2BTUA

Crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
329
structure length
322
Chain Sequence
EAGYEAVSRMKKHVQTTMRKEVLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
publication title Crystal Structure of Phosphoribosylformylglycinamidine Cyclo-Ligase from Bacillus Anthracis at 2.3A Resolution.
rcsb
source organism Bacillus anthracis
molecule tags Synthase
total genus 77
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2btuA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2btuA02
1CLIA 3MDOA 3VYUC 3M84A 3C9RA 2YXZA 2Z01A 3P4EA 2Z1FA 3WJQA 2Z1UA 2HS3A 3C9TA 3C9SA 3VYTC 3U0OA 2Z1EA 2ZAUA 3D54A 3VYSC 2RB9A 2BTUA 2YYEA 2V9YA 1VK3A 3MCQA 3VTIC 2I6RA 2HRYA 2HS4A 3QTYA 5AVMA 2HRUA 3KIZA 3FD5A 2ZODA 2Z1TA 3C9UA 3WJRA 2HS0A 1VQVA 3WJPA 3FD6A 3VIUA
chains in the Genus database with same CATH superfamily
5MN4A 3D00A 4X20B 3WGNA 4BY9D 2CWJA 1H47A 2MQEA 5HY2A 1VQ8F 4YJ2A 5IYZB 3V7QA 3LYBA 1YIJF 1XRGA 1GO1A 3D54A 4X1IA 3G71F 4C8EA 3HWUA 5KMGA 5EB1B 5CB4A 4C81A 1RQ2A 1RLUA 3F0GA 5FJ4C 5JQGB 3N2GB 5LA6A 1YITF 3VTIC 3JAWB 3P10A 3RE3A 5IJ9B 3S03A 5MN6A 5EYPB 5LXTB 1YJWF 3CB2A 1KNKA 2AMTA 3ZP4A 1NMUB 1YHQF 5GAPK 3O85A 2RHOA 3F0DA 2R6R1 4M8IA 3CCEF 3CC4F 4TV9A 2I6DA 5KX5B 1W55A 1W5BA 5FNVB 3AGKA 3JAKA 1VQOF 4RQOA 1OAPA 4FFBB 2ALEA 5GIPC 5LYJA 3NVKE 3RYIA 2OHWA 3VIUA 2UYNA 4X1KA 3TD3A 4YJ2B 1X25A 1YGYA 5MN5A 3VOBA 3NK7A 3C9TA 3LDTA 1VQPF 1JN1A 2IAFA 4X1IB 2BTUA 5KMGB 5CB4B 4C8GA 2F9ZC 3IKEA 4RHAA 1VQKF 2DYYA 5BMVA 2HRUA 3LMEA 5CA1A 3FFMA 2HP0A 3C9UA 1H7MA 1TUBA 5LA6B 1DBFA 3UT5A 3WJRA 5J2UA 3CMEF 1VQLF 3P0ZA 2HVYD 3MDOA 2VAPA 1XV2A 3MBMA 3KHNA 4B46A 1VQ9F 5A2QM 3J80M 2B33A 2KG4A 1S72F 2Q1YA 4TV9B 1KC8H 1VH8A 3CCRF 2EWCA 3JAKB 3WXMB 1VQMF 1QVFF 5AVMA 5HP7A 1YJ9F 3JCMM 5LYJB 4XCQA 4YJ3A 3RYIB 4DXDA 3FD6A 3M4SA 2K1SA 2UYNB 4X1KB 3S0HA 1X7PA 3L7QA 5IJ9A 4LNUA 4BVRA 1UFYA 4KWEA 3CCQF 1TVKA 5CA0A 1YI2F 1YQNA 5HY0A 3KE1A 1NJIH 5LOVA 4X1YA 4G88A 3VYSC 3DDNA 3WGJA 2H8CA 2UYKA 3JASA 4BW0B 2OTJF 3JARA 3F0EA 3LWOC 2QA4F 5JVDA 3ESJA 5BMVB 5CA1B 2HP0B 1Q81H 5J2UB 1TUBB 2QTPA 4ZHWA 3VCZA 4G4WA 5GANK 3CC7F 1QD9A 2CZWA 3IMPA 1IV1A 3V7EA 2GVIA 3EORA 3CD6F 3IR9A 1PXWA 3VYTC 1Q86H 4ZOLA 5JCOA 2LBXA 2KTVA 1VK3A 4WBNA 4TV8A 5LP6C 3SIUA 2ZODA 4NUTA 4B45A 2G9IA 3OBWA 4YJ3B 5B8FA 4EB6A 3WJPA 3LWQC 3E22A 2RHLA 5ITZA 1W581 3C9RA 4O4IA 2ZF8A 4C8IA 4LNUB 3ZO8A 1TVKB 4I4TA 5CA0B 3RYHA 1XHOA 2N48A 3K12A 3J81M 4I55A 1X52A 1X7OA 1W5FA 5LOVB 1RA4A 4X1YB 4O4HB 2VXYA 3JASB 5EAZA 3CMAF 4ZHYB 1Q8RA 1JY8A 3F6MA 1PF5A 3JARB 1E7KA 5JVDB 3MQWA 2UYJA 3HKBA 3OBYA 2HS0A 2UZHA 2VGNA 3KJKA 2LBWA 1N8RH 1KD1H 3WJQA 3HAXD 3QHDA 3PAFA 3R0PA 3RA5A 5JH7A 5G4VC 3N4ZA 3HKEA 1FNJA 2ZOVA 1QVGF 4ZHQB 4ZOLB 3GHZA 4ZI7A 5J2TA 5GINC 1W2BF 5HXUA 4WBNB 2I6RA 4IHJA 4R40B 4TV8B 2LBTA 2WALA 4BT6A 1KQSF 1T0AA 3RYCB 1RLGA 4EB6B 1GO0A 3E22B 3VYUC 5ITZB 3C8LA 3CG6A 2YXZA 4O4IB 5EZYA 1U3LA 5C8YA 4I4TB 5IT9M 1JFFA 3RYHB 3CYQA 1JJ2F 3MCAB 4C82A 4I55B 2KGWA 3VI6A 5HP8A 3LWPC 2LCAA 4BT5A 3CCMF 2HQSC 4U39A 1W42A 3MCQA 4IIJA 3FPIA 3HKBB 2AIZP 1YJNF 3FBAA 3S06A 2IG8A 1W3EX 4BT4A 3J7AR 1H48A 3K2XA 3G6EF 1ONIA 3M84A 3ZP7A 3Q8HA 2PMPA 1T0KB 3HKCA 1VQ6F 1VHAA 5JH7B 3HKEB 2HS3A 4F6RA 4G4VA 2FC3A 3CC2F 2Z1EA 4ZI7B 5J2TB 1U3PA 5GONB 3I3FA 3DC2A 4O4HA 2HX0A 5EO3A 1W57A 4IHJB 2HRYA 5EWRA 3I55F 4EI7A 3IEWA 4ZHVA 3VMFB 5EZYB 3P4EA 5C8YB 2Z1FA 3N2KA 1JFFB 5LP6A 1SZQA 1VQ4F 2HP3A 2BTQB 4ZHQA 3F0FA 4O4LA 1J7HA 4X3LA 1GX1A 3CCLF 3CYPB 4HNAA 5IJ0A 3GTZA 4IIJB 3NK6A 1ZWZA 1M1KH 1W5AA 2AIFA 2BTOA 2NMUA 2W8BC 4ERHA 4I50A 3CCUF 1COMA 3E1YA 3RYCA 1CLIA 1VQ5F 4BVQA 3CCJF 3HKCB 2DT4A 3V4DA 5HXZA 1GZ0A 1Z5VA 5EIBC 5HY1A 3E20B 4B62A 2OTMA 2RHHA 2CSLA 2QI2A 4F6RB 1R1MA 2CVLA 5EB0A 5GIOC 3SIVA 3NVIB 3KJJA 3IEQA 3M1XA 3ELCA 5HY4A 2VAWA 1UI9A 1VQNF 1K9MH 3V3TA 5HWEA 2YYEA 2ZVZA 4U3JA 3CCSF 4DRXA 3S0YA 1VQVA 2CHSA 2PHNA 3OW2F 2UYPA 2R751 2CHTA 3JVHA 4NWOB 4PWTA 1FFXA 5JCOC 1W59A 2Z01A 3HTNA 3N2KB 4G4XA 4O2AA 3ERNA 5LP6B 3LWRC 3LWVC 3I7TA 2Z1UA 2L26A 1Q82H 1IV4A 4BVTA 1QAHA 3WPWA 4B5CA 4BT7A 3C9SA 4O4LB 4TUYA 3U0OA 2FGYA 3JATA 5GONA 4HNAB 5IJ0B 2KTUA 4NQ3A 2V9YA 1IPAA 1Z5WA 4LCKA 2Q1XA 3WGMA 4ZK7A 1Q7YH 1SA0A 1W41A 2Z1TA 4I50B 4EI9A 1RQ7A 3CPQA 3IKFA 3WGLA 3T80A 2H6LA 3TD4A 3NMUC 3GYQA 2GLZA 3PLAC 3CPWF 2RHJA 4X3MA 3TD5A 3CCVF 3BYQA 3RYFA 3JALA 1K8AH 2VGMA 2CW4A 4BT2A 2RB9A 4G4YA 1KNJA 3CXCF 2P6YA 3LFOA 3ON1A 4U3JB 4O2BA 4DRXB 3HJWC 3S02A 3FD5A 4O4JA 3HKDA 3RA6A 1M90H 2QEXF 3G4SF 3VOAA 1FFXB 1QU9A 3K0TA 3N4YA 4X20A 4E6EA 4O2AB 1W40A 3WGKA 5FLXM 1DT9A 1JD1A 1OFUA 2VAMA 5EIBD 5DCVA 5IYZA 1U43A 3WPXA 4C4WC 4TUYB 1CN7A 3JATB 2GZLA 2IQQA 1IV2A 3S0WA 3ZOPA 2HS4A 4G4ZA 2BO1A 5JQGA 3VO8A 1SA0B 3N2GA 3I56F 3OONA 3JAMM 2OTLF 1CK2A 2OZBA 1ODEA 3JAWA 2ZVYA 1W5EA 4EI8A 5EYPA 5LXTA 1SDSA 1FSZA 1XBIA 4TZZA 5G4UC 3RYFB 3JALB 1U40A 3B6NA 3QUWA 2ZAUA 5KX5A 3K14A 1VQ7F 5FNVA 3QTYA 1K73H 4BVSA 4O2BB 4FFBA 3KIZA 3UT5B 4O4JB 2H8EA 3HKDB 1FNKA 3D01A 1NQ3A 4BT3A 2JNBA 1IV3A
chains in the Genus database with same CATH topology
1CLIA 3MDOA 3VYUC 3M84A 3C9RA 2YXZA 2Z01A 3P4EA 2Z1FA 3WJQA 2Z1UA 2HS3A 3C9TA 3C9SA 3VYTC 3U0OA 2Z1EA 2ZAUA 3D54A 3VYSC 2RB9A 2BTUA 2YYEA 2V9YA 1VK3A 3MCQA 3VTIC 2I6RA 2HRYA 2HS4A 3QTYA 5AVMA 2HRUA 3KIZA 3FD5A 2ZODA 2Z1TA 3C9UA 3WJRA 2HS0A 1VQVA 3WJPA 3FD6A 3VIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLI A;  3MDO A;  3VYU C;  3M84 A;  3C9R A;  2YXZ A;  2Z01 A;  3P4E A;  2Z1F A;  3WJQ A;  2Z1U A;  2HS3 A;  3C9T A;  3C9S A;  3VYT C;  3U0O A;  2Z1E A;  2ZAU A;  3D54 A;  3VYS C;  2RB9 A;  2BTU A;  2YYE A;  2V9Y A;  1VK3 A;  3MCQ A;  3VTI C;  2I6R A;  2HRY A;  2HS4 A;  3QTY A;  5AVM A;  2HRU A;  3KIZ A;  3FD5 A;  2ZOD A;  2Z1T A;  3C9U A;  3WJR A;  2HS0 A;  1VQV A;  3WJP A;  3FD6 A;  3VIU A; 
#chains in the Genus database with same CATH topology
 5MN4 A;  3D00 A;  4X20 B;  3WGN A;  4BY9 D;  2CWJ A;  1H47 A;  2MQE A;  5HY2 A;  1VQ8 F;  4YJ2 A;  5IYZ B;  3V7Q A;  3LYB A;  1YIJ F;  1XRG A;  1GO1 A;  3D54 A;  4X1I A;  3G71 F;  4C8E A;  3HWU A;  5KMG A;  5EB1 B;  5CB4 A;  4C81 A;  1RQ2 A;  1RLU A;  3F0G A;  5FJ4 C;  5JQG B;  3N2G B;  5LA6 A;  1YIT F;  3VTI C;  3JAW B;  3P10 A;  3RE3 A;  5IJ9 B;  3S03 A;  5MN6 A;  5EYP B;  5LXT B;  1YJW F;  3CB2 A;  1KNK A;  2AMT A;  3ZP4 A;  1NMU B;  1YHQ F;  5GAP K;  3O85 A;  2RHO A;  3F0D A;  2R6R 1;  4M8I A;  3CCE F;  3CC4 F;  4TV9 A;  2I6D A;  5KX5 B;  1W55 A;  1W5B A;  5FNV B;  3AGK A;  3JAK A;  1VQO F;  4RQO A;  1OAP A;  4FFB B;  2ALE A;  5GIP C;  5LYJ A;  3NVK E;  3RYI A;  2OHW A;  3VIU A;  2UYN A;  4X1K A;  3TD3 A;  4YJ2 B;  1X25 A;  1YGY A;  5MN5 A;  3VOB A;  3NK7 A;  3C9T A;  3LDT A;  1VQP F;  1JN1 A;  2IAF A;  4X1I B;  2BTU A;  5KMG B;  5CB4 B;  4C8G A;  2F9Z C;  3IKE A;  4RHA A;  1VQK F;  2DYY A;  5BMV A;  2HRU A;  3LME A;  5CA1 A;  3FFM A;  2HP0 A;  3C9U A;  1H7M A;  1TUB A;  5LA6 B;  1DBF A;  3UT5 A;  3WJR A;  5J2U A;  3CME F;  1VQL F;  3P0Z A;  2HVY D;  3MDO A;  2VAP A;  1XV2 A;  3MBM A;  3KHN A;  4B46 A;  1VQ9 F;  5A2Q M;  3J80 M;  2B33 A;  2KG4 A;  1S72 F;  2Q1Y A;  4TV9 B;  1KC8 H;  1VH8 A;  3CCR F;  2EWC A;  3JAK B;  3WXM B;  1VQM F;  1QVF F;  5AVM A;  5HP7 A;  1YJ9 F;  3JCM M;  5LYJ B;  4XCQ A;  4YJ3 A;  3RYI B;  4DXD A;  3FD6 A;  3M4S A;  2K1S A;  2UYN B;  4X1K B;  3S0H A;  1X7P A;  3L7Q A;  5IJ9 A;  4LNU A;  4BVR A;  1UFY A;  4KWE A;  3CCQ F;  1TVK A;  5CA0 A;  1YI2 F;  1YQN A;  5HY0 A;  3KE1 A;  1NJI H;  5LOV A;  4X1Y A;  4G88 A;  3VYS C;  3DDN A;  3WGJ A;  2H8C A;  2UYK A;  3JAS A;  4BW0 B;  2OTJ F;  3JAR A;  3F0E A;  3LWO C;  2QA4 F;  5JVD A;  3ESJ A;  5BMV B;  5CA1 B;  2HP0 B;  1Q81 H;  5J2U B;  1TUB B;  2QTP A;  4ZHW A;  3VCZ A;  4G4W A;  5GAN K;  3CC7 F;  1QD9 A;  2CZW A;  3IMP A;  1IV1 A;  3V7E A;  2GVI A;  3EOR A;  3CD6 F;  3IR9 A;  1PXW A;  3VYT C;  1Q86 H;  4ZOL A;  5JCO A;  2LBX A;  2KTV A;  1VK3 A;  4WBN A;  4TV8 A;  5LP6 C;  3SIU A;  2ZOD A;  4NUT A;  4B45 A;  2G9I A;  3OBW A;  4YJ3 B;  5B8F A;  4EB6 A;  3WJP A;  3LWQ C;  3E22 A;  2RHL A;  5ITZ A;  1W58 1;  3C9R A;  4O4I A;  2ZF8 A;  4C8I A;  4LNU B;  3ZO8 A;  1TVK B;  4I4T A;  5CA0 B;  3RYH A;  1XHO A;  2N48 A;  3K12 A;  3J81 M;  4I55 A;  1X52 A;  1X7O A;  1W5F A;  5LOV B;  1RA4 A;  4X1Y B;  4O4H B;  2VXY A;  3JAS B;  5EAZ A;  3CMA F;  4ZHY B;  1Q8R A;  1JY8 A;  3F6M A;  1PF5 A;  3JAR B;  1E7K A;  5JVD B;  3MQW A;  2UYJ A;  3HKB A;  3OBY A;  2HS0 A;  2UZH A;  2VGN A;  3KJK A;  2LBW A;  1N8R H;  1KD1 H;  3WJQ A;  3HAX D;  3QHD A;  3PAF A;  3R0P A;  3RA5 A;  5JH7 A;  5G4V C;  3N4Z A;  3HKE A;  1FNJ A;  2ZOV A;  1QVG F;  4ZHQ B;  4ZOL B;  3GHZ A;  4ZI7 A;  5J2T A;  5GIN C;  1W2B F;  5HXU A;  4WBN B;  2I6R A;  4IHJ A;  4R40 B;  4TV8 B;  2LBT A;  2WAL A;  4BT6 A;  1KQS F;  1T0A A;  3RYC B;  1RLG A;  4EB6 B;  1GO0 A;  3E22 B;  3VYU C;  5ITZ B;  3C8L A;  3CG6 A;  2YXZ A;  4O4I B;  5EZY A;  1U3L A;  5C8Y A;  4I4T B;  5IT9 M;  1JFF A;  3RYH B;  3CYQ A;  1JJ2 F;  3MCA B;  4C82 A;  4I55 B;  2KGW A;  3VI6 A;  5HP8 A;  3LWP C;  2LCA A;  4BT5 A;  3CCM F;  2HQS C;  4U39 A;  1W42 A;  3MCQ A;  4IIJ A;  3FPI A;  3HKB B;  2AIZ P;  1YJN F;  3FBA A;  3S06 A;  2IG8 A;  1W3E X;  4BT4 A;  3J7A R;  1H48 A;  3K2X A;  3G6E F;  1ONI A;  3M84 A;  3ZP7 A;  3Q8H A;  2PMP A;  1T0K B;  3HKC A;  1VQ6 F;  1VHA A;  5JH7 B;  3HKE B;  2HS3 A;  4F6R A;  4G4V A;  2FC3 A;  3CC2 F;  2Z1E A;  4ZI7 B;  5J2T B;  1U3P A;  5GON B;  3I3F A;  3DC2 A;  4O4H A;  2HX0 A;  5EO3 A;  1W57 A;  4IHJ B;  2HRY A;  5EWR A;  3I55 F;  4EI7 A;  3IEW A;  4ZHV A;  3VMF B;  5EZY B;  3P4E A;  5C8Y B;  2Z1F A;  3N2K A;  1JFF B;  5LP6 A;  1SZQ A;  1VQ4 F;  2HP3 A;  2BTQ B;  4ZHQ A;  3F0F A;  4O4L A;  1J7H A;  4X3L A;  1GX1 A;  3CCL F;  3CYP B;  4HNA A;  5IJ0 A;  3GTZ A;  4IIJ B;  3NK6 A;  1ZWZ A;  1M1K H;  1W5A A;  2AIF A;  2BTO A;  2NMU A;  2W8B C;  4ERH A;  4I50 A;  3CCU F;  1COM A;  3E1Y A;  3RYC A;  1CLI A;  1VQ5 F;  4BVQ A;  3CCJ F;  3HKC B;  2DT4 A;  3V4D A;  5HXZ A;  1GZ0 A;  1Z5V A;  5EIB C;  5HY1 A;  3E20 B;  4B62 A;  2OTM A;  2RHH A;  2CSL A;  2QI2 A;  4F6R B;  1R1M A;  2CVL A;  5EB0 A;  5GIO C;  3SIV A;  3NVI B;  3KJJ A;  3IEQ A;  3M1X A;  3ELC A;  5HY4 A;  2VAW A;  1UI9 A;  1VQN F;  1K9M H;  3V3T A;  5HWE A;  2YYE A;  2ZVZ A;  4U3J A;  3CCS F;  4DRX A;  3S0Y A;  1VQV A;  2CHS A;  2PHN A;  3OW2 F;  2UYP A;  2R75 1;  2CHT A;  3JVH A;  4NWO B;  4PWT A;  1FFX A;  5JCO C;  1W59 A;  2Z01 A;  3HTN A;  3N2K B;  4G4X A;  4O2A A;  3ERN A;  5LP6 B;  3LWR C;  3LWV C;  3I7T A;  2Z1U A;  2L26 A;  1Q82 H;  1IV4 A;  4BVT A;  1QAH A;  3WPW A;  4B5C A;  4BT7 A;  3C9S A;  4O4L B;  4TUY A;  3U0O A;  2FGY A;  3JAT A;  5GON A;  4HNA B;  5IJ0 B;  2KTU A;  4NQ3 A;  2V9Y A;  1IPA A;  1Z5W A;  4LCK A;  2Q1X A;  3WGM A;  4ZK7 A;  1Q7Y H;  1SA0 A;  1W41 A;  2Z1T A;  4I50 B;  4EI9 A;  1RQ7 A;  3CPQ A;  3IKF A;  3WGL A;  3T80 A;  2H6L A;  3TD4 A;  3NMU C;  3GYQ A;  2GLZ A;  3PLA C;  3CPW F;  2RHJ A;  4X3M A;  3TD5 A;  3CCV F;  3BYQ A;  3RYF A;  3JAL A;  1K8A H;  2VGM A;  2CW4 A;  4BT2 A;  2RB9 A;  4G4Y A;  1KNJ A;  3CXC F;  2P6Y A;  3LFO A;  3ON1 A;  4U3J B;  4O2B A;  4DRX B;  3HJW C;  3S02 A;  3FD5 A;  4O4J A;  3HKD A;  3RA6 A;  1M90 H;  2QEX F;  3G4S F;  3VOA A;  1FFX B;  1QU9 A;  3K0T A;  3N4Y A;  4X20 A;  4E6E A;  4O2A B;  1W40 A;  3WGK A;  5FLX M;  1DT9 A;  1JD1 A;  1OFU A;  2VAM A;  5EIB D;  5DCV A;  5IYZ A;  1U43 A;  3WPX A;  4C4W C;  4TUY B;  1CN7 A;  3JAT B;  2GZL A;  2IQQ A;  1IV2 A;  3S0W A;  3ZOP A;  2HS4 A;  4G4Z A;  2BO1 A;  5JQG A;  3VO8 A;  1SA0 B;  3N2G A;  3I56 F;  3OON A;  3JAM M;  2OTL F;  1CK2 A;  2OZB A;  1ODE A;  3JAW A;  2ZVY A;  1W5E A;  4EI8 A;  5EYP A;  5LXT A;  1SDS A;  1FSZ A;  1XBI A;  4TZZ A;  5G4U C;  3RYF B;  3JAL B;  1U40 A;  3B6N A;  3QUW A;  2ZAU A;  5KX5 A;  3K14 A;  1VQ7 F;  5FNV A;  3QTY A;  1K73 H;  4BVS A;  4O2B B;  4FFB A;  3KIZ A;  3UT5 B;  4O4J B;  2H8E A;  3HKD B;  1FNK A;  3D01 A;  1NQ3 A;  4BT3 A;  2JNB A;  1IV3 A; 
#chains in the Genus database with same CATH homology
 1CLI A;  3MDO A;  3VYU C;  3M84 A;  3C9R A;  2YXZ A;  2Z01 A;  3P4E A;  2Z1F A;  3WJQ A;  2Z1U A;  2HS3 A;  3C9T A;  3C9S A;  3VYT C;  3U0O A;  2Z1E A;  2ZAU A;  3D54 A;  3VYS C;  2RB9 A;  2BTU A;  2YYE A;  2V9Y A;  1VK3 A;  3MCQ A;  3VTI C;  2I6R A;  2HRY A;  2HS4 A;  3QTY A;  5AVM A;  2HRU A;  3KIZ A;  3FD5 A;  2ZOD A;  2Z1T A;  3C9U A;  3WJR A;  2HS0 A;  1VQV A;  3WJP A;  3FD6 A;  3VIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...