1VQ7F

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq7F00
1YJNF 1NJIH 1YJ9F 1KC8H 3J7AR 3J80M 3N4YA 3SIVA 3RA5A 1YITF 4NUTA 1GZ0A 4BW0B 1W2BF 3LWPC 1QVFF 1KQSF 3VI6A 3I56F 1KD1H 2QEXF 1VQLF 3G6EF 1CN7A 1K9MH 3CCJF 1VQ5F 3WXMB 3PLAC 1VQ6F 1Q81H 5GAPK 3CCMF 3CCEF 5IT9M 1RA4A 2OZBA 1JJ2F 1W40A 1QVGF 5A2QM 1W42A 3O85A 4TZZA 1VQMF 2WALA 1X7OA 1NMUB 4X3MA 3MCAB 2HVYD 5GANK 1W3EX 2KG4A 1IPAA 3CMAF 3CCQF 1DT9A 3I55F 3RA6A 1H7MA 3LFOA 3NVKE 3VMFB 3AGKA 3CCVF 1T0KB 2BO1A 2VGMA 4LCKA 3E20B 3CC4F 1VQNF 1PXWA 3OBYA 1W41A 2OHWA 2CZWA 1X7PA 3LWOC 3V7EA 3LWRC 1K8AH 3CCSF 1E7KA 2AIFA 1N8RH 1GO0A 1YI2F 2QI2A 3CPWF 2KTVA 2LBXA 2ALEA 2QA4F 1VQKF 5G4VC 3NVIB 3OBWA 3CC7F 1RLGA 3CG6A 1M1KH 1X52A 2KTUA 1K73H 3CD6F 2LBWA 4X3LA 5GIOC 3JAMM 1YIJF 3PAFA 3ON1A 3CC2F 5GINC 1YHQF 3G71F 5FLXM 1S72F 1CK2A 5DCVA 3SIUA 5FJ4C 2I6DA 1VQ8F 3NMUC 5EWRA 3OW2F 2FC3A 1YJWF 3V7QA 3LWQC 4C4WC 3N4ZA 5GIPC 1VQ7F 3NK7A 3E1YA 1VQOF 1Q82H 1VQ9F 3IR9A 3NK6A 3CXCF 3CCRF 1VQ4F 3HJWC 5EO3A 1ZWZA 1GO1A 3HAXD 3CCLF 3CPQA 2VGNA 3LWVC 1XBIA 3GYQA 3FFMA 1VQPF 1SDSA 3J81M 1M90H 2OTJF 2JNBA 3G4SF 3CMEF 5G4UC 3CCUF 1Q7YH 2OTLF 4BY9D 3JCMM 1Q86H
chains in the Genus database with same CATH superfamily
4ZI7A 5BMVA 1YJNF 1NJIH 4RQOA 1KC8H 3J80M 3N4YA 2GLZA 4C8GA 4BVRA 1FNJA 1GZ0A 4BW0B 1W2BF 1W57A 5FNVB 3GTZA 3VI6A 4B62A 5ITZB 1JFFB 4ZOLA 2CVLA 1CN7A 5JCOC 1K9MH 3JASB 2CW4A 1IV4A 4O4IA 4U3JA 5LYJB 2L26A 3CCMF 3KJKA 5IT9M 1RA4A 2OZBA 1W40A 1JY8A 2BTOA 1W42A 2WALA 3JAWA 5J2TB 4X1YB 1W5FA 4ZHVA 4TV8B 2LBTA 3I7TA 5B8FA 2HVYD 2W8BC 3M4SA 1FFXA 2PMPA 4EB6B 3JALB 5LXTB 1H7MA 4I50B 2UYNB 3AGKA 2BO1A 5MN5A 2AMTA 2VGMA 2R6R1 5LP6C 4XCQA 4C8IA 1JD1A 5EZYB 3DDNA 3L7QA 4G88A 2CZWA 3MQWA 1UFYA 3V7EA 3JVHA 1QAHA 4I4TA 1COMA 2AIFA 2CWJA 3TD4A 4KWEA 4ZHQA 1X25A 3CYQA 2QA4F 4YJ2A 4O2BA 3CG6A 2V9YA 5EB1B 1Z5WA 3P0ZA 4EI9A 3ZP4A 5KX5A 3B6NA 3HKCA 1JN1A 3ZOPA 3MCQA 2ZODA 4O2AB 3RYIA 1Q8RA 2QTPA 1IV1A 3C9UA 2LBWA 4G4WA 5HXZA 1YIJF 5GINC 1YHQF 3G71F 3K0TA 2F9ZC 1S72F 1CK2A 3RYCA 3UT5A 2ZVYA 1TVKA 1XHOA 3WJRA 2HQSC 1DBFA 1VQ8F 2HRUA 3JATB 2FC3A 5LA6A 4C4WC 3N4ZA 5GIPC 1VQ9F 2GVIA 2CHSA 1W5EA 1VQ4F 5HP7A 2YYEA 1GO1A 5JVDB 4ZHYB 5JH7B 4G4XA 1H48A 3HAXD 3CPQA 3F0FA 1U43A 2VGNA 3LWVC 1IV2A 4TUYA 5C8YA 3G4SF 3CMEF 3CYPB 3E22A 3JCMM 5LP6B 3M84A 1VH8A 4I55B 1YJ9F 3N2KB 3JAKA 3RA5A 2RB9A 1YITF 5EAZA 1QVFF 1KQSF 2VAWA 1KD1H 3HKBA 1VQLF 3EORA 2UYJA 3F0EA 1J7HA 1VQ5F 3D54A 3JARA 4NWOB 5CA1B 3LDTA 1QVGF 3S0YA 5A2QM 3O85A 1X7OA 3HTNA 1NMUB 5GONB 3WPXA 4FFBA 4G4YA 3MCAB 4HNAB 4X3MA 2BTUA 5GANK 4O4HA 1T0AA 4DRXA 2EWCA 1DT9A 5MN6A 3LMEA 2Q1YA 3LFOA 3NVKE 3VMFB 2VAPA 1TUBA 3CCVF 1T0KB 5HP8A 3HKDA 3E20B 1VQNF 1PXWA 2R751 2OHWA 5HY1A 4U39A 1K8AH 3CCSF 5EYPA 1GO0A 1N8RH 5IYZB 3D00A 1YI2F 3S06A 2VXYA 1FSZA 3N2GA 2QI2A 1GX1A 2CSLA 2KTVA 2Z1TA 1VQKF 4IHJB 2ZAUA 2ZF8A 1R1MA 3OBWA 4O4JA 3V4DA 1CLIA 2HP0B 3RYFA 3VYTC 4O4LA 5IJ9B 3ERNA 2KTUA 4TV9B 5CA0B 1W5BA 4YJ3A 5JCOA 4PWTA 4IIJA 4B5CA 4X3LA 5GIOC 3M1XA 4C8EA 3HKEB 4X1KB 3ON1A 4WBNB 3FD5A 5AVMA 1UI9A 4BT5A 5KMGB 3S0WA 3K2XA 5FLXM 3WGNA 4F6RB 1U40A 3MDOA 4DXDA 3SIUA 5IJ0B 5EIBC 3V7QA 4X1IA 3LWQC 5CB4A 2N48A 2Z1FA 1VQOF 1Q82H 3IR9A 4M8IA 3IEQA 2H8CA 3NK6A 3HJWC 5J2UB 1ZWZA 5LOVB 5LP6A 4X20B 4ZI7B 5BMVB 2NMUA 2Z1UA 3GYQA 3K12A 3KJJA 3P4EA 1SA0A 2IQQA 4ZOLB 1RQ7A 2OTJF 1ONIA 1W59A 5G4UC 4G4ZA 3IEWA 4O4IB 4U3JB 4BY9D 2GZLA 4R40B 3P10A 1YQNA 4NUTA 2HP3A 3C9RA 3JAWB 3WGJA 3G6EF 2BTQB 3CCJF 2IAFA 5JQGA 3WXMB 1FFXB 3PLAC 3F6MA 1Q81H 3VYSC 3CCEF 1SZQA 1JJ2F 1KNKA 3TD3A 3S0HA 3K14A 5FNVA 5ITZA 1PF5A 4ZK7A 1JFFA 1W3EX 3JASA 2KG4A 4I4TB 5LYJA 3RE3A 5HXUA 3CCQF 1QD9A 3I55F 2Z01A 4BVTA 4ZHQB 2K1SA 1NQ3A 2H8EA 5J2TA 4X1YA 3IMPA 4TV8A 3ZP7A 3CC4F 4YJ2B 4O2BB 3IKEA 3VIUA 4BT2A 3S03A 1X7PA 4BT4A 5KX5B 2PHNA 4EB6A 3HKCB 5IJ9A 1E7KA 3JALA 4LNUB 1YGYA 5LXTA 3WPWA 4I50A 4C82A 2UYNA 3RYIB 2DT4A 2ALEA 3KHNA 3ELCA 3VYUC 5G4VC 3VTIC 5EZYA 1M1KH 1X52A 3RYCB 3UT5B 1K73H 1TVKB 1U3LA 3CD6F 1Z5VA 4C81A 4E6EA 2P6YA 3PAFA 3QHDA 2YXZA 1OFUA 5LA6B 3WJQA 4EI8A 5DCVA 1VHAA 2RHLA 3T80A 5EB0A 3KIZA 3LYBA 2ZVZA 5HY2A 5FJ4C 4O2AA 2G9IA 2HS4A 3NMUC 1XRGA 5EWRA 3RYHB 3OW2F 2HS3A 1YJWF 1VQ7F 2MQEA 4TUYB 5MN4A 3CXCF 3TD5A 5C8YB 3CCRF 2RHHA 3E22B 4B46A 3F0DA 3CCLF 3JAKB 3JATA 3FFMA 3HKBB 1VQPF 1SDSA 3J81M 1M90H 3CCUF 1Q7YH 1Q86H 3JARB 3R0PA 5JVDA 5JH7A 3C9SA 3J7AR 2DYYA 3SIVA 3OONA 3ZO8A 5HWEA 2AIZP 4BVSA 3LWPC 3I56F 2QEXF 3F0GA 2CHTA 4FFBB 3FPIA 3MBMA 4ZHWA 4O4HB 3WGKA 4DRXB 1VQ6F 4I55A 5GAPK 2OTMA 3N2KA 3WGMA 5HY0A 1TUBB 4TZZA 1VQMF 2B33A 3HKDB 1FNKA 1KNJA 3WGLA 4EI7A 1RQ2A 1W55A 1OAPA 1IPAA 5EYPB 3CMAF 5CA1A 4LNUA 3RA6A 3N2GB 1QU9A 5LOVA 4LCKA 3U0OA 5GONA 4O4JB 2HS0A 4HNAA 3OBYA 3RYFB 2VAMA 1W41A 3LWOC 5EIBD 4O4LB 3LWRC 1W581 1RLUA 3D01A 3C8LA 3FD6A 4YJ3B 4G4VA 3CPWF 2LBXA 3QUWA 4IIJB 3VOBA 3FBAA 4RHAA 2Q1XA 3NVIB 4BVQA 3CC7F 1RLGA 3WJPA 1W5AA 4BT6A 3BYQA 3VOAA 5IYZA 2HRYA 3CB2A 2HX0A 2UYKA 3C9TA 4IHJA 2I6RA 3RYHA 3JAMM 4X1IB 3CC2F 2HP0A 5CB4B 2Z1EA 2ZOVA 1VK3A 2KGWA 2RHJA 3VCZA 1VQVA 4TV9A 1U3PA 5CA0A 4NQ3A 4B45A 3QTYA 2I6DA 2H6LA 3I3FA 1IV3A 3HKEA 3HWUA 4X1KA 4WBNA 5KMGA 1H47A 3NK7A 3E1YA 3V3TA 3S02A 1SA0B 3KE1A 3DC2A 4F6RA 1XV2A 2FGYA 5EO3A 2LCAA 1ODEA 4BT3A 2UZHA 5IJ0A 3Q8HA 5HY4A 1XBIA 2RHOA 2UYPA 3GHZA 3IKFA 3ESJA 2JNBA 3VO8A 5JQGB 2OTLF 4ERHA 5J2UA 4BT7A 2IG8A 4X20A
chains in the Genus database with same CATH topology
1YJNF 1NJIH 1YJ9F 1KC8H 3J7AR 3J80M 3N4YA 2GLZA 3SIVA 3RA5A 1YITF 4NUTA 4BVRA 1GZ0A 4BW0B 5HWEA 4BVSA 3LWPC 1W2BF 1QVFF 1KQSF 3VI6A 3I56F 1KD1H 2QEXF 1VQLF 3G6EF 1CN7A 1K9MH 3CCJF 1VQ5F 3WXMB 3PLAC 1VQ6F 1Q81H 5GAPK 3CCMF 3CCEF 5IT9M 1RA4A 2OZBA 1JJ2F 1W40A 1QVGF 5A2QM 1W42A 3O85A 5HY0A 4TZZA 1VQMF 2WALA 1X7OA 1NMUB 4X3MA 4EI7A 3MCAB 2HVYD 1W3EX 5GANK 2KG4A 1IPAA 3CMAF 3CCQF 5HXUA 1DT9A 3I55F 3RA6A 1H7MA 3LFOA 4BVTA 3NVKE 3VMFB 3AGKA 3CCVF 1T0KB 2BO1A 2VGMA 4LCKA 3E20B 3CC4F 1VQNF 4XCQA 1PXWA 3OBYA 1W41A 2OHWA 2CZWA 1X7PA 5HY1A 3LWOC 3LWRC 3V7EA 1K8AH 3CCSF 1E7KA 2AIFA 1N8RH 1GO0A 3D00A 1YI2F 2QI2A 3CPWF 2KTVA 2LBXA 2ALEA 2QA4F 1VQKF 5G4VC 3NVIB 3OBWA 4BVQA 3CC7F 1RLGA 3CG6A 1M1KH 1X52A 4EI9A 2KTUA 1K73H 3CD6F 2LBWA 4X3LA 5GIOC 3JAMM 5HXZA 1YIJF 3PAFA 3ON1A 3CC2F 5GINC 1YHQF 3G71F 5FLXM 2F9ZC 1S72F 1CK2A 4EI8A 5DCVA 3SIUA 5HY2A 5FJ4C 4NQ3A 2I6DA 1VQ8F 3NMUC 5EWRA 3OW2F 2FC3A 1YJWF 3V7QA 3LWQC 4C4WC 3N4ZA 5GIPC 1VQ7F 3NK7A 3E1YA 1VQOF 1Q82H 1VQ9F 3V3TA 3IR9A 3NK6A 3CXCF 3CCRF 1VQ4F 2FGYA 3HJWC 5EO3A 1ZWZA 1GO1A 3HAXD 3CCLF 3CPQA 2VGNA 3LWVC 5HY4A 1XBIA 3GYQA 3FFMA 1VQPF 1SDSA 3J81M 1M90H 2OTJF 2JNBA 3G4SF 3CMEF 5G4UC 3CCUF 1Q7YH 2OTLF 4BY9D 3JCMM 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN F;  1NJI H;  1YJ9 F;  1KC8 H;  3J7A R;  3J80 M;  3N4Y A;  3SIV A;  3RA5 A;  1YIT F;  4NUT A;  1GZ0 A;  4BW0 B;  1W2B F;  3LWP C;  1QVF F;  1KQS F;  3VI6 A;  3I56 F;  1KD1 H;  2QEX F;  1VQL F;  3G6E F;  1CN7 A;  1K9M H;  3CCJ F;  1VQ5 F;  3WXM B;  3PLA C;  1VQ6 F;  1Q81 H;  5GAP K;  3CCM F;  3CCE F;  5IT9 M;  1RA4 A;  2OZB A;  1JJ2 F;  1W40 A;  1QVG F;  5A2Q M;  1W42 A;  3O85 A;  4TZZ A;  1VQM F;  2WAL A;  1X7O A;  1NMU B;  4X3M A;  3MCA B;  2HVY D;  5GAN K;  1W3E X;  2KG4 A;  1IPA A;  3CMA F;  3CCQ F;  1DT9 A;  3I55 F;  3RA6 A;  1H7M A;  3LFO A;  3NVK E;  3VMF B;  3AGK A;  3CCV F;  1T0K B;  2BO1 A;  2VGM A;  4LCK A;  3E20 B;  3CC4 F;  1VQN F;  1PXW A;  3OBY A;  1W41 A;  2OHW A;  2CZW A;  1X7P A;  3LWO C;  3V7E A;  3LWR C;  1K8A H;  3CCS F;  1E7K A;  2AIF A;  1N8R H;  1GO0 A;  1YI2 F;  2QI2 A;  3CPW F;  2KTV A;  2LBX A;  2ALE A;  2QA4 F;  1VQK F;  5G4V C;  3NVI B;  3OBW A;  3CC7 F;  1RLG A;  3CG6 A;  1M1K H;  1X52 A;  2KTU A;  1K73 H;  3CD6 F;  2LBW A;  4X3L A;  5GIO C;  3JAM M;  1YIJ F;  3PAF A;  3ON1 A;  3CC2 F;  5GIN C;  1YHQ F;  3G71 F;  5FLX M;  1S72 F;  1CK2 A;  5DCV A;  3SIU A;  5FJ4 C;  2I6D A;  1VQ8 F;  3NMU C;  5EWR A;  3OW2 F;  2FC3 A;  1YJW F;  3V7Q A;  3LWQ C;  4C4W C;  3N4Z A;  5GIP C;  1VQ7 F;  3NK7 A;  3E1Y A;  1VQO F;  1Q82 H;  1VQ9 F;  3IR9 A;  3NK6 A;  3CXC F;  3CCR F;  1VQ4 F;  3HJW C;  5EO3 A;  1ZWZ A;  1GO1 A;  3HAX D;  3CCL F;  3CPQ A;  2VGN A;  3LWV C;  1XBI A;  3GYQ A;  3FFM A;  1VQP F;  1SDS A;  3J81 M;  1M90 H;  2OTJ F;  2JNB A;  3G4S F;  3CME F;  5G4U C;  3CCU F;  1Q7Y H;  2OTL F;  4BY9 D;  3JCM M;  1Q86 H; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  5BMV A;  1YJN F;  1NJI H;  4RQO A;  1KC8 H;  3J80 M;  3N4Y A;  2GLZ A;  4C8G A;  4BVR A;  1FNJ A;  1GZ0 A;  4BW0 B;  1W2B F;  1W57 A;  5FNV B;  3GTZ A;  3VI6 A;  4B62 A;  5ITZ B;  1JFF B;  4ZOL A;  2CVL A;  1CN7 A;  5JCO C;  1K9M H;  3JAS B;  2CW4 A;  1IV4 A;  4O4I A;  4U3J A;  5LYJ B;  2L26 A;  3CCM F;  3KJK A;  5IT9 M;  1RA4 A;  2OZB A;  1W40 A;  1JY8 A;  2BTO A;  1W42 A;  2WAL A;  3JAW A;  5J2T B;  4X1Y B;  1W5F A;  4ZHV A;  4TV8 B;  2LBT A;  3I7T A;  5B8F A;  2HVY D;  2W8B C;  3M4S A;  1FFX A;  2PMP A;  4EB6 B;  3JAL B;  5LXT B;  1H7M A;  4I50 B;  2UYN B;  3AGK A;  2BO1 A;  5MN5 A;  2AMT A;  2VGM A;  2R6R 1;  5LP6 C;  4XCQ A;  4C8I A;  1JD1 A;  5EZY B;  3DDN A;  3L7Q A;  4G88 A;  2CZW A;  3MQW A;  1UFY A;  3V7E A;  3JVH A;  1QAH A;  4I4T A;  1COM A;  2AIF A;  2CWJ A;  3TD4 A;  4KWE A;  4ZHQ A;  1X25 A;  3CYQ A;  2QA4 F;  4YJ2 A;  4O2B A;  3CG6 A;  2V9Y A;  5EB1 B;  1Z5W A;  3P0Z A;  4EI9 A;  3ZP4 A;  5KX5 A;  3B6N A;  3HKC A;  1JN1 A;  3ZOP A;  3MCQ A;  2ZOD A;  4O2A B;  3RYI A;  1Q8R A;  2QTP A;  1IV1 A;  3C9U A;  2LBW A;  4G4W A;  5HXZ A;  1YIJ F;  5GIN C;  1YHQ F;  3G71 F;  3K0T A;  2F9Z C;  1S72 F;  1CK2 A;  3RYC A;  3UT5 A;  2ZVY A;  1TVK A;  1XHO A;  3WJR A;  2HQS C;  1DBF A;  1VQ8 F;  2HRU A;  3JAT B;  2FC3 A;  5LA6 A;  4C4W C;  3N4Z A;  5GIP C;  1VQ9 F;  2GVI A;  2CHS A;  1W5E A;  1VQ4 F;  5HP7 A;  2YYE A;  1GO1 A;  5JVD B;  4ZHY B;  5JH7 B;  4G4X A;  1H48 A;  3HAX D;  3CPQ A;  3F0F A;  1U43 A;  2VGN A;  3LWV C;  1IV2 A;  4TUY A;  5C8Y A;  3G4S F;  3CME F;  3CYP B;  3E22 A;  3JCM M;  5LP6 B;  3M84 A;  1VH8 A;  4I55 B;  1YJ9 F;  3N2K B;  3JAK A;  3RA5 A;  2RB9 A;  1YIT F;  5EAZ A;  1QVF F;  1KQS F;  2VAW A;  1KD1 H;  3HKB A;  1VQL F;  3EOR A;  2UYJ A;  3F0E A;  1J7H A;  1VQ5 F;  3D54 A;  3JAR A;  4NWO B;  5CA1 B;  3LDT A;  1QVG F;  3S0Y A;  5A2Q M;  3O85 A;  1X7O A;  3HTN A;  1NMU B;  5GON B;  3WPX A;  4FFB A;  4G4Y A;  3MCA B;  4HNA B;  4X3M A;  2BTU A;  5GAN K;  4O4H A;  1T0A A;  4DRX A;  2EWC A;  1DT9 A;  5MN6 A;  3LME A;  2Q1Y A;  3LFO A;  3NVK E;  3VMF B;  2VAP A;  1TUB A;  3CCV F;  1T0K B;  5HP8 A;  3HKD A;  3E20 B;  1VQN F;  1PXW A;  2R75 1;  2OHW A;  5HY1 A;  4U39 A;  1K8A H;  3CCS F;  5EYP A;  1GO0 A;  1N8R H;  5IYZ B;  3D00 A;  1YI2 F;  3S06 A;  2VXY A;  1FSZ A;  3N2G A;  2QI2 A;  1GX1 A;  2CSL A;  2KTV A;  2Z1T A;  1VQK F;  4IHJ B;  2ZAU A;  2ZF8 A;  1R1M A;  3OBW A;  4O4J A;  3V4D A;  1CLI A;  2HP0 B;  3RYF A;  3VYT C;  4O4L A;  5IJ9 B;  3ERN A;  2KTU A;  4TV9 B;  5CA0 B;  1W5B A;  4YJ3 A;  5JCO A;  4PWT A;  4IIJ A;  4B5C A;  4X3L A;  5GIO C;  3M1X A;  4C8E A;  3HKE B;  4X1K B;  3ON1 A;  4WBN B;  3FD5 A;  5AVM A;  1UI9 A;  4BT5 A;  5KMG B;  3S0W A;  3K2X A;  5FLX M;  3WGN A;  4F6R B;  1U40 A;  3MDO A;  4DXD A;  3SIU A;  5IJ0 B;  5EIB C;  3V7Q A;  4X1I A;  3LWQ C;  5CB4 A;  2N48 A;  2Z1F A;  1VQO F;  1Q82 H;  3IR9 A;  4M8I A;  3IEQ A;  2H8C A;  3NK6 A;  3HJW C;  5J2U B;  1ZWZ A;  5LOV B;  5LP6 A;  4X20 B;  4ZI7 B;  5BMV B;  2NMU A;  2Z1U A;  3GYQ A;  3K12 A;  3KJJ A;  3P4E A;  1SA0 A;  2IQQ A;  4ZOL B;  1RQ7 A;  2OTJ F;  1ONI A;  1W59 A;  5G4U C;  4G4Z A;  3IEW A;  4O4I B;  4U3J B;  4BY9 D;  2GZL A;  4R40 B;  3P10 A;  1YQN A;  4NUT A;  2HP3 A;  3C9R A;  3JAW B;  3WGJ A;  3G6E F;  2BTQ B;  3CCJ F;  2IAF A;  5JQG A;  3WXM B;  1FFX B;  3PLA C;  3F6M A;  1Q81 H;  3VYS C;  3CCE F;  1SZQ A;  1JJ2 F;  1KNK A;  3TD3 A;  3S0H A;  3K14 A;  5FNV A;  5ITZ A;  1PF5 A;  4ZK7 A;  1JFF A;  1W3E X;  3JAS A;  2KG4 A;  4I4T B;  5LYJ A;  3RE3 A;  5HXU A;  3CCQ F;  1QD9 A;  3I55 F;  2Z01 A;  4BVT A;  4ZHQ B;  2K1S A;  1NQ3 A;  2H8E A;  5J2T A;  4X1Y A;  3IMP A;  4TV8 A;  3ZP7 A;  3CC4 F;  4YJ2 B;  4O2B B;  3IKE A;  3VIU A;  4BT2 A;  3S03 A;  1X7P A;  4BT4 A;  5KX5 B;  2PHN A;  4EB6 A;  3HKC B;  5IJ9 A;  1E7K A;  3JAL A;  4LNU B;  1YGY A;  5LXT A;  3WPW A;  4I50 A;  4C82 A;  2UYN A;  3RYI B;  2DT4 A;  2ALE A;  3KHN A;  3ELC A;  3VYU C;  5G4V C;  3VTI C;  5EZY A;  1M1K H;  1X52 A;  3RYC B;  3UT5 B;  1K73 H;  1TVK B;  1U3L A;  3CD6 F;  1Z5V A;  4C81 A;  4E6E A;  2P6Y A;  3PAF A;  3QHD A;  2YXZ A;  1OFU A;  5LA6 B;  3WJQ A;  4EI8 A;  5DCV A;  1VHA A;  2RHL A;  3T80 A;  5EB0 A;  3KIZ A;  3LYB A;  2ZVZ A;  5HY2 A;  5FJ4 C;  4O2A A;  2G9I A;  2HS4 A;  3NMU C;  1XRG A;  5EWR A;  3RYH B;  3OW2 F;  2HS3 A;  1YJW F;  1VQ7 F;  2MQE A;  4TUY B;  5MN4 A;  3CXC F;  3TD5 A;  5C8Y B;  3CCR F;  2RHH A;  3E22 B;  4B46 A;  3F0D A;  3CCL F;  3JAK B;  3JAT A;  3FFM A;  3HKB B;  1VQP F;  1SDS A;  3J81 M;  1M90 H;  3CCU F;  1Q7Y H;  1Q86 H;  3JAR B;  3R0P A;  5JVD A;  5JH7 A;  3C9S A;  3J7A R;  2DYY A;  3SIV A;  3OON A;  3ZO8 A;  5HWE A;  2AIZ P;  4BVS A;  3LWP C;  3I56 F;  2QEX F;  3F0G A;  2CHT A;  4FFB B;  3FPI A;  3MBM A;  4ZHW A;  4O4H B;  3WGK A;  4DRX B;  1VQ6 F;  4I55 A;  5GAP K;  2OTM A;  3N2K A;  3WGM A;  5HY0 A;  1TUB B;  4TZZ A;  1VQM F;  2B33 A;  3HKD B;  1FNK A;  1KNJ A;  3WGL A;  4EI7 A;  1RQ2 A;  1W55 A;  1OAP A;  1IPA A;  5EYP B;  3CMA F;  5CA1 A;  4LNU A;  3RA6 A;  3N2G B;  1QU9 A;  5LOV A;  4LCK A;  3U0O A;  5GON A;  4O4J B;  2HS0 A;  4HNA A;  3OBY A;  3RYF B;  2VAM A;  1W41 A;  3LWO C;  5EIB D;  4O4L B;  3LWR C;  1W58 1;  1RLU A;  3D01 A;  3C8L A;  3FD6 A;  4YJ3 B;  4G4V A;  3CPW F;  2LBX A;  3QUW A;  4IIJ B;  3VOB A;  3FBA A;  4RHA A;  2Q1X A;  3NVI B;  4BVQ A;  3CC7 F;  1RLG A;  3WJP A;  1W5A A;  4BT6 A;  3BYQ A;  3VOA A;  5IYZ A;  2HRY A;  3CB2 A;  2HX0 A;  2UYK A;  3C9T A;  4IHJ A;  2I6R A;  3RYH A;  3JAM M;  4X1I B;  3CC2 F;  2HP0 A;  5CB4 B;  2Z1E A;  2ZOV A;  1VK3 A;  2KGW A;  2RHJ A;  3VCZ A;  1VQV A;  4TV9 A;  1U3P A;  5CA0 A;  4NQ3 A;  4B45 A;  3QTY A;  2I6D A;  2H6L A;  3I3F A;  1IV3 A;  3HKE A;  3HWU A;  4X1K A;  4WBN A;  5KMG A;  1H47 A;  3NK7 A;  3E1Y A;  3V3T A;  3S02 A;  1SA0 B;  3KE1 A;  3DC2 A;  4F6R A;  1XV2 A;  2FGY A;  5EO3 A;  2LCA A;  1ODE A;  4BT3 A;  2UZH A;  5IJ0 A;  3Q8H A;  5HY4 A;  1XBI A;  2RHO A;  2UYP A;  3GHZ A;  3IKF A;  3ESJ A;  2JNB A;  3VO8 A;  5JQG B;  2OTL F;  4ERH A;  5J2U A;  4BT7 A;  2IG8 A;  4X20 A; 
#chains in the Genus database with same CATH homology
 1YJN F;  1NJI H;  1YJ9 F;  1KC8 H;  3J7A R;  3J80 M;  3N4Y A;  2GLZ A;  3SIV A;  3RA5 A;  1YIT F;  4NUT A;  4BVR A;  1GZ0 A;  4BW0 B;  5HWE A;  4BVS A;  3LWP C;  1W2B F;  1QVF F;  1KQS F;  3VI6 A;  3I56 F;  1KD1 H;  2QEX F;  1VQL F;  3G6E F;  1CN7 A;  1K9M H;  3CCJ F;  1VQ5 F;  3WXM B;  3PLA C;  1VQ6 F;  1Q81 H;  5GAP K;  3CCM F;  3CCE F;  5IT9 M;  1RA4 A;  2OZB A;  1JJ2 F;  1W40 A;  1QVG F;  5A2Q M;  1W42 A;  3O85 A;  5HY0 A;  4TZZ A;  1VQM F;  2WAL A;  1X7O A;  1NMU B;  4X3M A;  4EI7 A;  3MCA B;  2HVY D;  1W3E X;  5GAN K;  2KG4 A;  1IPA A;  3CMA F;  3CCQ F;  5HXU A;  1DT9 A;  3I55 F;  3RA6 A;  1H7M A;  3LFO A;  4BVT A;  3NVK E;  3VMF B;  3AGK A;  3CCV F;  1T0K B;  2BO1 A;  2VGM A;  4LCK A;  3E20 B;  3CC4 F;  1VQN F;  4XCQ A;  1PXW A;  3OBY A;  1W41 A;  2OHW A;  2CZW A;  1X7P A;  5HY1 A;  3LWO C;  3LWR C;  3V7E A;  1K8A H;  3CCS F;  1E7K A;  2AIF A;  1N8R H;  1GO0 A;  3D00 A;  1YI2 F;  2QI2 A;  3CPW F;  2KTV A;  2LBX A;  2ALE A;  2QA4 F;  1VQK F;  5G4V C;  3NVI B;  3OBW A;  4BVQ A;  3CC7 F;  1RLG A;  3CG6 A;  1M1K H;  1X52 A;  4EI9 A;  2KTU A;  1K73 H;  3CD6 F;  2LBW A;  4X3L A;  5GIO C;  3JAM M;  5HXZ A;  1YIJ F;  3PAF A;  3ON1 A;  3CC2 F;  5GIN C;  1YHQ F;  3G71 F;  5FLX M;  2F9Z C;  1S72 F;  1CK2 A;  4EI8 A;  5DCV A;  3SIU A;  5HY2 A;  5FJ4 C;  4NQ3 A;  2I6D A;  1VQ8 F;  3NMU C;  5EWR A;  3OW2 F;  2FC3 A;  1YJW F;  3V7Q A;  3LWQ C;  4C4W C;  3N4Z A;  5GIP C;  1VQ7 F;  3NK7 A;  3E1Y A;  1VQO F;  1Q82 H;  1VQ9 F;  3V3T A;  3IR9 A;  3NK6 A;  3CXC F;  3CCR F;  1VQ4 F;  2FGY A;  3HJW C;  5EO3 A;  1ZWZ A;  1GO1 A;  3HAX D;  3CCL F;  3CPQ A;  2VGN A;  3LWV C;  5HY4 A;  1XBI A;  3GYQ A;  3FFM A;  1VQP F;  1SDS A;  3J81 M;  1M90 H;  2OTJ F;  2JNB A;  3G4S F;  3CME F;  5G4U C;  3CCU F;  1Q7Y H;  2OTL F;  4BY9 D;  3JCM M;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...