2BTUA

Crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
329
structure length
322
Chain Sequence
b'EAGYEAVSRMKKHVQTTMRKEVLGGFGGMFDLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLDYIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDKKKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELIYGRLELPLGEELLKPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSLLQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE
molecule tags Synthase
source organism Bacillus anthracis
publication title Crystal Structure of Phosphoribosylformylglycinamidine Cyclo-Ligase from Bacillus Anthracis at 2.3A Resolution.
rcsb
total genus 77
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature ec 6.3.3.1: Phosphoribosylformylglycinamidine cyclo-ligase.
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00586 AIRS AIR synthase related protein, N-terminal domain
A PF02769 AIRS_C AIR synthase related protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.10 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; PurM-like, N-terminal domain 2btuA01
3.90.650.10 Alpha Beta Alpha-Beta Complex Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2 PurM-like C-terminal domain 2btuA02
3VTIC 3C9SA 3M84A 3FD5A 2HS3A 3FD6A 5AVMA 3U0OA 3MDOA 3C9RA 3C9TA 3C9UA 3VYUC 2BTUA 3VYTC 2V9YA 1VK3A 2Z1UA 3VYSC 2HRUA 2HRYA 2Z1EA 3WJQA 2Z01A 3VIUA 3WJPA 2I6RA 2YXZA 3WJRA 3P4EA 2RB9A 3MCQA 1VQVA 2ZODA 2HS0A 1CLIA 2HS4A 3D54A 2Z1FA 2ZAUA 3QTYA 3KIZA 2YYEA 2Z1TA
chains in the Genus database with same CATH superfamily
1W57A 3LWRC 4X3MA 4IHJA 4YJ2B 3JVHA 4O2BB 5JH7A 2HQSC 2HP0A 3J81M 2PMPA 1GX1A 3LWQC 5EIBC 4I50A 2OTMA 4I50B 3CYQA 1KNJA 3O85A 2CWJA 2RHOA 3MBMA 2PHNA 3DDNA 2HVYD 5GIOC 2KGWA 3MCQA 3UT5A 1K9MH 2LBWA 1JFFA 3F6MA 4I55B 5BMVB 1NQ3A 4O2AB 5HP8A 3JARB 3RA5A 4B46A 1T0AA 3K12A 1SZQA 5CB4B 2H6LA 1QD9A 5HY2A 1RQ2A 5IYZA 2CW4A 1X7PA 4IIJB 2V9YA 1VQ6F 5EZYA 1W55A 1H48A 3VIUA 3B6NA 3D01A 4X1YB 1KC8H 3HAXD 2RB9A 3CCJF 3RYFA 4WBNB 3HKCB 4E6EA 3WPXA 5KX5B 4LNUB 1VQ9F 3JAKB 3K2XA 4IIJA 3KIZA 3QHDA 2Z1TA 3Q8HA 3I55F 3IEWA 5IJ9B 3HTNA 3J7AR 5HXUA 3FD5A 3RYCA 3M1XA 3FD6A 3NK7A 5GONA 3U0OA 4B5CA 2QEXF 2H8CA 1T0KB 3JASB 3V3TA 4O2AA 1K73H 3CMAF 2VAPA 2Z01A 3N2GA 3ZOPA 4DRXB 2KG4A 3MCAB 1IV3A 2IQQA 4ZHVA 3T80A 3CG6A 4BVSA 2QA4F 3LFOA 4BVRA 4BT5A 1RLUA 5CA1B 2YYEA 3ZO8A 3RYFB 3V7EA 3ELCA 4IHJB 1XHOA 3S06A 3NVKE 4O4HA 2VAMA 5EB1B 5J2TB 3JAWB 1U3LA 3LYBA 4EB6A 2QI2A 5LP6A 3J80M 3K14A 1VQ8F 2B33A 5JVDA 5J2UA 1VQ7F 1H7MA 4LNUA 5LA6B 4YJ3B 2K1SA 2N48A 5J2TA 2VGMA 2DYYA 1XV2A 1CN7A 1QU9A 1TVKB 3R0PA 1N8RH 3CCMF 4X1IA 2HP3A 3I56F 3CD6F 3C9TA 2UZHA 2LCAA 4I4TB 4ZI7B 1ONIA 3S03A 4DXDA 5GANK 3VI6A 5IJ0B 2FC3A 2OZBA 2GVIA 2CHSA 3RA6A 3CB2A 3ESJA 5DCVA 2ALEA 4C8IA 1QVFF 4BT2A 2HS0A 4R40B 5EYPB 2VXYA 3PAFA 3G71F 5JCOC 5HY4A 3I7TA 5KMGA 2MQEA 2I6DA 1RA4A 5IJ9A 1SA0A 4BVTA 3CPQA 3VYUC 1W3EX 4O4IB 1ODEA 1SDSA 3RYIB 2KTVA 4F6RB 1VQMF 2YXZA 3IEQA 1QAHA 3CCUF 3HKCA 1YJ9F 2R6R1 1VQLF 1VQNF 3CCQF 4O4JB 3MQWA 4TUYA 4O4JA 3FBAA 3E22B 2CVLA 2RHJA 3LMEA 1R1MA 1YIJF 5CB4A 1U40A 1XRGA 3WXMB 1JN1A 4BT6A 3CPWF 5JCOA 1DBFA 3WJQA 2Z1EA 5EWRA 5G4VC 2OTJF 1ZWZA 4B62A 3JASA 2ZVZA 3G4SF 5MN4A 3RYIA 4F6RA 2OHWA 3WJRA 1U3PA 3IMPA 5CA0A 5CA1A 2H8EA 3JAKA 5A2QM 3SIVA 3HKBA 5KX5A 3ERNA 5JQGB 1Q8RA 3D54A 2UYPA 3JALA 3QTYA 3VO8A 3GHZA 4O2BA 4C4WC 1J7HA 4C8EA 4TZZA 3AGKA 3GYQA 5MN5A 3S0WA 1VH8A 1H47A 4G4YA 2BTUA 2HRUA 5EZYB 2BTOA 2G9IA 2ZVYA 3RYHA 4FFBB 3CCEF 5IJ0A 1VQ4F 3NK6A 2HX0A 3CYPB 4ZHQB 2ZF8A 5ITZB 1VQKF 1JY8A 2GLZA 3OBWA 5CA0B 3S0YA 1TUBB 1X52A 2IAFA 3M4SA 3CCLF 1CLIA 2HS4A 5HXZA 5KMGB 4O4HB 2JNBA 4ZK7A 5G4UC 3WGKA 4NQ3A 3S0HA 1KQSF 1U43A 2NMUA 3ZP7A 1RLGA 3E1YA 3L7QA 1VK3A 1W581 3LWVC 1QVGF 4BT4A 3HKEA 3K0TA 4O4LA 2I6RA 4G4VA 3FFMA 2UYNB 3P4EA 2ZOVA 3E22A 5HWEA 5MN6A 4X3LA 1Q7YH 4TUYB 2RHHA 1PF5A 1UI9A 2WALA 4G88A 1VQOF 5GONB 1TUBA 4U3JB 5LOVB 4TV8A 5IYZB 1IV4A 3CCRF 1IV2A 1FFXA 1SA0B 2HRYA 3V7QA 2HP0B 1FNJA 3LDTA 3FPIA 1IPAA 5FJ4C 4EB6B 1VQPF 2Q1YA 1W41A 3VCZA 5GIPC 2CSLA 3LWOC 4C81A 4U39A 3HKDB 2R751 4XCQA 1FNKA 1CK2A 3VOAA 1IV1A 3KE1A 3JALB 4C82A 3HKEB 1VQ5F 5EO3A 3TD4A 5LXTA 5AVMA 1YGYA 3CC7F 3QUWA 3VYTC 2Z1UA 4B45A 4ZHYB 3HJWC 1TVKA 4DRXA 1W5FA 3N2GB 4BVQA 3KHNA 3GTZA 4YJ3A 1W42A 4PWTA 1RQ7A 2VGNA 4G4WA 3WGJA 5ITZA 4G4XA 1M90H 4BT3A 1XBIA 3HWUA 2ZODA 3F0FA 4LCKA 3JARA 2ZAUA 3PLAC 3I3FA 4TV9B 3OONA 4C8GA 3N4ZA 2BO1A 2F9ZC 2AIZP 1YQNA 2CZWA 3C9RA 3JAWA 3C9UA 4M8IA 3EORA 5LYJA 1YJWF 3OW2F 1OFUA 1OAPA 1YJNF 3BYQA 5HY0A 2UYKA 2P6YA 4I4TA 4ZI7A 4X20A 2GZLA 4FFBA 1GZ0A 5HP7A 4RQOA 2DT4A 1YHQF 2IG8A 4NWOB 2EWCA 3ZP4A 3CXCF 1COMA 3N4YA 4X1KA 4I55A 5BMVA 1FSZA 3N2KA 3C8LA 4TV9A 2HS3A 2LBTA 4BY9D 3P10A 1X25A 3IR9A 1FFXB 5J2UB 3TD3A 3VYSC 4EI9A 2L26A 2FGYA 4ZHWA 1PXWA 1W5EA 2W8BC 4KWEA 3E20B 3CC4F 3F0GA 4WBNA 4RHAA 1Q82H 3WGNA 3CCVF 3JATB 1GO1A 5C8YB 2OTLF 1W59A 1JJ2F 1Q81H 3C9SA 5LXTB 3M84A 1KNKA 4O4IA 5GAPK 3SIUA 4O4LB 5JVDB 3OBYA 4ZOLA 3KJKA 4BW0B 3CC2F 3ON1A 4ZOLB 4BT7A 4X1KB 4ERHA 1JFFB 3IKEA 5HY1A 1VQVA 3UT5B 2BTQB 3G6EF 3NVIB 3RYCB 2CHTA 1E7KA 2Z1FA 1GO0A 2UYJA 3WPWA 4G4ZA 2RHLA 4U3JA 5LOVA 1M1KH 3D00A 1S72F 1YI2F 1JD1A 2KTUA 3JATA 3RYHB 5JH7B 4YJ2A 3VOBA 1W5AA 3TD5A 5EAZA 1YITF 1NJIH 2VAWA 4X1YA 5LYJB 3WJPA 3DC2A 1NMUB 5EIBD 1W40A 1VHAA 2UYNA 3F0EA 4X20B 5JQGA 1Z5VA 3LWPC 3NMUC 3HKBB 1DT9A 5C8YA 3F0DA 5FLXM 2AIFA 3VTIC 4X1IB 1W5BA 5GINC 5FNVA 3MDOA 4HNAA 1K8AH 5IT9M 4HNAB 3V4DA 2QTPA 5FNVB 4NUTA 1W2BF 3KJJA 1X7OA 3CMEF 5LA6A 2LBXA 3P0ZA 3RE3A 1KD1H 2AMTA 4TV8B 4ZHQA 1Z5WA 3S02A 5B8FA 1Q86H 1UFYA 4EI8A 3WGMA 2Q1XA 5EB0A 5LP6B 4EI7A 3JAMM 5EYPA 3WGLA 3CCSF 3N2KB 3HKDA 3JCMM 3IKFA 5LP6C 3VMFB
chains in the Genus database with same CATH topology
3VTIC 3C9SA 3M84A 3FD5A 2HS3A 3FD6A 5AVMA 3U0OA 3MDOA 3C9RA 3C9TA 3C9UA 3VYUC 2BTUA 3VYTC 2V9YA 1VK3A 2Z1UA 3VYSC 2HRUA 2HRYA 2Z1EA 3WJQA 2Z01A 3VIUA 3WJPA 2I6RA 2YXZA 3WJRA 3P4EA 2RB9A 3MCQA 1VQVA 2ZODA 2HS0A 1CLIA 2HS4A 3D54A 2Z1FA 2ZAUA 3QTYA 3KIZA 2YYEA 2Z1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTI C;  3C9S A;  3M84 A;  3FD5 A;  2HS3 A;  3FD6 A;  5AVM A;  3U0O A;  3MDO A;  3C9R A;  3C9T A;  3C9U A;  3VYU C;  2BTU A;  3VYT C;  2V9Y A;  1VK3 A;  2Z1U A;  3VYS C;  2HRU A;  2HRY A;  2Z1E A;  3WJQ A;  2Z01 A;  3VIU A;  3WJP A;  2I6R A;  2YXZ A;  3WJR A;  3P4E A;  2RB9 A;  3MCQ A;  1VQV A;  2ZOD A;  2HS0 A;  1CLI A;  2HS4 A;  3D54 A;  2Z1F A;  2ZAU A;  3QTY A;  3KIZ A;  2YYE A;  2Z1T A; 
#chains in the Genus database with same CATH topology
 1W57 A;  3LWR C;  4X3M A;  4IHJ A;  4YJ2 B;  3JVH A;  4O2B B;  5JH7 A;  2HQS C;  2HP0 A;  3J81 M;  2PMP A;  1GX1 A;  3LWQ C;  5EIB C;  4I50 A;  2OTM A;  4I50 B;  3CYQ A;  1KNJ A;  3O85 A;  2CWJ A;  2RHO A;  3MBM A;  2PHN A;  3DDN A;  2HVY D;  5GIO C;  2KGW A;  3MCQ A;  3UT5 A;  1K9M H;  2LBW A;  1JFF A;  3F6M A;  4I55 B;  5BMV B;  1NQ3 A;  4O2A B;  5HP8 A;  3JAR B;  3RA5 A;  4B46 A;  1T0A A;  3K12 A;  1SZQ A;  5CB4 B;  2H6L A;  1QD9 A;  5HY2 A;  1RQ2 A;  5IYZ A;  2CW4 A;  1X7P A;  4IIJ B;  2V9Y A;  1VQ6 F;  5EZY A;  1W55 A;  1H48 A;  3VIU A;  3B6N A;  3D01 A;  4X1Y B;  1KC8 H;  3HAX D;  2RB9 A;  3CCJ F;  3RYF A;  4WBN B;  3HKC B;  4E6E A;  3WPX A;  5KX5 B;  4LNU B;  1VQ9 F;  3JAK B;  3K2X A;  4IIJ A;  3KIZ A;  3QHD A;  2Z1T A;  3Q8H A;  3I55 F;  3IEW A;  5IJ9 B;  3HTN A;  3J7A R;  5HXU A;  3FD5 A;  3RYC A;  3M1X A;  3FD6 A;  3NK7 A;  5GON A;  3U0O A;  4B5C A;  2QEX F;  2H8C A;  1T0K B;  3JAS B;  3V3T A;  4O2A A;  1K73 H;  3CMA F;  2VAP A;  2Z01 A;  3N2G A;  3ZOP A;  4DRX B;  2KG4 A;  3MCA B;  1IV3 A;  2IQQ A;  4ZHV A;  3T80 A;  3CG6 A;  4BVS A;  2QA4 F;  3LFO A;  4BVR A;  4BT5 A;  1RLU A;  5CA1 B;  2YYE A;  3ZO8 A;  3RYF B;  3V7E A;  3ELC A;  4IHJ B;  1XHO A;  3S06 A;  3NVK E;  4O4H A;  2VAM A;  5EB1 B;  5J2T B;  3JAW B;  1U3L A;  3LYB A;  4EB6 A;  2QI2 A;  5LP6 A;  3J80 M;  3K14 A;  1VQ8 F;  2B33 A;  5JVD A;  5J2U A;  1VQ7 F;  1H7M A;  4LNU A;  5LA6 B;  4YJ3 B;  2K1S A;  2N48 A;  5J2T A;  2VGM A;  2DYY A;  1XV2 A;  1CN7 A;  1QU9 A;  1TVK B;  3R0P A;  1N8R H;  3CCM F;  4X1I A;  2HP3 A;  3I56 F;  3CD6 F;  3C9T A;  2UZH A;  2LCA A;  4I4T B;  4ZI7 B;  1ONI A;  3S03 A;  4DXD A;  5GAN K;  3VI6 A;  5IJ0 B;  2FC3 A;  2OZB A;  2GVI A;  2CHS A;  3RA6 A;  3CB2 A;  3ESJ A;  5DCV A;  2ALE A;  4C8I A;  1QVF F;  4BT2 A;  2HS0 A;  4R40 B;  5EYP B;  2VXY A;  3PAF A;  3G71 F;  5JCO C;  5HY4 A;  3I7T A;  5KMG A;  2MQE A;  2I6D A;  1RA4 A;  5IJ9 A;  1SA0 A;  4BVT A;  3CPQ A;  3VYU C;  1W3E X;  4O4I B;  1ODE A;  1SDS A;  3RYI B;  2KTV A;  4F6R B;  1VQM F;  2YXZ A;  3IEQ A;  1QAH A;  3CCU F;  3HKC A;  1YJ9 F;  2R6R 1;  1VQL F;  1VQN F;  3CCQ F;  4O4J B;  3MQW A;  4TUY A;  4O4J A;  3FBA A;  3E22 B;  2CVL A;  2RHJ A;  3LME A;  1R1M A;  1YIJ F;  5CB4 A;  1U40 A;  1XRG A;  3WXM B;  1JN1 A;  4BT6 A;  3CPW F;  5JCO A;  1DBF A;  3WJQ A;  2Z1E A;  5EWR A;  5G4V C;  2OTJ F;  1ZWZ A;  4B62 A;  3JAS A;  2ZVZ A;  3G4S F;  5MN4 A;  3RYI A;  4F6R A;  2OHW A;  3WJR A;  1U3P A;  3IMP A;  5CA0 A;  5CA1 A;  2H8E A;  3JAK A;  5A2Q M;  3SIV A;  3HKB A;  5KX5 A;  3ERN A;  5JQG B;  1Q8R A;  3D54 A;  2UYP A;  3JAL A;  3QTY A;  3VO8 A;  3GHZ A;  4O2B A;  4C4W C;  1J7H A;  4C8E A;  4TZZ A;  3AGK A;  3GYQ A;  5MN5 A;  3S0W A;  1VH8 A;  1H47 A;  4G4Y A;  2BTU A;  2HRU A;  5EZY B;  2BTO A;  2G9I A;  2ZVY A;  3RYH A;  4FFB B;  3CCE F;  5IJ0 A;  1VQ4 F;  3NK6 A;  2HX0 A;  3CYP B;  4ZHQ B;  2ZF8 A;  5ITZ B;  1VQK F;  1JY8 A;  2GLZ A;  3OBW A;  5CA0 B;  3S0Y A;  1TUB B;  1X52 A;  2IAF A;  3M4S A;  3CCL F;  1CLI A;  2HS4 A;  5HXZ A;  5KMG B;  4O4H B;  2JNB A;  4ZK7 A;  5G4U C;  3WGK A;  4NQ3 A;  3S0H A;  1KQS F;  1U43 A;  2NMU A;  3ZP7 A;  1RLG A;  3E1Y A;  3L7Q A;  1VK3 A;  1W58 1;  3LWV C;  1QVG F;  4BT4 A;  3HKE A;  3K0T A;  4O4L A;  2I6R A;  4G4V A;  3FFM A;  2UYN B;  3P4E A;  2ZOV A;  3E22 A;  5HWE A;  5MN6 A;  4X3L A;  1Q7Y H;  4TUY B;  2RHH A;  1PF5 A;  1UI9 A;  2WAL A;  4G88 A;  1VQO F;  5GON B;  1TUB A;  4U3J B;  5LOV B;  4TV8 A;  5IYZ B;  1IV4 A;  3CCR F;  1IV2 A;  1FFX A;  1SA0 B;  2HRY A;  3V7Q A;  2HP0 B;  1FNJ A;  3LDT A;  3FPI A;  1IPA A;  5FJ4 C;  4EB6 B;  1VQP F;  2Q1Y A;  1W41 A;  3VCZ A;  5GIP C;  2CSL A;  3LWO C;  4C81 A;  4U39 A;  3HKD B;  2R75 1;  4XCQ A;  1FNK A;  1CK2 A;  3VOA A;  1IV1 A;  3KE1 A;  3JAL B;  4C82 A;  3HKE B;  1VQ5 F;  5EO3 A;  3TD4 A;  5LXT A;  5AVM A;  1YGY A;  3CC7 F;  3QUW A;  3VYT C;  2Z1U A;  4B45 A;  4ZHY B;  3HJW C;  1TVK A;  4DRX A;  1W5F A;  3N2G B;  4BVQ A;  3KHN A;  3GTZ A;  4YJ3 A;  1W42 A;  4PWT A;  1RQ7 A;  2VGN A;  4G4W A;  3WGJ A;  5ITZ A;  4G4X A;  1M90 H;  4BT3 A;  1XBI A;  3HWU A;  2ZOD A;  3F0F A;  4LCK A;  3JAR A;  2ZAU A;  3PLA C;  3I3F A;  4TV9 B;  3OON A;  4C8G A;  3N4Z A;  2BO1 A;  2F9Z C;  2AIZ P;  1YQN A;  2CZW A;  3C9R A;  3JAW A;  3C9U A;  4M8I A;  3EOR A;  5LYJ A;  1YJW F;  3OW2 F;  1OFU A;  1OAP A;  1YJN F;  3BYQ A;  5HY0 A;  2UYK A;  2P6Y A;  4I4T A;  4ZI7 A;  4X20 A;  2GZL A;  4FFB A;  1GZ0 A;  5HP7 A;  4RQO A;  2DT4 A;  1YHQ F;  2IG8 A;  4NWO B;  2EWC A;  3ZP4 A;  3CXC F;  1COM A;  3N4Y A;  4X1K A;  4I55 A;  5BMV A;  1FSZ A;  3N2K A;  3C8L A;  4TV9 A;  2HS3 A;  2LBT A;  4BY9 D;  3P10 A;  1X25 A;  3IR9 A;  1FFX B;  5J2U B;  3TD3 A;  3VYS C;  4EI9 A;  2L26 A;  2FGY A;  4ZHW A;  1PXW A;  1W5E A;  2W8B C;  4KWE A;  3E20 B;  3CC4 F;  3F0G A;  4WBN A;  4RHA A;  1Q82 H;  3WGN A;  3CCV F;  3JAT B;  1GO1 A;  5C8Y B;  2OTL F;  1W59 A;  1JJ2 F;  1Q81 H;  3C9S A;  5LXT B;  3M84 A;  1KNK A;  4O4I A;  5GAP K;  3SIU A;  4O4L B;  5JVD B;  3OBY A;  4ZOL A;  3KJK A;  4BW0 B;  3CC2 F;  3ON1 A;  4ZOL B;  4BT7 A;  4X1K B;  4ERH A;  1JFF B;  3IKE A;  5HY1 A;  1VQV A;  3UT5 B;  2BTQ B;  3G6E F;  3NVI B;  3RYC B;  2CHT A;  1E7K A;  2Z1F A;  1GO0 A;  2UYJ A;  3WPW A;  4G4Z A;  2RHL A;  4U3J A;  5LOV A;  1M1K H;  3D00 A;  1S72 F;  1YI2 F;  1JD1 A;  2KTU A;  3JAT A;  3RYH B;  5JH7 B;  4YJ2 A;  3VOB A;  1W5A A;  3TD5 A;  5EAZ A;  1YIT F;  1NJI H;  2VAW A;  4X1Y A;  5LYJ B;  3WJP A;  3DC2 A;  1NMU B;  5EIB D;  1W40 A;  1VHA A;  2UYN A;  3F0E A;  4X20 B;  5JQG A;  1Z5V A;  3LWP C;  3NMU C;  3HKB B;  1DT9 A;  5C8Y A;  3F0D A;  5FLX M;  2AIF A;  3VTI C;  4X1I B;  1W5B A;  5GIN C;  5FNV A;  3MDO A;  4HNA A;  1K8A H;  5IT9 M;  4HNA B;  3V4D A;  2QTP A;  5FNV B;  4NUT A;  1W2B F;  3KJJ A;  1X7O A;  3CME F;  5LA6 A;  2LBX A;  3P0Z A;  3RE3 A;  1KD1 H;  2AMT A;  4TV8 B;  4ZHQ A;  1Z5W A;  3S02 A;  5B8F A;  1Q86 H;  1UFY A;  4EI8 A;  3WGM A;  2Q1X A;  5EB0 A;  5LP6 B;  4EI7 A;  3JAM M;  5EYP A;  3WGL A;  3CCS F;  3N2K B;  3HKD A;  3JCM M;  3IKF A;  5LP6 C;  3VMF B; 
#chains in the Genus database with same CATH homology
 3VTI C;  3C9S A;  3M84 A;  3FD5 A;  2HS3 A;  3FD6 A;  5AVM A;  3U0O A;  3MDO A;  3C9R A;  3C9T A;  3C9U A;  3VYU C;  2BTU A;  3VYT C;  2V9Y A;  1VK3 A;  2Z1U A;  3VYS C;  2HRU A;  2HRY A;  2Z1E A;  3WJQ A;  2Z01 A;  3VIU A;  3WJP A;  2I6R A;  2YXZ A;  3WJR A;  3P4E A;  2RB9 A;  3MCQ A;  1VQV A;  2ZOD A;  2HS0 A;  1CLI A;  2HS4 A;  3D54 A;  2Z1F A;  2ZAU A;  3QTY A;  3KIZ A;  2YYE A;  2Z1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...