2BTUA

Crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
329
structure length
322
Chain Sequence
EAGYEAVSRMKKHVQTTMRKEVLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Phosphoribosylformylglycinamidine Cyclo-Ligase from Bacillus Anthracis at 2.3A Resolution.
rcsb
source organism Bacillus anthracis
molecule tags Synthase
molecule keywords PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
total genus 77
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2btuA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2btuA02
3FD6A 3VYTC 3D54A 3WJPA 2V9YA 3C9TA 3FD5A 2ZAUA 3VTIC 3KIZA 2I6RA 5AVMA 3VYUC 2ZODA 3M84A 2Z1EA 3C9SA 2Z01A 2HS3A 3WJRA 1CLIA 3C9RA 2YXZA 3QTYA 3MCQA 3WJQA 3MDOA 2BTUA 3VIUA 2HRYA 2HS0A 2YYEA 3P4EA 2RB9A 2Z1TA 2Z1UA 3U0OA 3VYSC 2HRUA 2Z1FA 2HS4A 1VQVA 1VK3A 3C9UA
chains in the Genus database with same CATH superfamily
2H8EA 1U3LA 2QA4F 3KHNA 3FD5A 5JH7B 1VQKF 4BVTA 3CCQF 4ZI7A 4ZI7B 4O4JB 4G4VA 4C8GA 3S03A 1VQLF 3CPWF 3PLAC 1FFXA 3V3TA 4LCKA 3C9RA 3GTZA 4X3MA 1YJNF 1COMA 5JQGA 1YHQF 3OONA 2BTUA 3VIUA 5CA1A 3CCEF 3B6NA 2YYEA 5FNVB 2R6R1 2RB9A 3Q8HA 2R751 3K0TA 5HY2A 4YJ2A 1YI2F 3HKBA 1JD1A 3JAWB 2GLZA 5A2QM 1W42A 3M4SA 1W5BA 3LWOC 1SZQA 2I6RA 3RA5A 4TV9B 1XRGA 4R40B 1KC8H 2W8BC 1Z5WA 3WPXA 4X20B 4TZZA 4IHJA 3R0PA 3CXCF 2AIZP 5LXTA 1FFXB 5JVDA 5JVDB 1U40A 5CA1B 3E22A 3E22B 5EIBC 3J7AR 2OZBA 5LOVA 1VK3A 5EZYA 3PAFA 2V9YA 3IEWA 1ODEA 3JAWA 1M90H 3ERNA 3MCAB 2ALEA 3VYUC 4G4WA 5ITZB 5ITZA 3RYCA 3RYCB 1KNKA 2I6DA 3G6EF 1RQ7A 3KJKA 5LA6B 4X1KA 1Q7YH 4X1IB 5EB0A 3LFOA 1NJIH 4TV8A 4I4TA 4TV8B 2LBWA 3UT5A 3RYFA 2OTMA 3G71F 1VQ8F 1TVKA 4LNUB 1TVKB 5IJ0B 5IJ0A 3S02A 5EB1B 1W5AA 1KNJA 2Q1XA 3WJPA 3I7TA 4DRXB 3RE3A 3CYQA 4BVSA 2IQQA 4O2BB 3VTIC 3S06A 3NVIB 4ZHWA 4EB6A 3JAKA 3FBAA 1QU9A 2LCAA 1N8RH 2F9ZC 2VAMA 2IG8A 3BYQA 3MBMA 5EIBD 1PF5A 2OHWA 4I55A 3S0WA 1VQ4F 5JCOC 2EWCA 3SIVA 2Z1TA 1VQVA 3G4SF 2BTQB 3LDTA 4DXDA 3FD6A 3CB2A 1S72F 1SA0B 1IV2A 2K1SA 3P10A 1JJ2F 3ZOPA 2RHOA 3F6MA 1JY8A 1QD9A 5CA0A 4O2BA 4ERHA 5C8YA 3VOBA 3C8LA 5C8YB 5HP8A 5JQGB 4BVQA 2CWJA 3LWVC 3MDOA 3LYBA 3NK6A 3JAMM 1UI9A 4YJ2B 5EYPA 2UYJA 1RLGA 1JFFB 5J2TB 3HKDB 4BT3A 2UYKA 1OAPA 3CCSF 3NVKE 1Q82H 1Q86H 4HNAA 2VXYA 1M1KH 4BY9D 3JCMM 5EAZA 4U39A 5KMGA 3KIZA 5KMGB 4O4JA 5LP6A 4G4XA 2Z1EA 3C9SA 5GIOC 1T0KB 2YXZA 3KJJA 1W2BF 3V7QA 1QVGF 3LWRC 1W55A 2DT4A 2ZVYA 2KG4A 3VI6A 3WGLA 2VAPA 3N2KB 1KD1H 4C82A 3M1XA 3CCUF 5LYJB 3K2XA 2Q1YA 2VGMA 3CD6F 4ZHYB 2GVIA 3LMEA 2JNBA 3CG6A 2CSLA 4ZOLA 3I55F 1VQNF 4O2AA 4X1KB 4BW0B 3HKCB 3DC2A 1ONIA 1W57A 1XHOA 1W581 2ZOVA 3O85A 2OTLF 4F6RB 2HS0A 1T0AA 3RYIB 3WGJA 2HS4A 1Q81H 2CHSA 5KX5B 4G88A 3HKBB 5G4UC 4WBNB 3ZO8A 4O4HA 3J80M 3JARA 3VCZA 4ZHVA 4TV9A 2RHJA 1GO0A 2Z01A 2CZWA 3CYPB 2VAWA 3RYHA 3HKCA 4X1IA 1YJ9F 2N48A 1FNKA 3IEQA 4YJ3B 3IR9A 2KGWA 4YJ3A 5B8FA 4O2AB 1IPAA 4X1YB 3GHZA 1VQ9F 3CPQA 1K8AH 1YGYA 1K9MH 5HY4A 4ZHQA 4I4TB 3CC2F 4M8IA 1NQ3A 3J81M 3F0DA 2KTUA 1RA4A 4C8EA 3VYTC 1SDSA 5KX5A 1YITF 2WALA 1U43A 1W3EX 1U3PA 2ZAUA 3LWPC 2ZODA 2P6YA 3JALA 4C81A 4O4HB 3T80A 3WPWA 1KQSF 5LA6A 3QHDA 5HXUA 5FJ4C 3F0EA 4U3JA 4B5CA 1FNJA 3HKDA 3OBWA 1XV2A 1QAHA 4O4IA 3WGMA 2G9IA 1RQ2A 3CCJF 2RHLA 4EI8A 1UFYA 1NMUB 4BVRA 1TUBA 4FFBB 1VQ6F 3CCLF 5LP6B 2DYYA 4G4ZA 3ESJA 3K12A 5CB4B 5IJ9A 3SIUA 3M84A 3V7EA 3K14A 3NK7A 3CCMF 1JN1A 3ZP7A 3NMUC 2UYNA 1X25A 3ON1A 5GIPC 3N2KA 4IIJA 5EYPB 5GANK 3CMAF 1JFFA 3VOAA 2RHHA 2KTVA 3U0OA 3WGKA 1GZ0A 1Z5VA 2Z1FA 3I56F 2OTJF 1CN7A 3IKEA 3P0ZA 2H8CA 2LBTA 4HNAB 3JVHA 3RYFB 3S0HA 5EWRA 1VQMF 2FC3A 1YQNA 4BT7A 5AVMA 2L26A 3VMFB 4ZK7A 3HKEB 5BMVA 5IJ9B 5HXZA 4FFBA 3OW2F 2GZLA 3E1YA 2HVYD 3N2GB 2ZF8A 3CMEF 3S0YA 5LOVB 2CHTA 2HQSC 2IAFA 5HP7A 2PHNA 4B45A 2B33A 5FNVA 3JASB 1GO1A 3E20B 3TD3A 4IIJB 4WBNA 5LYJA 4RQOA 1H47A 3WXMB 3TD4A 1X7OA 5J2UA 5J2UB 5IT9M 3FPIA 5MN6A 5IYZA 4BT5A 1Q8RA 1X7PA 2QTPA 4RHAA 1ZWZA 1QVFF 2HP0A 1OFUA 1J7HA 3D01A 4IHJB 2HS3A 3RA6A 2UYPA 4X20A 3QTYA 3AGKA 3JATA 3JATB 3HKEA 5BMVB 3WGNA 5GONA 1XBIA 3CCVF 2FGYA 1W41A 4G4YA 2Z1UA 2HRUA 3C9UA 3DDNA 5MN5A 4NUTA 2UZHA 4E6EA 5J2TA 1R1MA 4EB6B 4B46A 2ZVZA 3D00A 4ZOLB 3JALB 3GYQA 5JH7A 3VO8A 5DCVA 4B62A 1DT9A 4C4WC 3IMPA 3MQWA 3ZP4A 3UT5B 2HRYA 3CCRF 2PMPA 3CC7F 2BO1A 1SA0A 2BTOA 1YIJF 1TUBB 5GONB 1IV1A 1VHAA 4XCQA 5GAPK 1VH8A 1W5FA 1CK2A 2H6LA 3QUWA 4BT2A 3V4DA 1E7KA 1YJWF 5EZYB 1IV3A 3KE1A 3JAKB 5FLXM 4BT4A 1GX1A 3JARB 3HWUA 1IV4A 5G4VC 3RYHB 2CW4A 2QI2A 3MCQA 2CVLA 2NMUA 5MN4A 3HJWC 3F0GA 3TD5A 4C8IA 5LXTB 5LP6C 4EI7A 4ZHQB 1RLUA 4F6RA 1VQOF 3HAXD 3L7QA 3HTNA 3IKFA 5HY1A 1VQ7F 3D54A 3LWQC 5CB4A 5CA0B 1X52A 1W5EA 2MQEA 1PXWA 4PWTA 1DBFA 2QEXF 3N4YA 4TUYB 3WJRA 2UYNB 4I50B 3WJQA 1H48A 3ELCA 5JCOA 3I3FA 3JASA 4O4IB 3P4EA 4I55B 4U3JB 5GINC 4X1YA 2AMTA 1W40A 5IYZB 4EI9A 1H7MA 1FSZA 4LNUA 3CC4F 2HP0B 1VQPF 3C9TA 4NWOB 4NQ3A 1W59A 2HX0A 4DRXA 4BT6A 1CLIA 2LBXA 3N4ZA 3F0FA 3N2GA 4X3LA 4TUYA 5HY0A 4O4LA 4O4LB 2VGNA 3RYIA 4I50A 1VQ5F 2AIFA 3OBYA 2HP3A 3EORA 1K73H 5EO3A 3FFMA 3VYSC 4KWEA 5HWEA
chains in the Genus database with same CATH topology
3FD6A 3VYTC 3D54A 3WJPA 2V9YA 3C9TA 3FD5A 2ZAUA 3VTIC 3KIZA 2I6RA 5AVMA 3VYUC 2ZODA 3M84A 2Z1EA 3C9SA 2Z01A 2HS3A 3WJRA 1CLIA 3C9RA 2YXZA 3QTYA 3MCQA 3WJQA 3MDOA 2BTUA 3VIUA 2HRYA 2HS0A 2YYEA 3P4EA 2RB9A 2Z1TA 2Z1UA 3U0OA 3VYSC 2HRUA 2Z1FA 2HS4A 1VQVA 1VK3A 3C9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FD6 A;  3VYT C;  3D54 A;  3WJP A;  2V9Y A;  3C9T A;  3FD5 A;  2ZAU A;  3VTI C;  3KIZ A;  2I6R A;  5AVM A;  3VYU C;  2ZOD A;  3M84 A;  2Z1E A;  3C9S A;  2Z01 A;  2HS3 A;  3WJR A;  1CLI A;  3C9R A;  2YXZ A;  3QTY A;  3MCQ A;  3WJQ A;  3MDO A;  2BTU A;  3VIU A;  2HRY A;  2HS0 A;  2YYE A;  3P4E A;  2RB9 A;  2Z1T A;  2Z1U A;  3U0O A;  3VYS C;  2HRU A;  2Z1F A;  2HS4 A;  1VQV A;  1VK3 A;  3C9U A; 
#chains in the Genus database with same CATH topology
 2H8E A;  1U3L A;  2QA4 F;  3KHN A;  3FD5 A;  5JH7 B;  1VQK F;  4BVT A;  3CCQ F;  4ZI7 A;  4ZI7 B;  4O4J B;  4G4V A;  4C8G A;  3S03 A;  1VQL F;  3CPW F;  3PLA C;  1FFX A;  3V3T A;  4LCK A;  3C9R A;  3GTZ A;  4X3M A;  1YJN F;  1COM A;  5JQG A;  1YHQ F;  3OON A;  2BTU A;  3VIU A;  5CA1 A;  3CCE F;  3B6N A;  2YYE A;  5FNV B;  2R6R 1;  2RB9 A;  3Q8H A;  2R75 1;  3K0T A;  5HY2 A;  4YJ2 A;  1YI2 F;  3HKB A;  1JD1 A;  3JAW B;  2GLZ A;  5A2Q M;  1W42 A;  3M4S A;  1W5B A;  3LWO C;  1SZQ A;  2I6R A;  3RA5 A;  4TV9 B;  1XRG A;  4R40 B;  1KC8 H;  2W8B C;  1Z5W A;  3WPX A;  4X20 B;  4TZZ A;  4IHJ A;  3R0P A;  3CXC F;  2AIZ P;  5LXT A;  1FFX B;  5JVD A;  5JVD B;  1U40 A;  5CA1 B;  3E22 A;  3E22 B;  5EIB C;  3J7A R;  2OZB A;  5LOV A;  1VK3 A;  5EZY A;  3PAF A;  2V9Y A;  3IEW A;  1ODE A;  3JAW A;  1M90 H;  3ERN A;  3MCA B;  2ALE A;  3VYU C;  4G4W A;  5ITZ B;  5ITZ A;  3RYC A;  3RYC B;  1KNK A;  2I6D A;  3G6E F;  1RQ7 A;  3KJK A;  5LA6 B;  4X1K A;  1Q7Y H;  4X1I B;  5EB0 A;  3LFO A;  1NJI H;  4TV8 A;  4I4T A;  4TV8 B;  2LBW A;  3UT5 A;  3RYF A;  2OTM A;  3G71 F;  1VQ8 F;  1TVK A;  4LNU B;  1TVK B;  5IJ0 B;  5IJ0 A;  3S02 A;  5EB1 B;  1W5A A;  1KNJ A;  2Q1X A;  3WJP A;  3I7T A;  4DRX B;  3RE3 A;  3CYQ A;  4BVS A;  2IQQ A;  4O2B B;  3VTI C;  3S06 A;  3NVI B;  4ZHW A;  4EB6 A;  3JAK A;  3FBA A;  1QU9 A;  2LCA A;  1N8R H;  2F9Z C;  2VAM A;  2IG8 A;  3BYQ A;  3MBM A;  5EIB D;  1PF5 A;  2OHW A;  4I55 A;  3S0W A;  1VQ4 F;  5JCO C;  2EWC A;  3SIV A;  2Z1T A;  1VQV A;  3G4S F;  2BTQ B;  3LDT A;  4DXD A;  3FD6 A;  3CB2 A;  1S72 F;  1SA0 B;  1IV2 A;  2K1S A;  3P10 A;  1JJ2 F;  3ZOP A;  2RHO A;  3F6M A;  1JY8 A;  1QD9 A;  5CA0 A;  4O2B A;  4ERH A;  5C8Y A;  3VOB A;  3C8L A;  5C8Y B;  5HP8 A;  5JQG B;  4BVQ A;  2CWJ A;  3LWV C;  3MDO A;  3LYB A;  3NK6 A;  3JAM M;  1UI9 A;  4YJ2 B;  5EYP A;  2UYJ A;  1RLG A;  1JFF B;  5J2T B;  3HKD B;  4BT3 A;  2UYK A;  1OAP A;  3CCS F;  3NVK E;  1Q82 H;  1Q86 H;  4HNA A;  2VXY A;  1M1K H;  4BY9 D;  3JCM M;  5EAZ A;  4U39 A;  5KMG A;  3KIZ A;  5KMG B;  4O4J A;  5LP6 A;  4G4X A;  2Z1E A;  3C9S A;  5GIO C;  1T0K B;  2YXZ A;  3KJJ A;  1W2B F;  3V7Q A;  1QVG F;  3LWR C;  1W55 A;  2DT4 A;  2ZVY A;  2KG4 A;  3VI6 A;  3WGL A;  2VAP A;  3N2K B;  1KD1 H;  4C82 A;  3M1X A;  3CCU F;  5LYJ B;  3K2X A;  2Q1Y A;  2VGM A;  3CD6 F;  4ZHY B;  2GVI A;  3LME A;  2JNB A;  3CG6 A;  2CSL A;  4ZOL A;  3I55 F;  1VQN F;  4O2A A;  4X1K B;  4BW0 B;  3HKC B;  3DC2 A;  1ONI A;  1W57 A;  1XHO A;  1W58 1;  2ZOV A;  3O85 A;  2OTL F;  4F6R B;  2HS0 A;  1T0A A;  3RYI B;  3WGJ A;  2HS4 A;  1Q81 H;  2CHS A;  5KX5 B;  4G88 A;  3HKB B;  5G4U C;  4WBN B;  3ZO8 A;  4O4H A;  3J80 M;  3JAR A;  3VCZ A;  4ZHV A;  4TV9 A;  2RHJ A;  1GO0 A;  2Z01 A;  2CZW A;  3CYP B;  2VAW A;  3RYH A;  3HKC A;  4X1I A;  1YJ9 F;  2N48 A;  1FNK A;  3IEQ A;  4YJ3 B;  3IR9 A;  2KGW A;  4YJ3 A;  5B8F A;  4O2A B;  1IPA A;  4X1Y B;  3GHZ A;  1VQ9 F;  3CPQ A;  1K8A H;  1YGY A;  1K9M H;  5HY4 A;  4ZHQ A;  4I4T B;  3CC2 F;  4M8I A;  1NQ3 A;  3J81 M;  3F0D A;  2KTU A;  1RA4 A;  4C8E A;  3VYT C;  1SDS A;  5KX5 A;  1YIT F;  2WAL A;  1U43 A;  1W3E X;  1U3P A;  2ZAU A;  3LWP C;  2ZOD A;  2P6Y A;  3JAL A;  4C81 A;  4O4H B;  3T80 A;  3WPW A;  1KQS F;  5LA6 A;  3QHD A;  5HXU A;  5FJ4 C;  3F0E A;  4U3J A;  4B5C A;  1FNJ A;  3HKD A;  3OBW A;  1XV2 A;  1QAH A;  4O4I A;  3WGM A;  2G9I A;  1RQ2 A;  3CCJ F;  2RHL A;  4EI8 A;  1UFY A;  1NMU B;  4BVR A;  1TUB A;  4FFB B;  1VQ6 F;  3CCL F;  5LP6 B;  2DYY A;  4G4Z A;  3ESJ A;  3K12 A;  5CB4 B;  5IJ9 A;  3SIU A;  3M84 A;  3V7E A;  3K14 A;  3NK7 A;  3CCM F;  1JN1 A;  3ZP7 A;  3NMU C;  2UYN A;  1X25 A;  3ON1 A;  5GIP C;  3N2K A;  4IIJ A;  5EYP B;  5GAN K;  3CMA F;  1JFF A;  3VOA A;  2RHH A;  2KTV A;  3U0O A;  3WGK A;  1GZ0 A;  1Z5V A;  2Z1F A;  3I56 F;  2OTJ F;  1CN7 A;  3IKE A;  3P0Z A;  2H8C A;  2LBT A;  4HNA B;  3JVH A;  3RYF B;  3S0H A;  5EWR A;  1VQM F;  2FC3 A;  1YQN A;  4BT7 A;  5AVM A;  2L26 A;  3VMF B;  4ZK7 A;  3HKE B;  5BMV A;  5IJ9 B;  5HXZ A;  4FFB A;  3OW2 F;  2GZL A;  3E1Y A;  2HVY D;  3N2G B;  2ZF8 A;  3CME F;  3S0Y A;  5LOV B;  2CHT A;  2HQS C;  2IAF A;  5HP7 A;  2PHN A;  4B45 A;  2B33 A;  5FNV A;  3JAS B;  1GO1 A;  3E20 B;  3TD3 A;  4IIJ B;  4WBN A;  5LYJ A;  4RQO A;  1H47 A;  3WXM B;  3TD4 A;  1X7O A;  5J2U A;  5J2U B;  5IT9 M;  3FPI A;  5MN6 A;  5IYZ A;  4BT5 A;  1Q8R A;  1X7P A;  2QTP A;  4RHA A;  1ZWZ A;  1QVF F;  2HP0 A;  1OFU A;  1J7H A;  3D01 A;  4IHJ B;  2HS3 A;  3RA6 A;  2UYP A;  4X20 A;  3QTY A;  3AGK A;  3JAT A;  3JAT B;  3HKE A;  5BMV B;  3WGN A;  5GON A;  1XBI A;  3CCV F;  2FGY A;  1W41 A;  4G4Y A;  2Z1U A;  2HRU A;  3C9U A;  3DDN A;  5MN5 A;  4NUT A;  2UZH A;  4E6E A;  5J2T A;  1R1M A;  4EB6 B;  4B46 A;  2ZVZ A;  3D00 A;  4ZOL B;  3JAL B;  3GYQ A;  5JH7 A;  3VO8 A;  5DCV A;  4B62 A;  1DT9 A;  4C4W C;  3IMP A;  3MQW A;  3ZP4 A;  3UT5 B;  2HRY A;  3CCR F;  2PMP A;  3CC7 F;  2BO1 A;  1SA0 A;  2BTO A;  1YIJ F;  1TUB B;  5GON B;  1IV1 A;  1VHA A;  4XCQ A;  5GAP K;  1VH8 A;  1W5F A;  1CK2 A;  2H6L A;  3QUW A;  4BT2 A;  3V4D A;  1E7K A;  1YJW F;  5EZY B;  1IV3 A;  3KE1 A;  3JAK B;  5FLX M;  4BT4 A;  1GX1 A;  3JAR B;  3HWU A;  1IV4 A;  5G4V C;  3RYH B;  2CW4 A;  2QI2 A;  3MCQ A;  2CVL A;  2NMU A;  5MN4 A;  3HJW C;  3F0G A;  3TD5 A;  4C8I A;  5LXT B;  5LP6 C;  4EI7 A;  4ZHQ B;  1RLU A;  4F6R A;  1VQO F;  3HAX D;  3L7Q A;  3HTN A;  3IKF A;  5HY1 A;  1VQ7 F;  3D54 A;  3LWQ C;  5CB4 A;  5CA0 B;  1X52 A;  1W5E A;  2MQE A;  1PXW A;  4PWT A;  1DBF A;  2QEX F;  3N4Y A;  4TUY B;  3WJR A;  2UYN B;  4I50 B;  3WJQ A;  1H48 A;  3ELC A;  5JCO A;  3I3F A;  3JAS A;  4O4I B;  3P4E A;  4I55 B;  4U3J B;  5GIN C;  4X1Y A;  2AMT A;  1W40 A;  5IYZ B;  4EI9 A;  1H7M A;  1FSZ A;  4LNU A;  3CC4 F;  2HP0 B;  1VQP F;  3C9T A;  4NWO B;  4NQ3 A;  1W59 A;  2HX0 A;  4DRX A;  4BT6 A;  1CLI A;  2LBX A;  3N4Z A;  3F0F A;  3N2G A;  4X3L A;  4TUY A;  5HY0 A;  4O4L A;  4O4L B;  2VGN A;  3RYI A;  4I50 A;  1VQ5 F;  2AIF A;  3OBY A;  2HP3 A;  3EOR A;  1K73 H;  5EO3 A;  3FFM A;  3VYS C;  4KWE A;  5HWE A; 
#chains in the Genus database with same CATH homology
 3FD6 A;  3VYT C;  3D54 A;  3WJP A;  2V9Y A;  3C9T A;  3FD5 A;  2ZAU A;  3VTI C;  3KIZ A;  2I6R A;  5AVM A;  3VYU C;  2ZOD A;  3M84 A;  2Z1E A;  3C9S A;  2Z01 A;  2HS3 A;  3WJR A;  1CLI A;  3C9R A;  2YXZ A;  3QTY A;  3MCQ A;  3WJQ A;  3MDO A;  2BTU A;  3VIU A;  2HRY A;  2HS0 A;  2YYE A;  3P4E A;  2RB9 A;  2Z1T A;  2Z1U A;  3U0O A;  3VYS C;  2HRU A;  2Z1F A;  2HS4 A;  1VQV A;  1VK3 A;  3C9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...