1VQ7F

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vq7F00
4BY9D 2AIFA 1GZ0A 2VGNA 3VI6A 2HVYD 5FJ4C 3AGKA 2BO1A 3OBWA 1YJWF 4LCKA 3GYQA 1VQ6F 3WXMB 3CCMF 3CCUF 2LBWA 1W2BF 2KTVA 3CCEF 1VQKF 1RLGA 3MCAB 5A2QM 2JNBA 3PLAC 1W3EX 3G4SF 1Q7YH 1PXWA 1K73H 5G4VC 1GO0A 1VQLF 1ZWZA 1YITF 1VQ9F 2OHWA 1KC8H 3E20B 3LWRC 2VGMA 3CG6A 1S72F 4BW0B 3J80M 2OTLF 1X7PA 5IT9M 1RA4A 1GO1A 1W41A 3J7AR 1NJIH 1X7OA 3O85A 1T0KB 3OW2F 1CK2A 1E7KA 2ALEA 2I6DA 1M1KH 3CCRF 1VQNF 1YIJF 1NMUB 2OTJF 3IR9A 1VQOF 5GIPC 3PAFA 3CCLF 1W40A 5GAPK 2QEXF 1VQ5F 3CMAF 2KG4A 3CCVF 1YI2F 1X52A 1KQSF 1DT9A 3N4YA 1VQMF 2WALA 3NK6A 5EWRA 3LWVC 3RA6A 3I56F 3LWOC 1YHQF 1CN7A 3NVIB 4X3LA 1M90H 4X3MA 1Q82H 3LFOA 1K9MH 3CXCF 1YJ9F 4NUTA 3NK7A 1VQ7F 3NMUC 3VMFB 1XBIA 3CPWF 3CMEF 3V7EA 1QVGF 5GIOC 1YJNF 1JJ2F 1VQ8F 3FFMA 3CC2F 3JAMM 1VQPF 1IPAA 3HJWC 3E1YA 3LWQC 3N4ZA 3CD6F 2QI2A 2CZWA 1N8RH 4C4WC 3CCQF 3SIUA 1Q86H 3V7QA 1KD1H 1W42A 2FC3A 3CCSF 3SIVA 2OZBA 3CPQA 2KTUA 5G4UC 3CC4F 1K8AH 3ON1A 2QA4F 3CC7F 1QVFF 3OBYA 3RA5A 3I55F 3HAXD 3NVKE 5GANK 5FLXM 3LWPC 5GINC 1SDSA 3CCJF 4TZZA 1Q81H 3J81M 5EO3A 3G71F 5DCVA 2LBXA 3JCMM 1H7MA 3G6EF 1VQ4F
chains in the Genus database with same CATH superfamily
2BTOA 3RYIB 3JARB 3VI6A 2PHNA 2UYNA 2HVYD 5EZYA 2L26A 1YJWF 4YJ3B 3F0GA 2ZVZA 4TV8B 4I4TB 3K14A 3DC2A 4G4ZA 2KTVA 1VH8A 3S0HA 3M1XA 2ZF8A 4IHJA 3KIZA 5B8FA 1RLGA 1W3EX 3F6MA 3ZO8A 4B46A 1Q7YH 5EIBC 4O4IA 1GO0A 3VCZA 3N2GB 4O2AB 2IG8A 2I6RA 5IJ0B 1R1MA 3RYFA 1FNKA 4R40B 1YITF 2CHSA 5LXTA 2CSLA 2Z1EA 1FSZA 4NWOB 3WGLA 4C8IA 3LWRC 4BW0B 3J80M 1X7PA 3JAKB 1KNJA 5IJ9B 2HS3A 4IIJB 3VO8A 4X1KB 3HKEB 3OW2F 5MN6A 3U0OA 3ESJA 2I6DA 1VQNF 1JFFA 4M8IA 1COMA 4FFBB 3MDOA 3Q8HA 2Q1XA 5KMGA 4ZI7B 2H6LA 3UT5B 3JALA 1X52A 1KQSF 3WGNA 5HXUA 1NQ3A 5LA6B 3NK6A 4LNUB 1IV3A 2Z1FA 3JVHA 2KGWA 3IMPA 2HRUA 3GTZA 4G4XA 3LWOC 2HP0B 1M90H 1FFXA 5HY2A 2R751 3C8LA 1QD9A 3KE1A 4G4VA 3JAWB 3CXCF 3NK7A 3JARA 3RYIA 3F0EA 3VMFB 2YYEA 5FNVB 3CMEF 1QVGF 5BMVA 1YJNF 1VQ8F 4TV8A 1W5FA 2UYJA 4I4TA 2QI2A 2CZWA 4WBNB 5MN4A 1W42A 2FC3A 4NQ3A 3L7QA 3LMEA 4O2BB 2ZODA 5LP6A 3CPQA 5CB4B 3CC4F 3N2GA 2QA4F 3FBAA 3BYQA 4O4JB 3MBMA 5IJ0A 1QVFF 3KHNA 5GANK 3ZP4A 4G88A 5FLXM 3N2KB 5CA0B 4TZZA 1ODEA 5JQGB 2LBXA 4U39A 1H7MA 1QAHA 3JAKA 5IJ9A 4BY9D 2Q1YA 1GZ0A 3JATB 4IIJA 4X1KA 3HKEA 3VYSC 2ZAUA 3JASB 5EAZA 4TUYB 1IV2A 4FFBA 2AMTA 3GYQA 3QTYA 1W2BF 1T0AA 3CCEF 3KJKA 1OAPA 3UT5A 2CW4A 5KX5B 5HY4A 4O4LB 4DXDA 3RE3A 4B45A 3MCAB 1UFYA 2JNBA 5LA6A 5HWEA 3IKEA 4LNUA 2RHJA 4BT3A 1PXWA 1XV2A 1K73H 4O4HB 2H8CA 2EWCA 4KWEA 2HP0A 2IQQA 3RYHB 4BVTA 1H48A 3IKFA 3JAWA 3C9RA 2VGMA 5J2UB 5EB1B 5C8YA 1S72F 3K12A 2OTLF 5FNVA 1RA4A 1W41A 3J7AR 1X7OA 1T0KB 3S0WA 1TUBB 1VQVA 4WBNA 2ALEA 1YIJF 1NMUB 2NMUA 5AVMA 3E22B 4O2BA 1W581 1VQ5F 2RHOA 3CCVF 3I7TA 2YXZA 3CYPB 5CB4A 4BT7A 3N4YA 2R6R1 3I56F 3D01A 3ELCA 3N2KA 5CA0A 4BVSA 2H8EA 1VK3A 5JQGA 1Q82H 4ZHVA 2AIZP 2K1SA 3HKDB 1K9MH 2DT4A 3HKBB 3JATA 5HY0A 4YJ2B 4F6RA 1XBIA 3JASA 4TUYA 1VQPF 3EORA 3N4ZA 1SA0A 4XCQA 4EI8A 1Q86H 1KD1H 2VAPA 4O4LA 4G4YA 1W5AA 1H47A 3ERNA 3T80A 4BT6A 4DRXB 3SIVA 3D00A 2OZBA 4X20B 4O4HA 3S0YA 3ON1A 4ZHWA 2G9IA 3CB2A 3WPXA 4U3JB 5JVDA 5CA1B 1W5EA 2Z01A 3V4DA 2N48A 3LWPC 5J2UA 1SDSA 3WJQA 5DCVA 4YJ3A 1VQ4F 2IAFA 1JN1A 2HP3A 3D54A 3WJPA 2VGNA 1TUBA 3S06A 1W59A 4EI9A 3OBWA 4BVRA 3I3FA 3LDTA 3WGKA 3CCMF 2LBWA 4TV9B 1TVKB 3VOBA 4O2AA 1VQKF 2ZOVA 2HS4A 1RQ2A 3M84A 5A2QM 1OFUA 3B6NA 1VQLF 1ZWZA 3VOAA 1RQ7A 4RHAA 4HNAB 4EB6B 2V9YA 3HKDA 3GHZA 3E20B 3CG6A 3HKBA 4YJ2A 2OTMA 3MCQA 3WGMA 4B5CA 5IT9M 2VAWA 1PF5A 3TD3A 1NJIH 4ZI7A 1CK2A 3R0PA 2LCAA 2Z1TA 3C9UA 3CYQA 2OTJF 4X1YB 4PWTA 3VYUC 3PAFA 3P0ZA 1W40A 3HKCB 5GAPK 2QEXF 4X1IB 3CMAF 4DRXA 1DBFA 2KG4A 1YI2F 4X20A 1DT9A 3MQWA 1IV1A 1VQMF 5EWRA 4U3JA 4ZK7A 3RA6A 2RB9A 1SZQA 3K0TA 3VYTC 3JALB 2P6YA 3C9SA 3FPIA 2BTQB 3NVIB 3HTNA 4X3MA 5GONB 2CVLA 1U40A 1Z5VA 3LFOA 2HX0A 2DYYA 4NUTA 1VQ7F 5EB0A 3WPWA 1JJ2F 1XHOA 3FFMA 3HJWC 3E1YA 4ZOLB 3HWUA 2HRYA 4ERHA 3QUWA 2PMPA 1TVKA 4TV9A 3CCQF 4BT4A 2UYKA 5JCOA 3C9TA 5BMVB 3V7QA 4O4JA 3TD4A 3CCSF 1ONIA 5LOVB 4I55B 1K8AH 3DDNA 4C82A 5J2TB 4C81A 3OBYA 5EYPB 3RA5A 5JCOC 3HAXD 1W57A 4HNAA 4EB6A 2FGYA 3RYCB 3WGJA 5LP6B 3TD5A 4RQOA 2BTUA 5HP8A 5ITZB 1YQNA 1U43A 5IYZB 2AIFA 4E6EA 3WJRA 5FJ4C 3AGKA 2BO1A 3P4EA 3FD6A 5KX5A 3V3TA 4ZHQB 4X1YA 4LCKA 1VQ6F 4BT2A 2B33A 3WXMB 1UI9A 3CCUF 3HKCA 1Z5WA 4X1IA 3IEWA 5JH7B 2QTPA 5EIBD 3RYHA 4BT5A 3PLAC 2Z1UA 3G4SF 5HY1A 4I50B 4BVQA 5G4VC 1U3PA 1YGYA 2LBTA 1J7HA 2CWJA 5GONA 1VQ9F 2OHWA 2CHTA 1KC8H 2UYPA 1GX1A 5LYJB 3F0DA 2GZLA 2UZHA 3ZOPA 1GO1A 3O85A 5HP7A 3E22A 2UYNB 4ZOLA 2F9ZC 3P10A 5EZYB 1XRGA 1E7KA 5C8YB 1QU9A 1M1KH 3CCRF 4C8GA 3FD5A 1IV4A 1W5BA 3IR9A 1VQOF 4C8EA 2ZVYA 5LOVA 5GIPC 3CCLF 1JD1A 1JY8A 4I55A 3VIUA 5MN5A 4IHJB 4ZHYB 5J2TA 2WALA 2W8BC 5EYPA 3LWVC 2RHHA 4O4IB 1KNKA 3RYCA 2HQSC 1W55A 2RHLA 1YHQF 1CN7A 4X3LA 3RYFB 5ITZA 1Q8RA 5IYZA 5LXTB 1RLUA 2VAMA 1YJ9F 3NMUC 2GLZA 1FNJA 3CPWF 5HXZA 3LYBA 3V7EA 5GIOC 3QHDA 5LP6C 4ZHQA 3CC2F 3OONA 4B62A 3JAMM 1IPAA 3S03A 3LWQC 3CD6F 1N8RH 3S02A 4C4WC 3VTIC 1JFFB 4F6RB 1X25A 3SIUA 3K2XA 5JH7A 5KMGB 5CA1A 1SA0B 1CLIA 3KJJA 4I50A 2KTUA 5G4UC 3F0FA 4G4WA 3CC7F 1VHAA 2HS0A 3ZP7A 1U3LA 3I55F 3NVKE 2GVIA 4EI7A 2MQEA 5GINC 2VXYA 3CCJF 5LYJA 1Q81H 3J81M 3IEQA 1FFXB 5EO3A 3G71F 3JCMM 3G6EF 3M4SA 5JVDB
chains in the Genus database with same CATH topology
4BY9D 2AIFA 1GZ0A 2VGNA 3VI6A 2HVYD 5FJ4C 3AGKA 2BO1A 4EI9A 3OBWA 4BVRA 1YJWF 3V3TA 4LCKA 3GYQA 1VQ6F 3WXMB 3CCMF 3CCUF 2LBWA 1W2BF 2KTVA 3CCEF 1VQKF 5HY4A 1RLGA 3MCAB 5A2QM 2JNBA 5HWEA 1W3EX 3PLAC 3G4SF 5HY1A 1Q7YH 1PXWA 1K73H 4BVQA 5G4VC 1GO0A 1VQLF 1ZWZA 4BVTA 1YITF 1VQ9F 2OHWA 1KC8H 3E20B 3LWRC 2VGMA 3CG6A 1S72F 4BW0B 3J80M 2OTLF 1X7PA 5IT9M 1RA4A 1GO1A 1W41A 3J7AR 1NJIH 1X7OA 3O85A 1T0KB 3OW2F 1CK2A 2F9ZC 1E7KA 2ALEA 2I6DA 1M1KH 3CCRF 1VQNF 1YIJF 1NMUB 2OTJF 3IR9A 1VQOF 5GIPC 3PAFA 3CCLF 1W40A 5GAPK 2QEXF 1VQ5F 3CMAF 2KG4A 3CCVF 1YI2F 1X52A 1KQSF 1DT9A 3N4YA 5HXUA 1VQMF 2WALA 3NK6A 5EWRA 3LWVC 3RA6A 3I56F 3LWOC 1YHQF 1CN7A 4BVSA 3NVIB 4X3LA 1M90H 4X3MA 1Q82H 5HY2A 3LFOA 1K9MH 3CXCF 1YJ9F 4NUTA 2GLZA 3NK7A 5HY0A 1VQ7F 3NMUC 3VMFB 1XBIA 3CPWF 5HXZA 3CMEF 3V7EA 1QVGF 5GIOC 1YJNF 1JJ2F 1VQ8F 3FFMA 3CC2F 3JAMM 1VQPF 1IPAA 3HJWC 3E1YA 3LWQC 3N4ZA 3CD6F 2QI2A 4XCQA 2CZWA 1N8RH 4C4WC 3CCQF 3SIUA 4EI8A 1Q86H 3V7QA 1KD1H 1W42A 2FC3A 3CCSF 4NQ3A 3SIVA 3D00A 2OZBA 3CPQA 2KTUA 5G4UC 3CC4F 1K8AH 3ON1A 2QA4F 3CC7F 1QVFF 3OBYA 3RA5A 3I55F 3HAXD 3NVKE 5GANK 2FGYA 5FLXM 4EI7A 3LWPC 5GINC 1SDSA 3CCJF 4TZZA 1Q81H 3J81M 5EO3A 3G71F 5DCVA 2LBXA 3JCMM 1H7MA 3G6EF 1VQ4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY9 D;  2AIF A;  1GZ0 A;  2VGN A;  3VI6 A;  2HVY D;  5FJ4 C;  3AGK A;  2BO1 A;  3OBW A;  1YJW F;  4LCK A;  3GYQ A;  1VQ6 F;  3WXM B;  3CCM F;  3CCU F;  2LBW A;  1W2B F;  2KTV A;  3CCE F;  1VQK F;  1RLG A;  3MCA B;  5A2Q M;  2JNB A;  3PLA C;  1W3E X;  3G4S F;  1Q7Y H;  1PXW A;  1K73 H;  5G4V C;  1GO0 A;  1VQL F;  1ZWZ A;  1YIT F;  1VQ9 F;  2OHW A;  1KC8 H;  3E20 B;  3LWR C;  2VGM A;  3CG6 A;  1S72 F;  4BW0 B;  3J80 M;  2OTL F;  1X7P A;  5IT9 M;  1RA4 A;  1GO1 A;  1W41 A;  3J7A R;  1NJI H;  1X7O A;  3O85 A;  1T0K B;  3OW2 F;  1CK2 A;  1E7K A;  2ALE A;  2I6D A;  1M1K H;  3CCR F;  1VQN F;  1YIJ F;  1NMU B;  2OTJ F;  3IR9 A;  1VQO F;  5GIP C;  3PAF A;  3CCL F;  1W40 A;  5GAP K;  2QEX F;  1VQ5 F;  3CMA F;  2KG4 A;  3CCV F;  1YI2 F;  1X52 A;  1KQS F;  1DT9 A;  3N4Y A;  1VQM F;  2WAL A;  3NK6 A;  5EWR A;  3LWV C;  3RA6 A;  3I56 F;  3LWO C;  1YHQ F;  1CN7 A;  3NVI B;  4X3L A;  1M90 H;  4X3M A;  1Q82 H;  3LFO A;  1K9M H;  3CXC F;  1YJ9 F;  4NUT A;  3NK7 A;  1VQ7 F;  3NMU C;  3VMF B;  1XBI A;  3CPW F;  3CME F;  3V7E A;  1QVG F;  5GIO C;  1YJN F;  1JJ2 F;  1VQ8 F;  3FFM A;  3CC2 F;  3JAM M;  1VQP F;  1IPA A;  3HJW C;  3E1Y A;  3LWQ C;  3N4Z A;  3CD6 F;  2QI2 A;  2CZW A;  1N8R H;  4C4W C;  3CCQ F;  3SIU A;  1Q86 H;  3V7Q A;  1KD1 H;  1W42 A;  2FC3 A;  3CCS F;  3SIV A;  2OZB A;  3CPQ A;  2KTU A;  5G4U C;  3CC4 F;  1K8A H;  3ON1 A;  2QA4 F;  3CC7 F;  1QVF F;  3OBY A;  3RA5 A;  3I55 F;  3HAX D;  3NVK E;  5GAN K;  5FLX M;  3LWP C;  5GIN C;  1SDS A;  3CCJ F;  4TZZ A;  1Q81 H;  3J81 M;  5EO3 A;  3G71 F;  5DCV A;  2LBX A;  3JCM M;  1H7M A;  3G6E F;  1VQ4 F; 
#chains in the Genus database with same CATH topology
 2BTO A;  3RYI B;  3JAR B;  3VI6 A;  2PHN A;  2UYN A;  2HVY D;  5EZY A;  2L26 A;  1YJW F;  4YJ3 B;  3F0G A;  2ZVZ A;  4TV8 B;  4I4T B;  3K14 A;  3DC2 A;  4G4Z A;  2KTV A;  1VH8 A;  3S0H A;  3M1X A;  2ZF8 A;  4IHJ A;  3KIZ A;  5B8F A;  1RLG A;  1W3E X;  3F6M A;  3ZO8 A;  4B46 A;  1Q7Y H;  5EIB C;  4O4I A;  1GO0 A;  3VCZ A;  3N2G B;  4O2A B;  2IG8 A;  2I6R A;  5IJ0 B;  1R1M A;  3RYF A;  1FNK A;  4R40 B;  1YIT F;  2CHS A;  5LXT A;  2CSL A;  2Z1E A;  1FSZ A;  4NWO B;  3WGL A;  4C8I A;  3LWR C;  4BW0 B;  3J80 M;  1X7P A;  3JAK B;  1KNJ A;  5IJ9 B;  2HS3 A;  4IIJ B;  3VO8 A;  4X1K B;  3HKE B;  3OW2 F;  5MN6 A;  3U0O A;  3ESJ A;  2I6D A;  1VQN F;  1JFF A;  4M8I A;  1COM A;  4FFB B;  3MDO A;  3Q8H A;  2Q1X A;  5KMG A;  4ZI7 B;  2H6L A;  3UT5 B;  3JAL A;  1X52 A;  1KQS F;  3WGN A;  5HXU A;  1NQ3 A;  5LA6 B;  3NK6 A;  4LNU B;  1IV3 A;  2Z1F A;  3JVH A;  2KGW A;  3IMP A;  2HRU A;  3GTZ A;  4G4X A;  3LWO C;  2HP0 B;  1M90 H;  1FFX A;  5HY2 A;  2R75 1;  3C8L A;  1QD9 A;  3KE1 A;  4G4V A;  3JAW B;  3CXC F;  3NK7 A;  3JAR A;  3RYI A;  3F0E A;  3VMF B;  2YYE A;  5FNV B;  3CME F;  1QVG F;  5BMV A;  1YJN F;  1VQ8 F;  4TV8 A;  1W5F A;  2UYJ A;  4I4T A;  2QI2 A;  2CZW A;  4WBN B;  5MN4 A;  1W42 A;  2FC3 A;  4NQ3 A;  3L7Q A;  3LME A;  4O2B B;  2ZOD A;  5LP6 A;  3CPQ A;  5CB4 B;  3CC4 F;  3N2G A;  2QA4 F;  3FBA A;  3BYQ A;  4O4J B;  3MBM A;  5IJ0 A;  1QVF F;  3KHN A;  5GAN K;  3ZP4 A;  4G88 A;  5FLX M;  3N2K B;  5CA0 B;  4TZZ A;  1ODE A;  5JQG B;  2LBX A;  4U39 A;  1H7M A;  1QAH A;  3JAK A;  5IJ9 A;  4BY9 D;  2Q1Y A;  1GZ0 A;  3JAT B;  4IIJ A;  4X1K A;  3HKE A;  3VYS C;  2ZAU A;  3JAS B;  5EAZ A;  4TUY B;  1IV2 A;  4FFB A;  2AMT A;  3GYQ A;  3QTY A;  1W2B F;  1T0A A;  3CCE F;  3KJK A;  1OAP A;  3UT5 A;  2CW4 A;  5KX5 B;  5HY4 A;  4O4L B;  4DXD A;  3RE3 A;  4B45 A;  3MCA B;  1UFY A;  2JNB A;  5LA6 A;  5HWE A;  3IKE A;  4LNU A;  2RHJ A;  4BT3 A;  1PXW A;  1XV2 A;  1K73 H;  4O4H B;  2H8C A;  2EWC A;  4KWE A;  2HP0 A;  2IQQ A;  3RYH B;  4BVT A;  1H48 A;  3IKF A;  3JAW A;  3C9R A;  2VGM A;  5J2U B;  5EB1 B;  5C8Y A;  1S72 F;  3K12 A;  2OTL F;  5FNV A;  1RA4 A;  1W41 A;  3J7A R;  1X7O A;  1T0K B;  3S0W A;  1TUB B;  1VQV A;  4WBN A;  2ALE A;  1YIJ F;  1NMU B;  2NMU A;  5AVM A;  3E22 B;  4O2B A;  1W58 1;  1VQ5 F;  2RHO A;  3CCV F;  3I7T A;  2YXZ A;  3CYP B;  5CB4 A;  4BT7 A;  3N4Y A;  2R6R 1;  3I56 F;  3D01 A;  3ELC A;  3N2K A;  5CA0 A;  4BVS A;  2H8E A;  1VK3 A;  5JQG A;  1Q82 H;  4ZHV A;  2AIZ P;  2K1S A;  3HKD B;  1K9M H;  2DT4 A;  3HKB B;  3JAT A;  5HY0 A;  4YJ2 B;  4F6R A;  1XBI A;  3JAS A;  4TUY A;  1VQP F;  3EOR A;  3N4Z A;  1SA0 A;  4XCQ A;  4EI8 A;  1Q86 H;  1KD1 H;  2VAP A;  4O4L A;  4G4Y A;  1W5A A;  1H47 A;  3ERN A;  3T80 A;  4BT6 A;  4DRX B;  3SIV A;  3D00 A;  2OZB A;  4X20 B;  4O4H A;  3S0Y A;  3ON1 A;  4ZHW A;  2G9I A;  3CB2 A;  3WPX A;  4U3J B;  5JVD A;  5CA1 B;  1W5E A;  2Z01 A;  3V4D A;  2N48 A;  3LWP C;  5J2U A;  1SDS A;  3WJQ A;  5DCV A;  4YJ3 A;  1VQ4 F;  2IAF A;  1JN1 A;  2HP3 A;  3D54 A;  3WJP A;  2VGN A;  1TUB A;  3S06 A;  1W59 A;  4EI9 A;  3OBW A;  4BVR A;  3I3F A;  3LDT A;  3WGK A;  3CCM F;  2LBW A;  4TV9 B;  1TVK B;  3VOB A;  4O2A A;  1VQK F;  2ZOV A;  2HS4 A;  1RQ2 A;  3M84 A;  5A2Q M;  1OFU A;  3B6N A;  1VQL F;  1ZWZ A;  3VOA A;  1RQ7 A;  4RHA A;  4HNA B;  4EB6 B;  2V9Y A;  3HKD A;  3GHZ A;  3E20 B;  3CG6 A;  3HKB A;  4YJ2 A;  2OTM A;  3MCQ A;  3WGM A;  4B5C A;  5IT9 M;  2VAW A;  1PF5 A;  3TD3 A;  1NJI H;  4ZI7 A;  1CK2 A;  3R0P A;  2LCA A;  2Z1T A;  3C9U A;  3CYQ A;  2OTJ F;  4X1Y B;  4PWT A;  3VYU C;  3PAF A;  3P0Z A;  1W40 A;  3HKC B;  5GAP K;  2QEX F;  4X1I B;  3CMA F;  4DRX A;  1DBF A;  2KG4 A;  1YI2 F;  4X20 A;  1DT9 A;  3MQW A;  1IV1 A;  1VQM F;  5EWR A;  4U3J A;  4ZK7 A;  3RA6 A;  2RB9 A;  1SZQ A;  3K0T A;  3VYT C;  3JAL B;  2P6Y A;  3C9S A;  3FPI A;  2BTQ B;  3NVI B;  3HTN A;  4X3M A;  5GON B;  2CVL A;  1U40 A;  1Z5V A;  3LFO A;  2HX0 A;  2DYY A;  4NUT A;  1VQ7 F;  5EB0 A;  3WPW A;  1JJ2 F;  1XHO A;  3FFM A;  3HJW C;  3E1Y A;  4ZOL B;  3HWU A;  2HRY A;  4ERH A;  3QUW A;  2PMP A;  1TVK A;  4TV9 A;  3CCQ F;  4BT4 A;  2UYK A;  5JCO A;  3C9T A;  5BMV B;  3V7Q A;  4O4J A;  3TD4 A;  3CCS F;  1ONI A;  5LOV B;  4I55 B;  1K8A H;  3DDN A;  4C82 A;  5J2T B;  4C81 A;  3OBY A;  5EYP B;  3RA5 A;  5JCO C;  3HAX D;  1W57 A;  4HNA A;  4EB6 A;  2FGY A;  3RYC B;  3WGJ A;  5LP6 B;  3TD5 A;  4RQO A;  2BTU A;  5HP8 A;  5ITZ B;  1YQN A;  1U43 A;  5IYZ B;  2AIF A;  4E6E A;  3WJR A;  5FJ4 C;  3AGK A;  2BO1 A;  3P4E A;  3FD6 A;  5KX5 A;  3V3T A;  4ZHQ B;  4X1Y A;  4LCK A;  1VQ6 F;  4BT2 A;  2B33 A;  3WXM B;  1UI9 A;  3CCU F;  3HKC A;  1Z5W A;  4X1I A;  3IEW A;  5JH7 B;  2QTP A;  5EIB D;  3RYH A;  4BT5 A;  3PLA C;  2Z1U A;  3G4S F;  5HY1 A;  4I50 B;  4BVQ A;  5G4V C;  1U3P A;  1YGY A;  2LBT A;  1J7H A;  2CWJ A;  5GON A;  1VQ9 F;  2OHW A;  2CHT A;  1KC8 H;  2UYP A;  1GX1 A;  5LYJ B;  3F0D A;  2GZL A;  2UZH A;  3ZOP A;  1GO1 A;  3O85 A;  5HP7 A;  3E22 A;  2UYN B;  4ZOL A;  2F9Z C;  3P10 A;  5EZY B;  1XRG A;  1E7K A;  5C8Y B;  1QU9 A;  1M1K H;  3CCR F;  4C8G A;  3FD5 A;  1IV4 A;  1W5B A;  3IR9 A;  1VQO F;  4C8E A;  2ZVY A;  5LOV A;  5GIP C;  3CCL F;  1JD1 A;  1JY8 A;  4I55 A;  3VIU A;  5MN5 A;  4IHJ B;  4ZHY B;  5J2T A;  2WAL A;  2W8B C;  5EYP A;  3LWV C;  2RHH A;  4O4I B;  1KNK A;  3RYC A;  2HQS C;  1W55 A;  2RHL A;  1YHQ F;  1CN7 A;  4X3L A;  3RYF B;  5ITZ A;  1Q8R A;  5IYZ A;  5LXT B;  1RLU A;  2VAM A;  1YJ9 F;  3NMU C;  2GLZ A;  1FNJ A;  3CPW F;  5HXZ A;  3LYB A;  3V7E A;  5GIO C;  3QHD A;  5LP6 C;  4ZHQ A;  3CC2 F;  3OON A;  4B62 A;  3JAM M;  1IPA A;  3S03 A;  3LWQ C;  3CD6 F;  1N8R H;  3S02 A;  4C4W C;  3VTI C;  1JFF B;  4F6R B;  1X25 A;  3SIU A;  3K2X A;  5JH7 A;  5KMG B;  5CA1 A;  1SA0 B;  1CLI A;  3KJJ A;  4I50 A;  2KTU A;  5G4U C;  3F0F A;  4G4W A;  3CC7 F;  1VHA A;  2HS0 A;  3ZP7 A;  1U3L A;  3I55 F;  3NVK E;  2GVI A;  4EI7 A;  2MQE A;  5GIN C;  2VXY A;  3CCJ F;  5LYJ A;  1Q81 H;  3J81 M;  3IEQ A;  1FFX B;  5EO3 A;  3G71 F;  3JCM M;  3G6E F;  3M4S A;  5JVD B; 
#chains in the Genus database with same CATH homology
 4BY9 D;  2AIF A;  1GZ0 A;  2VGN A;  3VI6 A;  2HVY D;  5FJ4 C;  3AGK A;  2BO1 A;  4EI9 A;  3OBW A;  4BVR A;  1YJW F;  3V3T A;  4LCK A;  3GYQ A;  1VQ6 F;  3WXM B;  3CCM F;  3CCU F;  2LBW A;  1W2B F;  2KTV A;  3CCE F;  1VQK F;  5HY4 A;  1RLG A;  3MCA B;  5A2Q M;  2JNB A;  5HWE A;  1W3E X;  3PLA C;  3G4S F;  5HY1 A;  1Q7Y H;  1PXW A;  1K73 H;  4BVQ A;  5G4V C;  1GO0 A;  1VQL F;  1ZWZ A;  4BVT A;  1YIT F;  1VQ9 F;  2OHW A;  1KC8 H;  3E20 B;  3LWR C;  2VGM A;  3CG6 A;  1S72 F;  4BW0 B;  3J80 M;  2OTL F;  1X7P A;  5IT9 M;  1RA4 A;  1GO1 A;  1W41 A;  3J7A R;  1NJI H;  1X7O A;  3O85 A;  1T0K B;  3OW2 F;  1CK2 A;  2F9Z C;  1E7K A;  2ALE A;  2I6D A;  1M1K H;  3CCR F;  1VQN F;  1YIJ F;  1NMU B;  2OTJ F;  3IR9 A;  1VQO F;  5GIP C;  3PAF A;  3CCL F;  1W40 A;  5GAP K;  2QEX F;  1VQ5 F;  3CMA F;  2KG4 A;  3CCV F;  1YI2 F;  1X52 A;  1KQS F;  1DT9 A;  3N4Y A;  5HXU A;  1VQM F;  2WAL A;  3NK6 A;  5EWR A;  3LWV C;  3RA6 A;  3I56 F;  3LWO C;  1YHQ F;  1CN7 A;  4BVS A;  3NVI B;  4X3L A;  1M90 H;  4X3M A;  1Q82 H;  5HY2 A;  3LFO A;  1K9M H;  3CXC F;  1YJ9 F;  4NUT A;  2GLZ A;  3NK7 A;  5HY0 A;  1VQ7 F;  3NMU C;  3VMF B;  1XBI A;  3CPW F;  5HXZ A;  3CME F;  3V7E A;  1QVG F;  5GIO C;  1YJN F;  1JJ2 F;  1VQ8 F;  3FFM A;  3CC2 F;  3JAM M;  1VQP F;  1IPA A;  3HJW C;  3E1Y A;  3LWQ C;  3N4Z A;  3CD6 F;  2QI2 A;  4XCQ A;  2CZW A;  1N8R H;  4C4W C;  3CCQ F;  3SIU A;  4EI8 A;  1Q86 H;  3V7Q A;  1KD1 H;  1W42 A;  2FC3 A;  3CCS F;  4NQ3 A;  3SIV A;  3D00 A;  2OZB A;  3CPQ A;  2KTU A;  5G4U C;  3CC4 F;  1K8A H;  3ON1 A;  2QA4 F;  3CC7 F;  1QVF F;  3OBY A;  3RA5 A;  3I55 F;  3HAX D;  3NVK E;  5GAN K;  2FGY A;  5FLX M;  4EI7 A;  3LWP C;  5GIN C;  1SDS A;  3CCJ F;  4TZZ A;  1Q81 H;  3J81 M;  5EO3 A;  3G71 F;  5DCV A;  2LBX A;  3JCM M;  1H7M A;  3G6E F;  1VQ4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...