2BTUA

Crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
329
structure length
322
Chain Sequence
EAGYEAVSRMKKHVQTTMRKEVLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
publication title Crystal Structure of Phosphoribosylformylglycinamidine Cyclo-Ligase from Bacillus Anthracis at 2.3A Resolution.
rcsb
source organism Bacillus anthracis
molecule tags Synthase
total genus 77
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2btuA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2btuA02
2ZAUA 3C9UA 1VQVA 2V9YA 2YYEA 3VYTC 1VK3A 3FD5A 2HS3A 3KIZA 2RB9A 2I6RA 3M84A 5AVMA 3C9RA 3QTYA 2Z1EA 2HS0A 3MCQA 3WJPA 2HS4A 3C9SA 1CLIA 3WJQA 2BTUA 2YXZA 3VYUC 2HRYA 3P4EA 3VIUA 3WJRA 2ZODA 3U0OA 2Z1FA 3VYSC 3MDOA 3D54A 2HRUA 3VTIC 2Z01A 2Z1UA 3FD6A 3C9TA 2Z1TA
chains in the Genus database with same CATH superfamily
2YYEA 3VCZA 4G4WA 3CPWF 4BY9D 3OW2F 3RA6A 3ZO8A 2JNBA 5EYPB 3LFOA 1YGYA 3K2XA 1XRGA 4ZHYB 5C8YB 2CSLA 5J2TB 3V7QA 3VI6A 1W5FA 1DBFA 2DT4A 5FLXM 4E6EA 4BVQA 4IHJA 5CB4B 5GONB 1W55A 3N4YA 2OHWA 3G6EF 2G9IA 5KX5B 3RYCA 3M84A 5LA6B 5MN4A 2VAWA 4O4JB 2P6YA 1QAHA 5LOVA 5HWEA 1FNJA 5IYZB 3WJPA 3N2GB 4XCQA 4B46A 1YQNA 4NWOB 1QVFF 3I3FA 1VQ6F 4LNUB 2RHJA 3HKBA 4G4VA 1X52A 5MN5A 3CCSF 3PLAC 2N48A 3CCMF 5HY4A 3KE1A 5EB0A 3WPXA 5LYJB 5BMVB 1ZWZA 3JASB 4X1IA 1Q7YH 2BO1A 1FSZA 4BT3A 3MCAB 4DXDA 3S0YA 3ESJA 4O2AA 3ERNA 4WBNA 2GLZA 5JQGA 4B62A 4X1KA 3ON1A 1J7HA 4F6RB 4PWTA 2CWJA 5LP6C 1OFUA 2YXZA 3WXMB 1W42A 4BT5A 3P4EA 3HWUA 3CMEF 3E20B 3WGLA 1VQ7F 5HP7A 5EWRA 4C4WC 1U3PA 3JARA 2VGMA 3WGNA 3VYTC 1KC8H 3HTNA 2RB9A 3IEWA 1S72F 2AMTA 4ZHQB 3SIUA 1XBIA 4BT7A 4BW0B 1PXWA 1VQMF 2CW4A 4IIJA 1K8AH 1RQ7A 3R0PA 3CCUF 1QD9A 5CA0A 2B33A 4R40B 3ZP4A 2LBWA 4C81A 1VQNF 3ZOPA 3JVHA 3CC2F 1KD1H 2RHLA 3G71F 5EAZA 1K73H 2VAPA 4FFBA 3AGKA 2OZBA 5GINC 2H8CA 3C8LA 1KNJA 5HY0A 3KIZA 3CXCF 4BT6A 3EORA 3CYQA 3F0GA 3V3TA 3J7AR 2Z1EA 1FFXA 3D01A 2VXYA 5IJ0B 3HKDA 3K12A 4BVTA 4I50A 3FPIA 3K14A 3OBWA 5FNVA 4C8EA 1FNKA 4TV8A 5EIBC 5HXUA 4C82A 2QI2A 3U0OA 5G4VC 3KJJA 2Q1YA 2Z01A 3M1XA 5EZYA 4IHJB 5HY1A 1W581 3LWPC 3C9UA 4C8GA 1Q81H 3UT5A 3RYFA 1NJIH 3RYCB 4LCKA 1VQKF 5LOVB 4EI7A 3I7TA 3LWRC 2VGNA 2CHTA 1K9MH 3IKEA 3LMEA 3JCMM 2PHNA 2HS4A 4G4XA 4I4TA 1H7MA 4RQOA 2UYPA 3HKBB 3VYUC 3CCVF 3VIUA 1YIJF 3LYBA 2UZHA 3HKEA 4O4IA 3MDOA 1SA0A 2HRUA 4X1YB 1RLUA 2NMUA 2ZAUA 4X1IB 3WGJA 1RQ2A 3VO8A 1QVGF 5AVMA 1ODEA 3CC4F 3QTYA 4O2AB 5MN6A 2ZVYA 4WBNB 3TD3A 4C8IA 3MCQA 4TV9A 4X1KB 5JQGB 3CCJF 2OTJF 2H8EA 1GX1A 1W59A 2MQEA 2UYNA 1CN7A 1W3EX 2HP0A 3I55F 1M1KH 3F6MA 1VQ9F 3GHZA 5CA1A 5JVDA 2HVYD 3JARB 1UI9A 1W40A 3JAWA 1OAPA 1ONIA 3BYQA 4G4YA 5J2UA 1U3LA 1IV2A 3IR9A 4B45A 2FGYA 3NMUC 3V7EA 4IIJB 4TUYA 3CCRF 2LCAA 3KHNA 3P0ZA 3I56F 5CA0B 2HS0A 5GIOC 2L26A 2AIZP 5A2QM 2GVIA 3WJQA 1T0KB 3RYIA 3CG6A 4FFBB 3RE3A 4G88A 3VYSC 2I6DA 4X3MA 5JCOC 4TZZA 1YJ9F 3E22A 1Q86H 4ZOLA 3JATA 1YJNF 1GO1A 1FFXB 3IKFA 3CD6F 4U3JA 1NQ3A 4YJ3A 3HKDB 4I50B 4ZK7A 3LWVC 3E1YA 5FNVB 3N2KA 3HKCA 4TV8B 2BTUA 5HXZA 2QTPA 3NK6A 3CCLF 1YITF 2ZODA 2ZVZA 2HP3A 5EZYB 2R751 1X25A 1XV2A 4X20A 3UT5B 3RYFB 1GZ0A 3CYPB 1TUBA 2V9YA 1W41A 4I55A 3FD5A 3CC7F 5KMGA 1KQSF 4ZHVA 5IJ9A 3G4SF 1DT9A 1QU9A 1JN1A 4I4TB 4EB6A 3FBAA 1CLIA 3QUWA 5LP6A 5GAPK 2IAFA 3NVIB 3HKEB 4O4IB 3SIVA 3K0TA 1VQPF 1SA0B 3F0DA 5LXTA 4BT2A 2K1SA 4ZHWA 1JD1A 2QA4F 3FD6A 2FC3A 4BVRA 3S03A 5ITZA 1T0AA 4YJ2A 1YI2F 2ZOVA 3Q8HA 5B8FA 4X3LA 4TV9B 4ZI7A 2UYNB 1VH8A 2QEXF 3JAKA 3RYHA 2HP0B 1VQ8F 2GZLA 1Z5VA 3O85A 3OBYA 1VQLF 1IPAA 3KJKA 5CA1B 1X7OA 5JVDB 1RLGA 4HNAA 1TVKA 1KNKA 3T80A 2OTMA 3JAWB 5J2UB 1JFFA 5EIBD 4O4HA 3CCQF 1U40A 4O2BA 2LBXA 2PMPA 1IV4A 1M90H 5JH7A 4TUYB 2I6RA 3F0FA 1PF5A 3J81M 2BTOA 1CK2A 2CZWA 4DRXA 2ALEA 3N4ZA 2KTUA 5IJ0A 5DCVA 3J80M 3RYIB 3RA5A 3LWQC 3JALA 4O4LA 3S0WA 1VQOF 2Z1FA 3D00A 1Q8RA 1GO0A 2W8BC 3CMAF 2RHOA 1X7PA 3WGKA 3M4SA 3E22B 1VQVA 4ZOLB 3JATB 2IQQA 3CB2A 2CVLA 3JAMM 3NK7A 2BTQB 4RHAA 4U3JB 2LBTA 3IMPA 4YJ3B 1W57A 4BT4A 4G4ZA 1IV3A 2H6LA 3CPQA 5EYPA 3IEQA 3N2KB 3C9SA 3HKCB 1YJWF 3VOAA 3S02A 3DDNA 1COMA 3GTZA 2EWCA 2HRYA 3WJRA 3HAXD 1W5BA 5C8YA 5J2TA 3PAFA 4X20B 1H48A 2RHHA 4ERHA 1YHQF 3HJWC 2UYKA 1TUBB 4X1YA 3C9TA 4I55B 5KMGB 2ZF8A 3GYQA 2R6R1 1JY8A 5CB4A 3QHDA 5GONA 5IJ9B 5KX5A 4EB6B 5LA6A 1NMUB 2UYJA 4O4JA 5IYZA 1SZQA 5LP6B 2HX0A 3F0EA 3N2GA 3ZP7A 1N8RH 5LXTB 5HY2A 2WALA 1W5EA 4LNUA 4EI9A 3S06A 3VTIC 1JJ2F 2Z1UA 2F9ZC 1H47A 2Z1TA 2IG8A 5ITZB 2OTLF 4YJ2B 1VK3A 3OONA 2HS3A 5LYJA 4NQ3A 5BMVA 3V4DA 3JASA 3VOBA 3NVKE 1XHOA 1W2BF 4ZI7B 3C9RA 1UFYA 1SDSA 3JAKB 3RYHB 3P10A 3B6NA 1VHAA 5FJ4C 1Z5WA 1RA4A 3ELCA 4KWEA 3S0HA 4HNAB 1TVKB 4F6RA 4BVSA 1JFFB 5G4UC 2AIFA 4O4HB 3VMFB 1E7KA 4O2BB 5JCOA 3WPWA 1Q82H 1VQ5F 3TD5A 3WGMA 5JH7B 1W5AA 2DYYA 5IT9M 4DRXB 2KTVA 4ZHQA 3MBMA 4EI8A 2KG4A 5GIPC 1U43A 3LDTA 5EO3A 4B5CA 5HP8A 2HQSC 1VQ4F 4NUTA 3LWOC 1R1MA 4U39A 3JALB 4O4LB 5GANK 2KGWA 4M8IA 1IV1A 2Q1XA 2VAMA 3TD4A 3FFMA 3L7QA 3CCEF 3D54A 3DC2A 3MQWA 2CHSA 5EB1B
chains in the Genus database with same CATH topology
2ZAUA 3C9UA 1VQVA 2V9YA 2YYEA 3VYTC 1VK3A 3FD5A 2HS3A 3KIZA 2RB9A 2I6RA 3M84A 5AVMA 3C9RA 3QTYA 2Z1EA 2HS0A 3MCQA 3WJPA 2HS4A 3C9SA 1CLIA 3WJQA 2BTUA 2YXZA 3VYUC 2HRYA 3P4EA 3VIUA 3WJRA 2ZODA 3U0OA 2Z1FA 3VYSC 3MDOA 3D54A 2HRUA 3VTIC 2Z01A 2Z1UA 3FD6A 3C9TA 2Z1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAU A;  3C9U A;  1VQV A;  2V9Y A;  2YYE A;  3VYT C;  1VK3 A;  3FD5 A;  2HS3 A;  3KIZ A;  2RB9 A;  2I6R A;  3M84 A;  5AVM A;  3C9R A;  3QTY A;  2Z1E A;  2HS0 A;  3MCQ A;  3WJP A;  2HS4 A;  3C9S A;  1CLI A;  3WJQ A;  2BTU A;  2YXZ A;  3VYU C;  2HRY A;  3P4E A;  3VIU A;  3WJR A;  2ZOD A;  3U0O A;  2Z1F A;  3VYS C;  3MDO A;  3D54 A;  2HRU A;  3VTI C;  2Z01 A;  2Z1U A;  3FD6 A;  3C9T A;  2Z1T A; 
#chains in the Genus database with same CATH topology
 2YYE A;  3VCZ A;  4G4W A;  3CPW F;  4BY9 D;  3OW2 F;  3RA6 A;  3ZO8 A;  2JNB A;  5EYP B;  3LFO A;  1YGY A;  3K2X A;  1XRG A;  4ZHY B;  5C8Y B;  2CSL A;  5J2T B;  3V7Q A;  3VI6 A;  1W5F A;  1DBF A;  2DT4 A;  5FLX M;  4E6E A;  4BVQ A;  4IHJ A;  5CB4 B;  5GON B;  1W55 A;  3N4Y A;  2OHW A;  3G6E F;  2G9I A;  5KX5 B;  3RYC A;  3M84 A;  5LA6 B;  5MN4 A;  2VAW A;  4O4J B;  2P6Y A;  1QAH A;  5LOV A;  5HWE A;  1FNJ A;  5IYZ B;  3WJP A;  3N2G B;  4XCQ A;  4B46 A;  1YQN A;  4NWO B;  1QVF F;  3I3F A;  1VQ6 F;  4LNU B;  2RHJ A;  3HKB A;  4G4V A;  1X52 A;  5MN5 A;  3CCS F;  3PLA C;  2N48 A;  3CCM F;  5HY4 A;  3KE1 A;  5EB0 A;  3WPX A;  5LYJ B;  5BMV B;  1ZWZ A;  3JAS B;  4X1I A;  1Q7Y H;  2BO1 A;  1FSZ A;  4BT3 A;  3MCA B;  4DXD A;  3S0Y A;  3ESJ A;  4O2A A;  3ERN A;  4WBN A;  2GLZ A;  5JQG A;  4B62 A;  4X1K A;  3ON1 A;  1J7H A;  4F6R B;  4PWT A;  2CWJ A;  5LP6 C;  1OFU A;  2YXZ A;  3WXM B;  1W42 A;  4BT5 A;  3P4E A;  3HWU A;  3CME F;  3E20 B;  3WGL A;  1VQ7 F;  5HP7 A;  5EWR A;  4C4W C;  1U3P A;  3JAR A;  2VGM A;  3WGN A;  3VYT C;  1KC8 H;  3HTN A;  2RB9 A;  3IEW A;  1S72 F;  2AMT A;  4ZHQ B;  3SIU A;  1XBI A;  4BT7 A;  4BW0 B;  1PXW A;  1VQM F;  2CW4 A;  4IIJ A;  1K8A H;  1RQ7 A;  3R0P A;  3CCU F;  1QD9 A;  5CA0 A;  2B33 A;  4R40 B;  3ZP4 A;  2LBW A;  4C81 A;  1VQN F;  3ZOP A;  3JVH A;  3CC2 F;  1KD1 H;  2RHL A;  3G71 F;  5EAZ A;  1K73 H;  2VAP A;  4FFB A;  3AGK A;  2OZB A;  5GIN C;  2H8C A;  3C8L A;  1KNJ A;  5HY0 A;  3KIZ A;  3CXC F;  4BT6 A;  3EOR A;  3CYQ A;  3F0G A;  3V3T A;  3J7A R;  2Z1E A;  1FFX A;  3D01 A;  2VXY A;  5IJ0 B;  3HKD A;  3K12 A;  4BVT A;  4I50 A;  3FPI A;  3K14 A;  3OBW A;  5FNV A;  4C8E A;  1FNK A;  4TV8 A;  5EIB C;  5HXU A;  4C82 A;  2QI2 A;  3U0O A;  5G4V C;  3KJJ A;  2Q1Y A;  2Z01 A;  3M1X A;  5EZY A;  4IHJ B;  5HY1 A;  1W58 1;  3LWP C;  3C9U A;  4C8G A;  1Q81 H;  3UT5 A;  3RYF A;  1NJI H;  3RYC B;  4LCK A;  1VQK F;  5LOV B;  4EI7 A;  3I7T A;  3LWR C;  2VGN A;  2CHT A;  1K9M H;  3IKE A;  3LME A;  3JCM M;  2PHN A;  2HS4 A;  4G4X A;  4I4T A;  1H7M A;  4RQO A;  2UYP A;  3HKB B;  3VYU C;  3CCV F;  3VIU A;  1YIJ F;  3LYB A;  2UZH A;  3HKE A;  4O4I A;  3MDO A;  1SA0 A;  2HRU A;  4X1Y B;  1RLU A;  2NMU A;  2ZAU A;  4X1I B;  3WGJ A;  1RQ2 A;  3VO8 A;  1QVG F;  5AVM A;  1ODE A;  3CC4 F;  3QTY A;  4O2A B;  5MN6 A;  2ZVY A;  4WBN B;  3TD3 A;  4C8I A;  3MCQ A;  4TV9 A;  4X1K B;  5JQG B;  3CCJ F;  2OTJ F;  2H8E A;  1GX1 A;  1W59 A;  2MQE A;  2UYN A;  1CN7 A;  1W3E X;  2HP0 A;  3I55 F;  1M1K H;  3F6M A;  1VQ9 F;  3GHZ A;  5CA1 A;  5JVD A;  2HVY D;  3JAR B;  1UI9 A;  1W40 A;  3JAW A;  1OAP A;  1ONI A;  3BYQ A;  4G4Y A;  5J2U A;  1U3L A;  1IV2 A;  3IR9 A;  4B45 A;  2FGY A;  3NMU C;  3V7E A;  4IIJ B;  4TUY A;  3CCR F;  2LCA A;  3KHN A;  3P0Z A;  3I56 F;  5CA0 B;  2HS0 A;  5GIO C;  2L26 A;  2AIZ P;  5A2Q M;  2GVI A;  3WJQ A;  1T0K B;  3RYI A;  3CG6 A;  4FFB B;  3RE3 A;  4G88 A;  3VYS C;  2I6D A;  4X3M A;  5JCO C;  4TZZ A;  1YJ9 F;  3E22 A;  1Q86 H;  4ZOL A;  3JAT A;  1YJN F;  1GO1 A;  1FFX B;  3IKF A;  3CD6 F;  4U3J A;  1NQ3 A;  4YJ3 A;  3HKD B;  4I50 B;  4ZK7 A;  3LWV C;  3E1Y A;  5FNV B;  3N2K A;  3HKC A;  4TV8 B;  2BTU A;  5HXZ A;  2QTP A;  3NK6 A;  3CCL F;  1YIT F;  2ZOD A;  2ZVZ A;  2HP3 A;  5EZY B;  2R75 1;  1X25 A;  1XV2 A;  4X20 A;  3UT5 B;  3RYF B;  1GZ0 A;  3CYP B;  1TUB A;  2V9Y A;  1W41 A;  4I55 A;  3FD5 A;  3CC7 F;  5KMG A;  1KQS F;  4ZHV A;  5IJ9 A;  3G4S F;  1DT9 A;  1QU9 A;  1JN1 A;  4I4T B;  4EB6 A;  3FBA A;  1CLI A;  3QUW A;  5LP6 A;  5GAP K;  2IAF A;  3NVI B;  3HKE B;  4O4I B;  3SIV A;  3K0T A;  1VQP F;  1SA0 B;  3F0D A;  5LXT A;  4BT2 A;  2K1S A;  4ZHW A;  1JD1 A;  2QA4 F;  3FD6 A;  2FC3 A;  4BVR A;  3S03 A;  5ITZ A;  1T0A A;  4YJ2 A;  1YI2 F;  2ZOV A;  3Q8H A;  5B8F A;  4X3L A;  4TV9 B;  4ZI7 A;  2UYN B;  1VH8 A;  2QEX F;  3JAK A;  3RYH A;  2HP0 B;  1VQ8 F;  2GZL A;  1Z5V A;  3O85 A;  3OBY A;  1VQL F;  1IPA A;  3KJK A;  5CA1 B;  1X7O A;  5JVD B;  1RLG A;  4HNA A;  1TVK A;  1KNK A;  3T80 A;  2OTM A;  3JAW B;  5J2U B;  1JFF A;  5EIB D;  4O4H A;  3CCQ F;  1U40 A;  4O2B A;  2LBX A;  2PMP A;  1IV4 A;  1M90 H;  5JH7 A;  4TUY B;  2I6R A;  3F0F A;  1PF5 A;  3J81 M;  2BTO A;  1CK2 A;  2CZW A;  4DRX A;  2ALE A;  3N4Z A;  2KTU A;  5IJ0 A;  5DCV A;  3J80 M;  3RYI B;  3RA5 A;  3LWQ C;  3JAL A;  4O4L A;  3S0W A;  1VQO F;  2Z1F A;  3D00 A;  1Q8R A;  1GO0 A;  2W8B C;  3CMA F;  2RHO A;  1X7P A;  3WGK A;  3M4S A;  3E22 B;  1VQV A;  4ZOL B;  3JAT B;  2IQQ A;  3CB2 A;  2CVL A;  3JAM M;  3NK7 A;  2BTQ B;  4RHA A;  4U3J B;  2LBT A;  3IMP A;  4YJ3 B;  1W57 A;  4BT4 A;  4G4Z A;  1IV3 A;  2H6L A;  3CPQ A;  5EYP A;  3IEQ A;  3N2K B;  3C9S A;  3HKC B;  1YJW F;  3VOA A;  3S02 A;  3DDN A;  1COM A;  3GTZ A;  2EWC A;  2HRY A;  3WJR A;  3HAX D;  1W5B A;  5C8Y A;  5J2T A;  3PAF A;  4X20 B;  1H48 A;  2RHH A;  4ERH A;  1YHQ F;  3HJW C;  2UYK A;  1TUB B;  4X1Y A;  3C9T A;  4I55 B;  5KMG B;  2ZF8 A;  3GYQ A;  2R6R 1;  1JY8 A;  5CB4 A;  3QHD A;  5GON A;  5IJ9 B;  5KX5 A;  4EB6 B;  5LA6 A;  1NMU B;  2UYJ A;  4O4J A;  5IYZ A;  1SZQ A;  5LP6 B;  2HX0 A;  3F0E A;  3N2G A;  3ZP7 A;  1N8R H;  5LXT B;  5HY2 A;  2WAL A;  1W5E A;  4LNU A;  4EI9 A;  3S06 A;  3VTI C;  1JJ2 F;  2Z1U A;  2F9Z C;  1H47 A;  2Z1T A;  2IG8 A;  5ITZ B;  2OTL F;  4YJ2 B;  1VK3 A;  3OON A;  2HS3 A;  5LYJ A;  4NQ3 A;  5BMV A;  3V4D A;  3JAS A;  3VOB A;  3NVK E;  1XHO A;  1W2B F;  4ZI7 B;  3C9R A;  1UFY A;  1SDS A;  3JAK B;  3RYH B;  3P10 A;  3B6N A;  1VHA A;  5FJ4 C;  1Z5W A;  1RA4 A;  3ELC A;  4KWE A;  3S0H A;  4HNA B;  1TVK B;  4F6R A;  4BVS A;  1JFF B;  5G4U C;  2AIF A;  4O4H B;  3VMF B;  1E7K A;  4O2B B;  5JCO A;  3WPW A;  1Q82 H;  1VQ5 F;  3TD5 A;  3WGM A;  5JH7 B;  1W5A A;  2DYY A;  5IT9 M;  4DRX B;  2KTV A;  4ZHQ A;  3MBM A;  4EI8 A;  2KG4 A;  5GIP C;  1U43 A;  3LDT A;  5EO3 A;  4B5C A;  5HP8 A;  2HQS C;  1VQ4 F;  4NUT A;  3LWO C;  1R1M A;  4U39 A;  3JAL B;  4O4L B;  5GAN K;  2KGW A;  4M8I A;  1IV1 A;  2Q1X A;  2VAM A;  3TD4 A;  3FFM A;  3L7Q A;  3CCE F;  3D54 A;  3DC2 A;  3MQW A;  2CHS A;  5EB1 B; 
#chains in the Genus database with same CATH homology
 2ZAU A;  3C9U A;  1VQV A;  2V9Y A;  2YYE A;  3VYT C;  1VK3 A;  3FD5 A;  2HS3 A;  3KIZ A;  2RB9 A;  2I6R A;  3M84 A;  5AVM A;  3C9R A;  3QTY A;  2Z1E A;  2HS0 A;  3MCQ A;  3WJP A;  2HS4 A;  3C9S A;  1CLI A;  3WJQ A;  2BTU A;  2YXZ A;  3VYU C;  2HRY A;  3P4E A;  3VIU A;  3WJR A;  2ZOD A;  3U0O A;  2Z1F A;  3VYS C;  3MDO A;  3D54 A;  2HRU A;  3VTI C;  2Z01 A;  2Z1U A;  3FD6 A;  3C9T A;  2Z1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...