XA 3DOJA 3VOUA 2LPMA 1D6JA 1SBQA 2VGMA 1THMA 1V47A 1C7EA 5DHTA 1E79D 3QLEA 1XZJA 2XE6A 4D96A 2ZDIC 5KQSA 5SZIA 2YHUA 4Q6WA 1XKLA 1OGIA 3WOVA 2WILA 1MNGA 1MVLA 3OMXA 1OVMA 3C24A 5TVKA 5B1OA 4G6ZA 2UXCB 1O94A 3CTPA 3FYHA 5KSWB 4N01A 5CK5A 3VPXA 2RE8A 3OR6C 2HQSA 1GITA 4KLNA 3QWFA 1VQ9V 2Z8YA 3N2ZB 4H4DA 1L4KA 5EB1B 1S01A 4YP5A 3R3HA 4DNPA 5K7SA 3MTEA 3DT8A 4TS3A 1B16A 2VJMA 3Q8WA 3CCRV 2J5KA 2NZWA 4BKOA 3U40A 1ODLA 3NHSA 3WGZA 3ZJZA 4K1LA 1VCIA 4C82A 4G5RA 1H42A 5EB0A 3TECE 3QLVA 5FI3A 4FC7A 1NXQA 5CT9A 2E82A 3KTAB 3G6KA 3C3MA 2EATA 3SIRA 3K3WA 4WJKB 1U63A 3V4VB 5HFNA 3QEMB 5LZ5A 2W93A 4EPWA 2J0UA 4EHHA 2A5YB 1EBOA 4DLXA 4BNUA 3CX4A 1OV4A 3CF4A 2C3YA 4PI2A 3TF5A 3BD8A 4X8AA 1P72A 1VI6A 2ZB8A 4YDRA 1WZNA 5LQAA 4DRZA 1K63A 4Z8YA 2P9JA 2EHJA 2P5SA 3WKAA 3NYWA 4F7WA 5TNXA 1TVCA 3UK0A 4PLWA 3ENNA 4J0GA 3GVXA 3BMCA 4AKTA 3IEUA 2IOFA 4CUKA 1TLTA 5EWJB 2QTOA 3HTNA 2GEVA 4TVSA 1O3YA 1FUUA 2ID7A 1PF5A 3FYEB 4Y9SA 2X15A 4QUAA 3LWZA 2WWYA 1IZ8A 1NUQA 3MMSA 4YP7A 2BMVA 2VJPA 5B1BC 1ZM9A 3OF2A 5ALPA 2ATCA 3GLSA 1Z0FA 3KEMA 2Q2VA 4ASUG 1L4UA 5BORA 1RQGA 4X63A 1NDHA 2WJWA 4K8RB 3VPDA 1NUPA 1L5YA 1E3EA 1EZJA 4QQKA 1VMAA 4BT3A 1RZUA 1B3BA 1GPJA 1GMGA 4I5SA 3C5VA 2DH5A 1NUHA 4P82A 4J0HA 2GBPA 3D3EA 3UJAA 5KYGA 4MVOA 2JAPA 5DHPA 3PNLA 3GFVA 4GKAA 2V9YA 4RA9A 4PW0A 3WSVA 4Z9FA 1MIOB 3I30X 1KKCA 2FSIA 3INTA 4RMHA 1MORA 1ACJA 3QKWA 4M6WB 2XGGA 4YJFB 2JIZG 1Z39A 4OUKX 4LXXA 1BHJA 4I6JA 4N6GA 1PP9H 2Z3YA 4ISCA 4JVNA 4ONEA 5F3DA 1SUBA 5JY1A 2BYTA 1OXVA 2ZODA 1LY1A 4QM7A 4ARSA 4N8EA 3RHSA 5DH9A 1MZEA 3HR0A 1MVNA 3OSZA 3B1KA 3PUZA 3CZAA 1KZ4A 4KIWA 3E7DA 4KJZA 4TWZA 4J8PA 2XOXA 1Q1NA 4OMCA 4MHSA 1JYEA 4YMGA 3CB4A 1Y7HA 3H9CA 4LYFA 1GZ6A 1N0NA 1VQOV 3ZLBA 4YALA 2OK7A 4HB2A 2BMWA 3SZRA 4BBAA 5B2EA 4NYJQ 5DOVA 4W4TA 1VP9A 3W8DA 2ZR0A 4MKRA 3ZXYA 1JDSA 5K0ZA 4PLPA 4U2BA 2QR5A 4AG6A 3TX2A 5TPZA 3A7EA 3KR2A 2WY2D 1L4MA 2P9TA 1P2DA 2QN7A 1IDSA 2QTHA 4PN3A 4N7MA 5FD8A 5DVZA 2FE4A 1J56A 1YSCA 2IYRA 3HMQA 1GXSA 2Y1LA 3SYPA 3HFJA 5EBMC 5P8WA 4UE2A 2AGVA 5KYXA 2CHUA 3AESA 3CF0A 1UDBA 1M8PA 2DLNA 4D56A 1UP6A 1JQDA 4MV0A 4GUNA 2F1MA 2PZJA 3M6WA 3SSAA 4RZ2A 2Z6QA 4LWPA 2VOEA 1S2NA 2QOEA 4JXJA 5D3MA 1H47A 1ZK2A 3SYNA 5D87A 4Q9HA 2Z83A 3TD9A 2EX1A 4IHKA 3UMRA 4M0CA 4TLMB 2GCOA 4B5KA 3H2GA 1SZDA 1BXKA 4LKOA 4NQZA 5I9NA 1JJ2F 5JR3A 2FPRA 1K0FA 4QJBA 5CDFE 4X8MA 3WO0A 3S3TA 1L8QA 1G55A 2J67A 1UK6A 3QG5A 3I3SR 1AF7A 4IIBA 2QU8A 1BEUB 4MGEA 1CULC 2O8VA 3ANXA 3H9JA 5C53B 3LJKA 4US0R 2BAGA 2AJ8A 3PJDA 5GIOE 4B6JA 5E79Z 2HEPA 3RVJA 3D3WB 1XMJA 1HTBA 3ASUA 2HJHA 1V9CA 4KR7A 4WNAB 5LL6Y 1HW7A 1RTTA 4O2AA 3W7TA 1QQ5A 1RE0A 1T5IA 5CNJA 3BXPA 4NV3A 2E75B 1NT2B 3W1VA 1FJGB 3ZH9B 1E8NA 4DUPA 4TUYB 1US6A 3DGEC 2ZG6A 5A9RA 1SWWA 1QMGA 3L40A 4GBMA 1C3OB 1C1DA 3S2YA 4CMKA 3EAGA 1FFWA 1SU6A 4MVJF 2QS9A 4A8JC 1GG5A 3KZXA 3M7MX 3WK9A 1Z0SA 4QDXA 3D54A 2QPTA 2JGFA 3O8QB 4PYRA 4CKXA 4YAIA 1T0KB 1RHRA 3UFBA 3GIWA 5DN9A 4Y7DA 4IIJF 5E8JA 2FWIA 4BNFA 2QL5A 1E8MA 2QL6A 3AEZA 3GUZA 1M1YE 2IH4A 1XZKA 3I92A 4XDZA 2BKEA 2HA2A 1EZVH 2YEVB 1CQPA 3N2YA 3I04M 1UJ2A 3C3YA 1VCHA 1IEVA 2I03A 2P2CA 2PY5A 1BVYF 2DMRA 4WDQA 3JQEA 4P3NA 4G81A 1XYGA 2BHRA 2QM3A 4JI5B 1NVUQ 3DDSA 4JGGA 1IIBA 5J4VA 2UXBO 2GKSA 4E32A 5A5EA 3C1OA 3HYLA 5A03A 2ZIOA 1QOZA 4DSNA 4JCCA 2Q99A 4EIWA 1VLHA 4UUPA 2ESRA 1QZTA 1V2GA 3I55V 2X86A 3CWQA 4BYGA 4KNVA 5DTMA 4K6CA 3ZCQA 2HYIC 3CRRA 2GSMB 4YN3A 2VDPB 4RVSA 3KSAC 4WT7A 4EKWA 3KSBC 2GA9A 1K8QA 4R1OA 4G0UA 2GEBA 2B2CA 5B58T 4E14A 1NP7A 4XD2A 4AKIA 2ZUEA 2GZAA 4UNIA 4QWWA 2C4KA 1USGA 1P9WA 3KJKA 1TO6A 1JA1A 3CEHA 5B1AC 4CKZA 4L57A 1XA3A 2AC7A 3VVCA 2QX6A 2FEPA 3VPBA 1GDDA 2VJBA 3TW0A 2HV8A 1H6CA 3VRHA 4OGGA 1G9TA 2PH3A 2ZYWX 5KYVA 1U7OA 1M7BA 4HH1A 1BHBA 3PC8A 3CLSD 2VP3A 3KSRA 3NPMA 2KG7B 3DB2A 1N25A 2ZANA 3KV1A 5GONF 3OSUA 3C3BA 2P0EA 3DAOA 2E4XA 1U0OC 1KDOA 1DIHA 3K5MA 2OCHA 3L18A 1JJ2U 4MVCA 2GO1A 1H22A 4UBKA 5CYPA 2VNAA 4Q1EA 2OV6A 1IUKA 4YUVA 1L4BA 5AQ1A 2C42A 2XNDA 1WULS 4FB5A 4YRTA 4UM9D 4GYYA 4BMZA 1Y3DE 3A2FA 3NK6A 1Y8ZA 2P9YA 4O5AA 2O2EA 1H2NA 3KTAA 2O7NA 5C8YF 2H1IA 1JHOA 4BT7A 2A9JA 4G8JA 3QEMA 3LRTA 5JPCA 4EY5A 5KMGB 4B9AA 3WICA 1FYFA 3HLYA 4NWIA 1GH6A 5A02A 2EGHA 2PYZA 1RYZA 3UJDA 1JDTA 5FA5A 2F7SA 1Z22A 1W5BA 4KTVE 4IJWA 2O3SA 3F5QA 5JXWA 2AMFA 3LH5A 1UJ5A 4IWNA 5KNDA 3EXG2 1Q0TA 4BVTA 1CG6A 3NPAA 1AUVA 2ZAMA 2J3IA 1ICEA 2YXNA 3AIIA 4LTDA 5DTRA 4WH0A 2VZ8A 1O77A 5EWJA 1E2KA 4DUGA 2FMKA 5T6BA 1K9MH 1F1BA 4LZJA 4N1AA 2CXNA 3D8RA 1MRNA 3DV0B 3ZMTA 3AGQA 4X8HA 2QN6A 2ZTVA 2AD5A 4GUAA 3A6ZA 3B82A 4KMMA 3P96A 1S8FA 2C1XA 5JZ9A 3SS8A 2BN4A 2P1DA 3SPCA 2BJHA 3L1VA 1O8BA 4J3JA 4FLMA 1ISGA 5BWBA 5JZVA 3D6AA 4RWUA 4UAUA 4G5FA 4R8RA 2VAWA 1WNFA 4RSMA 3H5AA 3KQTA 3THRA 4BQQA 4MUKA 3AL3A 3C9SA 5FBKA 4I4NA 1ZIPA 2OHOA 2GRUA 2IIPA 4LOIA 3CEAA 5BYKA 2GD2A 2R68A 3IRUA 1XL4A 3N8IA 3GLKA 4IV0A 4F5ZA 4GICA 4CQNA 3BXXA 1VRVA 5HDBB 1DJPA 3U49A 3ELYA 3FD5A 4M1OA 4ABTA 2ZUBA 1PLLA 2WHPB 4KXWA 2R7NA 2OG2A 3ICQB 1MIOA 2V7UA 2G5TA 2ZRDA 5H4GA 1V8FA 5JD3A 3VNAA 3HB4X 5J59A 1EBUA 2J33A 3AFHA 1BJRE 4M6WA 4YJFA 4TTQA 1WKVA 2B6NA 2G63A 1QLJA 1NVEA 3EASA 1NYRA 3MB5A 3OIGA 3DL4A 3L2OB 1JTVA 1QS0B 4AURA 3QWBA 2MU1A 3LLSA 3MCAA 1BS2A 3BXHA 1CUCA 3TLEA 3DULA 5AH0A 3ZD9A 3KZIZ 4ZALA 3TTSA 1DX6A 4ZGWA 4D0SA 4LCBA 1IBLB 1CP2A 1FYWA 3O0DA 2C9ZA 4Q24A 3NDRA 3RS5A 1IU9A 1O89A 4B4OA 3L7NA 3N8GA 2VRZA 1RAGA 3ZWWA 4ZYLA 3I73A 3T9CA 5B37A 1C29B 5JJKA 2WM9B 3C15C 3OKFA 4UZFA 1P4JA 1GUFA 1FYVA 4B8ZA 1EE1A 2PKQP 5CX1B 1XUOA 4P8RA 3ED5A 1E0SA 4F1KA 2V54A 4ZAVA 1J39A 3MSCA 5J2TB 2WB4A 2Z9DA 2NLOA 3LI2A 3ZY4A 5D1HA 2DHDA 5C7YA 1DT5A 1Z88A 2H2IA 1JLLB 4ENRA 1QG2A 4M53A 5FFNA 5F3RA 4ESOA 4ZGBA 3M5CA 4QECA 4UB8Z 3K8QA 4AKGA 4OUDB 4LUCA 4A6EA 1R4NB 1P1KA 1L5HB 2ZM5A 4MCHA 1MUUA 2ZJ2A 4OVKA 3ZOKA 3EBLA 3GMSA 4C0XA 1TCCA 3L5OA 1TFUA 2OD9A 2ATXA 3FWNA 4WK2B 4BBPA 5KQLA 1QE3A 2FUKA 2NO9A 4FFDA 3AONB 2WHXA 4FT2A 2LQTA 2FH5B 5DBGA 4LWOA 3MNFA 1CEEA 3DAPA 1U5CA 1BCRB 1BQZA 3AM5A 5JADA 2JS3A 3NAGA 4L6IA 1KEZA 4D4HA 2EBFX 4ZT7A 3C8ZA 3RVBA 4QSMA 2R8PA 4JK3A 2UXCO 4Y6SA 5DI3B 4Y2UA 4JA2A 2YIJA 1EFLA 3TRDA 4CE6A 1DAHA 4FNGA 4NABA 1N5LA 2CMFA 1ACMA 2QZSA 3TAUA 4TOIA 1TCBA 4FUQA 4W9NA 4C6HA 4EY6A 3U26A 3OOYA 3FETA 1VPLA 3AR8A 5LZ7A 3M5PA 2AMLA 4BC0A 5JQWA 2NLJC 3D3WA 2P40A 3LXXA 5GAJA 3HJGA 2N42A 1QLEC 5DBEX 1NT2A 4M1MA 3L7KA 3QXXA 2G7MC 2D0DA 4PGGA 1VKJA 3NU1A 4TUYA 5FAXA 3QVKA 1PK8A 1Y1TA 4Z86A 1C3OA 3GJ6A 3EPHA 2PSSA 1RPTA 2CCKA 1NVVQ 1JF8A 1TKCA 1AA9A 1W46A 4JAUA 4I3FA 2XAQA 3MT8A 2EDCA 3O8QA 3MAJA 4ZIBA 4GGOA 5FBZA 3FDJA 3VOSA 4TMWA 2F3TA 2CNLA 4F4DA 3HCOA 2JFXA 5ER6A 4KHPO 2VHCA 1FFGA 3TPFA 2L82A 5ICMA 1SUPA 1XROA 2CN1A 3IBYA 4RZ3A 4JSTA 1DF5A 3KOZA 4PAGA 3LU1A 4MX8A 1NJ2A 2CL6X 3P0RA 2YEVA 2X9NA 3V4SA 3T1OA 4B83A 1QK5A 4ZHQA 3PR2B 3ESAA 1HGXA 3FMIA 3STZC 5HMLA 1AURA 2VP0A 2BL4A 3GIDA 3BH7A 2PRIA 4REMA 3ABSB 3LT5A 4PZZA 1YITV 2IYVA 3WB9A 3T54A 4JSRA 3GLIE 2Z01A 2V03A 2WJPA 4NG5A 1BMQA 1YUMA 3AG2B 3L8HA 3V46A 4CVNA 5FXMA 4LY9A 1F3LA 4Y0AA 1MOPA 4KO8A 2V6MA 3FOAA 2ADOA 5JSZB 3RUIA 1JKJB 3C5WP 4QU5A 5CBGA 3DXXA 2SKDA 5K0FA 1M3SA 4G5QA 3VZSA 1OMOA 1JQ5A 4PG5A 2X77A 3Q7IA 3FRIA 3W5DA 1OJ7A 5A5GA 1JP7A 2VF2A 1EP9A 1MH1A 4C8EA 3FNHA 1R3KC 2NPOA 4PGMA 1GZ5A 3LLVA 4OXQA 4NXNB 3KIZA 4DMKA 1DSSG 3FPGA 1LKZA 4ETMA 2OORA 1L5QA 1PM9A 1LRLA 2JBAB 5BMVA 2IZ7A 4XVQA 4KBFA 1F7VA 2NACA 4JOSA 2O5CA 1EWKA 4I1RA 3D8HA 4ZJUA 4U7JA 1BGXT 1N32B 1UOOA 1VHAA 2D3TA 1ODTC 4FE4A 1F17A 1AB6A 2CNWA 5E0KB 1C1YA 2Q7HA 3TQOA 1ESZA 2FLKA 1P7WA 3H1FA 2KG7A 2GN2A 1J33A 3KWJA 1J0EA 1PWYE 4G0WA 4HBGA 2Q7DA 1COWA 3HE3A 4ETNA 3G9QA 3D7NA 1RDFA 4QQ8A 1TF7A 3NJ8A 4UCFA 1VC2A 2P22C 3NHMA 1Q86W 4JDUA 4RM2A 3H5VA 4K9LA 1ZVQA 3PQ4A 4HPXB 2BGUA 1VHTA 1LJ8A 4NU6A 1TQHA 3KQYA 5CHYA 1OBOA 4OHCA 1NI3A 4MUAA 2VWHA 2I4OA 3MMZA 2A79B 1OILA 4TLAA 2HV9A 2VI5A 1GL3A 3P4UA 4YMHA 3TXAA 2O57A 4Z4FA 2UXXA 4MS3A 1F20A 3WA7A 2CUKA 3H16A 2XVZA 1DQPA 1NASA 2WJZB 1TCUA 4YRDA 5FLXN 1D4FA 4XWAA 1VK3A 3LFHA 1KS9A 5AI9A 3BWDD 1KSJA 4M49A 2KTUA 5KMGA 4RMJA 2IYNA 1XAGA 5IBQA 2WIBA 3OZ7A 2HIHA 4PR3A 3CQ9A 4M9XA 4JBWA 2P6JA 5LGTA 3ZX4A 4DNXA 1HTTA 5K6AA 2YZNA 3WLOA 4IR7A 4CTJA 2I91A 3F8TA 1KQNA 1N6KA 3FROA 4GWGA 5A3QA 1E4EB 3ZYZA 2G6TA 5BSVA 1XA4A 3JQGB 3LT4A 3QBDA 4Y6QA 2WBLC 1KR2A 5HKLA 1GGHA 1ENPA 1J2EA 1ZD8A 4K0KB 1DCMA 1EUQA 1JALA 3L75H 1W87A 2POQX 3E8MA 4UB6Z 4KYTA 4P58A 4I0XB 1MO6A 3MVEA 1POXA 3DV0A 5IANA 1XZEA 3WY9A 4X88A 1PNQA 2LIVA 3H84A 4H13B 3RQSA 3QE9Y 2IS2A 1C9JA 2TS1A 2YV1A 4HPJB 4U7HA 1G291 4CHTA 3OBWA 1AX9A 2KS6A 2Z5FA 1Y9DA 2OPBA 1GPLA 3S81A 1TTPB 3WG9A 3WGMA 1Z0AA 3R9KA 1RWQA 1LNSA 4UHBA 5KAIZ 2WKWA 1QFXA 4O3FA 3TD5A 3GYBA 3RSCA 3TXSA 2ZB7A 4OATA 5EZYF 3LFTA 3OBIA 4B3HA 3PUWA 1SQPH 3AINA 2ZIZA 3DEYX 1FJGO 4DG9A 3ZWCA 4K8XA 2H51A 3C7CB 3BWXA 4N40A 3DPIA 3C14C 4IJVA 4RJTA 1ECGA 3KT3A 4X54A 4E0BA 2LBTA 1WLSA 2WHPA 3PVSA 5JIBA 1VDZA 4HAMA 3V7NA 4FDAA 3EPJA 1FDSA 2YDXA 3RRMA 3IP9A 2BFFB 2XT9A 3OAAG 2J3HA 2C8JA