2BTUA

Crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
329
structure length
322
Chain Sequence
EAGYEAVSRMKKHVQTTMRKEVLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Synthase
molecule keywords PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
publication title Crystal Structure of Phosphoribosylformylglycinamidine Cyclo-Ligase from Bacillus Anthracis at 2.3A Resolution.
rcsb
source organism Bacillus anthracis
total genus 77
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2btuA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2btuA02
3WJPA 3M84A 2Z1EA 3C9UA 3D54A 3QTYA 2HS4A 3VTIC 3C9SA 3MDOA 2Z01A 2YXZA 2ZODA 2I6RA 3WJQA 2BTUA 2Z1TA 3C9RA 3MCQA 3WJRA 3VYSC 2Z1UA 2HS3A 2RB9A 3FD5A 2HS0A 3VYTC 3VYUC 2HRUA 3VIUA 1VQVA 2HRYA 2ZAUA 3FD6A 3U0OA 1VK3A 3C9TA 3P4EA 5AVMA 1CLIA 2Z1FA 3KIZA 2V9YA 2YYEA
chains in the Genus database with same CATH superfamily
3ELCA 4G4XA 3ESJA 4O2AA 1YHQF 4ZOLB 3I7TA 5IJ9A 1W3EX 5B8FA 3CB2A 5EZYB 1JFFA 3V7EA 3N2GA 4O4HA 3VI6A 3VOBA 2KTUA 3HKDB 5EYPB 3JAMM 1VQVA 5JH7A 3CCJF 3HKCB 4M8IA 1YGYA 3JASA 1YJNF 3T80A 2MQEA 3MBMA 5G4UC 4TV8A 4BVRA 1PXWA 5BMVB 2HP0A 1IV3A 2HS4A 3L7QA 2ALEA 1W41A 1KD1H 1DT9A 2HQSC 5MN4A 1FFXB 3MCQA 5HP7A 3CMAF 3FD5A 1VQ9F 2AMTA 2KTVA 4LNUA 3KJJA 5DCVA 3IEQA 3JAKA 1VK3A 5CA0B 3LWQC 5AVMA 4TZZA 1UFYA 2CW4A 3I3FA 3ZP7A 2L26A 2V9YA 5HXZA 3Q8HA 1H48A 3LMEA 3UT5B 4EI8A 5LXTB 3RYCA 4U3JA 4NUTA 3K12A 3FPIA 5KX5A 4I55A 1S72F 3IKFA 4I50A 2QI2A 3C9RA 1VQ8F 1JN1A 1FNKA 3HKBA 3MCAB 1YJWF 2BO1A 2CHTA 5FNVA 3RA6A 3LDTA 1CN7A 3NVIB 2OTJF 1GZ0A 1XBIA 1VQKF 1U40A 3VCZA 1SA0A 3F6MA 3LWOC 4DRXB 4X1IB 3JARB 4ZHQA 1NJIH 1VQ7F 1VQOF 4O4IA 3IKEA 3QHDA 1XV2A 4TUYA 2VAWA 1JD1A 2Z1TA 5GAPK 2QA4F 4BT2A 5CA1B 3N2KB 1W59A 1VQ4F 3E20B 4B5CA 5HP8A 3U0OA 4BW0B 3D00A 1W40A 3O85A 3WGNA 4ZHYB 3CMEF 3V7QA 1ONIA 2UYPA 4O4JA 1VH8A 3JAWA 1X7OA 2KG4A 2ZOVA 5EIBC 5JQGA 4C8EA 1YQNA 4IIJA 3I56F 2Z01A 1RA4A 3RA5A 3CC7F 5A2QM 3HKEA 3KJKA 3IMPA 3S06A 3WJQA 3CC4F 4O4LA 2OZBA 3JATA 5EAZA 2HRUA 2NMUA 1Q82H 3P4EA 3K0TA 4WBNA 3WPXA 1RLUA 5HY1A 4ZHVA 4BT7A 2RHLA 1VQMF 4IHJA 1Q81H 3PAFA 5HWEA 4U39A 5KMGA 1K73H 5GANK 3M84A 4BVQA 1YJ9F 3NVKE 2IG8A 2DYYA 2OTMA 1KNJA 1W2BF 3E1YA 2QEXF 4X20B 3WPWA 2WALA 5EIBD 4HNAA 4C82A 4BT5A 2H8EA 2CWJA 2GVIA 2ZVZA 5CB4B 3F0EA 5LP6A 5HY2A 5ITZB 2EWCA 3RYFB 4F6RB 3K2XA 3JALA 1X52A 1Z5WA 3OBYA 4LCKA 4NQ3A 3CXCF 1TVKA 3S0HA 5LOVB 1U3LA 5HY4A 3F0GA 3VTIC 5GONA 1SDSA 2YXZA 3RYIB 3K14A 3IR9A 4TV9A 1IV4A 4C8IA 4C81A 1W55A 2LBXA 2H8CA 3CC2F 3WGMA 3NK7A 4RHAA 5LA6B 2RHHA 3CYQA 2CSLA 5GIPC 1K9MH 2W8BC 3N4YA 2RHOA 3E22B 4ZOLA 1X7PA 2G9IA 1UI9A 5EZYA 1U3PA 3PLAC 3HKDA 5EYPA 4O2BB 3KHNA 3BYQA 4FFBB 1YITF 4NWOB 3HKCA 4X1YB 4EI7A 5J2UB 5BMVA 3D01A 2Z1FA 1PF5A 2HP3A 1IV1A 3EORA 5J2TB 1FFXA 1W5BA 2VXYA 3NK6A 3C9UA 3ON1A 4BT3A 4EB6B 1OAPA 5IJ0B 3SIVA 2ZF8A 1VQNF 1Q86H 5CA0A 5IYZB 3CCUF 4ZI7B 2BTUA 4YJ2B 5LYJB 3VYUC 3LWRC 4X1KB 1IPAA 4ZHWA 2HRYA 3UT5A 3WGKA 1NQ3A 5LXTA 2UYNB 5JCOC 2QTPA 3VMFB 3CCSF 5JVDB 3TD5A 1TUBB 4B62A 3NMUC 4YJ3A 4RQOA 3OW2F 3RYHB 3F0FA 1XHOA 3C9SA 1W5AA 4IHJB 2I6DA 3WXMB 3WGJA 1QU9A 4R40B 3N4ZA 4I4TA 3LFOA 2Q1YA 3M1XA 1Q8RA 2Z1UA 4O2AB 1E7KA 2IQQA 5IJ9B 3CG6A 2CZWA 2KGWA 4BT4A 5GIOC 1JFFB 4DRXA 4X1IA 3JARA 3CYPB 4ZK7A 3N2GB 4O4HB 2R6R1 1SZQA 2UYJA 3GTZA 1M1KH 2F9ZC 4BY9D 1VQLF 3WGLA 3WJPA 5JH7B 1M90H 1OFUA 5HXUA 3V4DA 1GO0A 5CA1A 3N2KA 3JASB 3LYBA 3MDOA 3QUWA 3CCLF 1KQSF 1W581 3ZO8A 1RLGA 4TV8B 3LWPC 2LCAA 3FBAA 3VYSC 2CVLA 2HP0B 2DT4A 1FNJA 1H47A 3ZP4A 2RHJA 4X3MA 3P10A 1DBFA 2OHWA 3KIZA 3VO8A 1X25A 2UYKA 5FLXM 2YYEA 3TD4A 4LNUB 3JAKB 1GO1A 3ZOPA 3HWUA 3QTYA 4BVSA 3FFMA 3RE3A 2I6RA 3F0DA 5C8YA 1IV2A 3RYCB 2HS0A 3J7AR 3CPWF 1JJ2F 2ZVYA 4U3JB 1FSZA 2R751 3JVHA 1YI2F 1JY8A 5KX5B 4I55B 3VOAA 3C9TA 4I50B 3J81M 2VGMA 2K1SA 3HJWC 1QVGF 1VHAA 4X20A 3HKBB 1QAHA 4BVTA 5FNVB 3CCQF 3R0PA 2AIFA 2UZHA 5CB4A 1KNKA 1SA0B 4G4YA 3OONA 5ITZA 2PHNA 4ZHQB 3RYFA 3CD6F 4F6RA 1ODEA 1ZWZA 4O4IB 2Q1XA 1R1MA 4B46A 4BT6A 5MN5A 2JNBA 2VAPA 3OBWA 2FGYA 4TUYB 5LOVA 3CCEF 1QVFF 1RQ2A 3JCMM 5EB0A 3J80M 1CLIA 1VQ5F 3S02A 4E6EA 5FJ4C 3RYIA 1J7HA 2GZLA 1W42A 4ERHA 3S0WA 2CHSA 4EI9A 1CK2A 4X3LA 1W5FA 2FC3A 3D54A 3HAXD 3S03A 2HX0A 2P6YA 5LA6A 3DDNA 4O4JB 2ZODA 3JAWB 4XCQA 4YJ3B 5EB1B 2N48A 3E22A 5EWRA 5JQGB 3DC2A 2VGNA 4IIJB 3VYTC 2AIZP 3B6NA 3ERNA 4I4TB 3HKEB 5GINC 3CCVF 3V3TA 4O4LB 1K8AH 4C4WC 4O2BA 3CPQA 3CCMF 3JATB 2B33A 4FFBA 4PWTA 3AGKA 2IAFA 3I55F 2H6LA 3KE1A 4WBNB 4KWEA 4X1YA 1Z5VA 3G4SF 4G88A 5G4VC 3LWVC 5J2UA 3IEWA 4DXDA 2LBWA 5KMGB 1QD9A 3C8LA 3M4SA 2RB9A 2BTOA 3VIUA 3G71F 3CCRF 3FD6A 1N8RH 5J2TA 4HNAB 1W5EA 2GLZA 1NMUB 4G4ZA 5EO3A 4EB6A 1KC8H 5IT9M 1T0KB 5IJ0A 1GX1A 1XRGA 5IYZA 4ZI7A 2LBTA 5LYJA 4YJ2A 4C8GA 5LP6B 2Z1EA 2VAMA 4X1KA 5LP6C 4G4VA 3JALB 3P0ZA 5JCOA 2HVYD 1H7MA 1TVKB 2UYNA 3WJRA 2HS3A 3GHZA 1T0AA 2PMPA 1RQ7A 3HTNA 5JVDA 5GONB 1TUBA 5MN6A 3SIUA 4G4WA 1Q7YH 2ZAUA 3GYQA 1YIJF 3MQWA 3G6EF 1U43A 4TV9B 5C8YB 1COMA 4B45A 2OTLF 3TD3A 1W57A 3RYHA 2BTQB 1VQ6F 5HY0A 1VQPF 3S0YA
chains in the Genus database with same CATH topology
3WJPA 3M84A 2Z1EA 3C9UA 3D54A 3QTYA 2HS4A 3VTIC 3C9SA 3MDOA 2Z01A 2YXZA 2ZODA 2I6RA 3WJQA 2BTUA 2Z1TA 3C9RA 3MCQA 3WJRA 3VYSC 2Z1UA 2HS3A 2RB9A 3FD5A 2HS0A 3VYTC 3VYUC 2HRUA 3VIUA 1VQVA 2HRYA 2ZAUA 3FD6A 3U0OA 1VK3A 3C9TA 3P4EA 5AVMA 1CLIA 2Z1FA 3KIZA 2V9YA 2YYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJP A;  3M84 A;  2Z1E A;  3C9U A;  3D54 A;  3QTY A;  2HS4 A;  3VTI C;  3C9S A;  3MDO A;  2Z01 A;  2YXZ A;  2ZOD A;  2I6R A;  3WJQ A;  2BTU A;  2Z1T A;  3C9R A;  3MCQ A;  3WJR A;  3VYS C;  2Z1U A;  2HS3 A;  2RB9 A;  3FD5 A;  2HS0 A;  3VYT C;  3VYU C;  2HRU A;  3VIU A;  1VQV A;  2HRY A;  2ZAU A;  3FD6 A;  3U0O A;  1VK3 A;  3C9T A;  3P4E A;  5AVM A;  1CLI A;  2Z1F A;  3KIZ A;  2V9Y A;  2YYE A; 
#chains in the Genus database with same CATH topology
 3ELC A;  4G4X A;  3ESJ A;  4O2A A;  1YHQ F;  4ZOL B;  3I7T A;  5IJ9 A;  1W3E X;  5B8F A;  3CB2 A;  5EZY B;  1JFF A;  3V7E A;  3N2G A;  4O4H A;  3VI6 A;  3VOB A;  2KTU A;  3HKD B;  5EYP B;  3JAM M;  1VQV A;  5JH7 A;  3CCJ F;  3HKC B;  4M8I A;  1YGY A;  3JAS A;  1YJN F;  3T80 A;  2MQE A;  3MBM A;  5G4U C;  4TV8 A;  4BVR A;  1PXW A;  5BMV B;  2HP0 A;  1IV3 A;  2HS4 A;  3L7Q A;  2ALE A;  1W41 A;  1KD1 H;  1DT9 A;  2HQS C;  5MN4 A;  1FFX B;  3MCQ A;  5HP7 A;  3CMA F;  3FD5 A;  1VQ9 F;  2AMT A;  2KTV A;  4LNU A;  3KJJ A;  5DCV A;  3IEQ A;  3JAK A;  1VK3 A;  5CA0 B;  3LWQ C;  5AVM A;  4TZZ A;  1UFY A;  2CW4 A;  3I3F A;  3ZP7 A;  2L26 A;  2V9Y A;  5HXZ A;  3Q8H A;  1H48 A;  3LME A;  3UT5 B;  4EI8 A;  5LXT B;  3RYC A;  4U3J A;  4NUT A;  3K12 A;  3FPI A;  5KX5 A;  4I55 A;  1S72 F;  3IKF A;  4I50 A;  2QI2 A;  3C9R A;  1VQ8 F;  1JN1 A;  1FNK A;  3HKB A;  3MCA B;  1YJW F;  2BO1 A;  2CHT A;  5FNV A;  3RA6 A;  3LDT A;  1CN7 A;  3NVI B;  2OTJ F;  1GZ0 A;  1XBI A;  1VQK F;  1U40 A;  3VCZ A;  1SA0 A;  3F6M A;  3LWO C;  4DRX B;  4X1I B;  3JAR B;  4ZHQ A;  1NJI H;  1VQ7 F;  1VQO F;  4O4I A;  3IKE A;  3QHD A;  1XV2 A;  4TUY A;  2VAW A;  1JD1 A;  2Z1T A;  5GAP K;  2QA4 F;  4BT2 A;  5CA1 B;  3N2K B;  1W59 A;  1VQ4 F;  3E20 B;  4B5C A;  5HP8 A;  3U0O A;  4BW0 B;  3D00 A;  1W40 A;  3O85 A;  3WGN A;  4ZHY B;  3CME F;  3V7Q A;  1ONI A;  2UYP A;  4O4J A;  1VH8 A;  3JAW A;  1X7O A;  2KG4 A;  2ZOV A;  5EIB C;  5JQG A;  4C8E A;  1YQN A;  4IIJ A;  3I56 F;  2Z01 A;  1RA4 A;  3RA5 A;  3CC7 F;  5A2Q M;  3HKE A;  3KJK A;  3IMP A;  3S06 A;  3WJQ A;  3CC4 F;  4O4L A;  2OZB A;  3JAT A;  5EAZ A;  2HRU A;  2NMU A;  1Q82 H;  3P4E A;  3K0T A;  4WBN A;  3WPX A;  1RLU A;  5HY1 A;  4ZHV A;  4BT7 A;  2RHL A;  1VQM F;  4IHJ A;  1Q81 H;  3PAF A;  5HWE A;  4U39 A;  5KMG A;  1K73 H;  5GAN K;  3M84 A;  4BVQ A;  1YJ9 F;  3NVK E;  2IG8 A;  2DYY A;  2OTM A;  1KNJ A;  1W2B F;  3E1Y A;  2QEX F;  4X20 B;  3WPW A;  2WAL A;  5EIB D;  4HNA A;  4C82 A;  4BT5 A;  2H8E A;  2CWJ A;  2GVI A;  2ZVZ A;  5CB4 B;  3F0E A;  5LP6 A;  5HY2 A;  5ITZ B;  2EWC A;  3RYF B;  4F6R B;  3K2X A;  3JAL A;  1X52 A;  1Z5W A;  3OBY A;  4LCK A;  4NQ3 A;  3CXC F;  1TVK A;  3S0H A;  5LOV B;  1U3L A;  5HY4 A;  3F0G A;  3VTI C;  5GON A;  1SDS A;  2YXZ A;  3RYI B;  3K14 A;  3IR9 A;  4TV9 A;  1IV4 A;  4C8I A;  4C81 A;  1W55 A;  2LBX A;  2H8C A;  3CC2 F;  3WGM A;  3NK7 A;  4RHA A;  5LA6 B;  2RHH A;  3CYQ A;  2CSL A;  5GIP C;  1K9M H;  2W8B C;  3N4Y A;  2RHO A;  3E22 B;  4ZOL A;  1X7P A;  2G9I A;  1UI9 A;  5EZY A;  1U3P A;  3PLA C;  3HKD A;  5EYP A;  4O2B B;  3KHN A;  3BYQ A;  4FFB B;  1YIT F;  4NWO B;  3HKC A;  4X1Y B;  4EI7 A;  5J2U B;  5BMV A;  3D01 A;  2Z1F A;  1PF5 A;  2HP3 A;  1IV1 A;  3EOR A;  5J2T B;  1FFX A;  1W5B A;  2VXY A;  3NK6 A;  3C9U A;  3ON1 A;  4BT3 A;  4EB6 B;  1OAP A;  5IJ0 B;  3SIV A;  2ZF8 A;  1VQN F;  1Q86 H;  5CA0 A;  5IYZ B;  3CCU F;  4ZI7 B;  2BTU A;  4YJ2 B;  5LYJ B;  3VYU C;  3LWR C;  4X1K B;  1IPA A;  4ZHW A;  2HRY A;  3UT5 A;  3WGK A;  1NQ3 A;  5LXT A;  2UYN B;  5JCO C;  2QTP A;  3VMF B;  3CCS F;  5JVD B;  3TD5 A;  1TUB B;  4B62 A;  3NMU C;  4YJ3 A;  4RQO A;  3OW2 F;  3RYH B;  3F0F A;  1XHO A;  3C9S A;  1W5A A;  4IHJ B;  2I6D A;  3WXM B;  3WGJ A;  1QU9 A;  4R40 B;  3N4Z A;  4I4T A;  3LFO A;  2Q1Y A;  3M1X A;  1Q8R A;  2Z1U A;  4O2A B;  1E7K A;  2IQQ A;  5IJ9 B;  3CG6 A;  2CZW A;  2KGW A;  4BT4 A;  5GIO C;  1JFF B;  4DRX A;  4X1I A;  3JAR A;  3CYP B;  4ZK7 A;  3N2G B;  4O4H B;  2R6R 1;  1SZQ A;  2UYJ A;  3GTZ A;  1M1K H;  2F9Z C;  4BY9 D;  1VQL F;  3WGL A;  3WJP A;  5JH7 B;  1M90 H;  1OFU A;  5HXU A;  3V4D A;  1GO0 A;  5CA1 A;  3N2K A;  3JAS B;  3LYB A;  3MDO A;  3QUW A;  3CCL F;  1KQS F;  1W58 1;  3ZO8 A;  1RLG A;  4TV8 B;  3LWP C;  2LCA A;  3FBA A;  3VYS C;  2CVL A;  2HP0 B;  2DT4 A;  1FNJ A;  1H47 A;  3ZP4 A;  2RHJ A;  4X3M A;  3P10 A;  1DBF A;  2OHW A;  3KIZ A;  3VO8 A;  1X25 A;  2UYK A;  5FLX M;  2YYE A;  3TD4 A;  4LNU B;  3JAK B;  1GO1 A;  3ZOP A;  3HWU A;  3QTY A;  4BVS A;  3FFM A;  3RE3 A;  2I6R A;  3F0D A;  5C8Y A;  1IV2 A;  3RYC B;  2HS0 A;  3J7A R;  3CPW F;  1JJ2 F;  2ZVY A;  4U3J B;  1FSZ A;  2R75 1;  3JVH A;  1YI2 F;  1JY8 A;  5KX5 B;  4I55 B;  3VOA A;  3C9T A;  4I50 B;  3J81 M;  2VGM A;  2K1S A;  3HJW C;  1QVG F;  1VHA A;  4X20 A;  3HKB B;  1QAH A;  4BVT A;  5FNV B;  3CCQ F;  3R0P A;  2AIF A;  2UZH A;  5CB4 A;  1KNK A;  1SA0 B;  4G4Y A;  3OON A;  5ITZ A;  2PHN A;  4ZHQ B;  3RYF A;  3CD6 F;  4F6R A;  1ODE A;  1ZWZ A;  4O4I B;  2Q1X A;  1R1M A;  4B46 A;  4BT6 A;  5MN5 A;  2JNB A;  2VAP A;  3OBW A;  2FGY A;  4TUY B;  5LOV A;  3CCE F;  1QVF F;  1RQ2 A;  3JCM M;  5EB0 A;  3J80 M;  1CLI A;  1VQ5 F;  3S02 A;  4E6E A;  5FJ4 C;  3RYI A;  1J7H A;  2GZL A;  1W42 A;  4ERH A;  3S0W A;  2CHS A;  4EI9 A;  1CK2 A;  4X3L A;  1W5F A;  2FC3 A;  3D54 A;  3HAX D;  3S03 A;  2HX0 A;  2P6Y A;  5LA6 A;  3DDN A;  4O4J B;  2ZOD A;  3JAW B;  4XCQ A;  4YJ3 B;  5EB1 B;  2N48 A;  3E22 A;  5EWR A;  5JQG B;  3DC2 A;  2VGN A;  4IIJ B;  3VYT C;  2AIZ P;  3B6N A;  3ERN A;  4I4T B;  3HKE B;  5GIN C;  3CCV F;  3V3T A;  4O4L B;  1K8A H;  4C4W C;  4O2B A;  3CPQ A;  3CCM F;  3JAT B;  2B33 A;  4FFB A;  4PWT A;  3AGK A;  2IAF A;  3I55 F;  2H6L A;  3KE1 A;  4WBN B;  4KWE A;  4X1Y A;  1Z5V A;  3G4S F;  4G88 A;  5G4V C;  3LWV C;  5J2U A;  3IEW A;  4DXD A;  2LBW A;  5KMG B;  1QD9 A;  3C8L A;  3M4S A;  2RB9 A;  2BTO A;  3VIU A;  3G71 F;  3CCR F;  3FD6 A;  1N8R H;  5J2T A;  4HNA B;  1W5E A;  2GLZ A;  1NMU B;  4G4Z A;  5EO3 A;  4EB6 A;  1KC8 H;  5IT9 M;  1T0K B;  5IJ0 A;  1GX1 A;  1XRG A;  5IYZ A;  4ZI7 A;  2LBT A;  5LYJ A;  4YJ2 A;  4C8G A;  5LP6 B;  2Z1E A;  2VAM A;  4X1K A;  5LP6 C;  4G4V A;  3JAL B;  3P0Z A;  5JCO A;  2HVY D;  1H7M A;  1TVK B;  2UYN A;  3WJR A;  2HS3 A;  3GHZ A;  1T0A A;  2PMP A;  1RQ7 A;  3HTN A;  5JVD A;  5GON B;  1TUB A;  5MN6 A;  3SIU A;  4G4W A;  1Q7Y H;  2ZAU A;  3GYQ A;  1YIJ F;  3MQW A;  3G6E F;  1U43 A;  4TV9 B;  5C8Y B;  1COM A;  4B45 A;  2OTL F;  3TD3 A;  1W57 A;  3RYH A;  2BTQ B;  1VQ6 F;  5HY0 A;  1VQP F;  3S0Y A; 
#chains in the Genus database with same CATH homology
 3WJP A;  3M84 A;  2Z1E A;  3C9U A;  3D54 A;  3QTY A;  2HS4 A;  3VTI C;  3C9S A;  3MDO A;  2Z01 A;  2YXZ A;  2ZOD A;  2I6R A;  3WJQ A;  2BTU A;  2Z1T A;  3C9R A;  3MCQ A;  3WJR A;  3VYS C;  2Z1U A;  2HS3 A;  2RB9 A;  3FD5 A;  2HS0 A;  3VYT C;  3VYU C;  2HRU A;  3VIU A;  1VQV A;  2HRY A;  2ZAU A;  3FD6 A;  3U0O A;  1VK3 A;  3C9T A;  3P4E A;  5AVM A;  1CLI A;  2Z1F A;  3KIZ A;  2V9Y A;  2YYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...