2HP3A

Crystal structure of iminodisuccinate epimerase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
446
structure length
446
Chain Sequence
MFTTKLAEKVVSAWKAKISQPALKAAQDGVIDTVAAALGGVTEHSVQVALKYVAATGGSGDSKLWGVNQRSNMFDAAFVNGMAAHAIDFDDSFPVMRGHPSSSLVPAIFAVGEHVGANGHNCLKSYVLGIEVVATLGRAVGKGHYLAGWHPTSTLGVFGATTAAALLLGADEEQLRNAWGIAASNSCGIIKNFGTMTKPMHTGSAARNGVLSAWLSMQSFTGCQTVFDDAEGILAMYGAQPGPELFNAMQKFGTPWAIIAPGLYKKSWPSCYANHKPLAGLFAIMKEHGLTGQDISHVDVGFLPGVEKPLLYMDPRTTEEAKFSIEANIGAALLDGEVSLASFEIEHLDRPAMRAAMKKVTRFDMPSETTFSGTTGYTDIVVHTADGKIERRIEATPGSLEDPMDDAHLERKFKDCTAWMPFGESGLLFDRLRSLTADQGIKTVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords IDS-epimerase
publication title Three-dimensional Structure of Iminodisuccinate Epimerase Defines the Fold of the MmgE/PrpD Protein Family.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 170
structure length 446
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03972 MmgE_PrpD MmgE/PrpD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4100.10 Mainly Alpha Orthogonal Bundle 2-methylcitrate dehydratase PrpD 2-methylcitrate dehydratase PrpD 2hp3A01
3.30.1330.120 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-methylcitrate dehydratase PrpD 2hp3A02
2HP0A 2HP3A 1SZQA 2HP0B
chains in the Genus database with same CATH superfamily
4IIJA 4E6EA 3I7TA 5LP6A 4ZK7A 3S0YA 3G4SF 1YJ9F 1VQ5F 1QU9A 2UZHA 2HS3A 4B62A 3JAKA 2LBTA 3CYPB 2KTVA 5LP6C 1Q7YH 2RHLA 2VAPA 5MN5A 4O4IA 1IV1A 2CW4A 1KC8H 4LNUA 5HWEA 5HY4A 2AIZP 4I55B 3GTZA 1QD9A 1YIJF 1XHOA 3MCAB 2ZVZA 2UYNB 3CMAF 3CD6F 3LYBA 4O4JB 1X52A 4NQ3A 3JAMM 3D00A 3RYFA 3F0EA 5JVDB 4O4LB 3VOBA 2OTMA 5HY0A 4BT7A 1SDSA 3K12A 3CCJF 3N2KB 1XBIA 2I6DA 3L7QA 2HVYD 5EZYA 5KMGA 1VQKF 2BO1A 1W5AA 3CC7F 1IV4A 4C8GA 1M90H 5EYPB 3JALA 4HNAB 1VK3A 4ZHVA 4ZHWA 4DRXA 3E1YA 3MBMA 1Q86H 5DCVA 3FPIA 3CCVF 4ZOLA 5IJ0A 3P4EA 1VH8A 4TV9A 5CA1B 3CPWF 2IG8A 3EORA 5C8YB 1J7HA 3CCLF 1KNJA 5BMVB 4WBNA 1DT9A 1COMA 5HP8A 3D54A 4DXDA 1YQNA 3OW2F 2DYYA 3UT5B 3P10A 3N2KA 5GINC 5IYZA 3S02A 2HS4A 1VQ6F 3E20B 3K14A 3N2GA 5LA6B 4X20B 5AVMA 3PLAC 1Z5VA 2YYEA 3LWPC 4EI9A 2KTUA 1TVKA 4ZHQA 4G4VA 3VIUA 5J2UA 3HKBA 3CG6A 4BW0B 4R40B 4LCKA 1T0AA 1NQ3A 1H48A 2OZBA 5JCOA 1W40A 3V7QA 1CN7A 5EB1B 5IJ9A 5MN6A 1KNKA 5LXTA 1SA0B 5CB4B 3WJPA 3ZOPA 5G4UC 4XCQA 1JN1A 5A2QM 4I4TB 1RA4A 3LWRC 5JCOC 3HKDB 1IV2A 2RHHA 1W5EA 3M84A 5EWRA 3CYQA 5EO3A 4EB6A 4U39A 5GAPK 1YITF 1TUBA 1SZQA 4BT4A 2LCAA 5LYJB 2VGMA 3MQWA 4PWTA 5J2TA 1K9MH 5GIPC 3F6MA 3ZP7A 2HP0B 4X1KA 2NMUA 3RYCA 4U3JB 1QAHA 2ALEA 5EB0A 3CCUF 1FSZA 1SA0A 1K73H 2L26A 3FBAA 1H47A 3IEWA 3E22B 3NMUC 2YXZA 3F0DA 3TD5A 2Q1YA 4X3LA 2OTLF 3WJQA 4I50A 2ZF8A 1YHQF 3ZP4A 4X1YB 4C81A 1VQOF 3CB2A 1M1KH 4G88A 3JATA 2VAWA 3V3TA 5EIBD 2R751 1W57A 2HRUA 5JH7B 2Z01A 4O2AA 4BT3A 1JY8A 2W8BC 1JFFB 4F6RB 5GONB 4TV8B 3I55F 3P0ZA 1OFUA 2OTJF 4BVRA 1UI9A 1U43A 3T80A 3E22A 2I6RA 3C9RA 5G4VC 3C9TA 2CVLA 2Z1TA 3PAFA 3IKEA 5GIOC 2ZVYA 1W41A 3RYIB 4G4YA 2CZWA 3JASB 3JCMM 1W5BA 2OHWA 5JH7A 4B45A 4B5CA 4C8EA 4I55A 3KHNA 4BVSA 5LOVB 2UYJA 1RLUA 3WJRA 4IHJB 3NVIB 2UYNA 1NMUB 1XV2A 5GONA 5GANK 2DT4A 4O4JA 1YJNF 3VOAA 4TV8A 2Z1FA 3VYUC 3LFOA 5HP7A 3TD3A 2LBXA 5JVDA 4O4LA 3ZO8A 4EI7A 2BTQB 3GYQA 4O4HB 3N4ZA 4TUYB 3QTYA 4X1IB 1FFXB 2HP3A 2GZLA 5FJ4C 2H8EA 2H8CA 4ZI7B 3ERNA 3RYIA 3O85A 5EYPA 4HNAA 4NUTA 2H6LA 3S03A 3OBYA 4YJ2B 3C9UA 3AGKA 3K0TA 5CA0B 4BVQA 5LOVA 3FD5A 4TZZA 4G4XA 5CA1A 3I3FA 1Z5WA 1JD1A 5C8YA 3VTIC 5HY1A 3SIUA 3IEQA 1T0KB 1QVFF 5BMVA 4FFBB 2GLZA 2MQEA 1PXWA 5FNVB 1H7MA 1R1MA 1S72F 1OAPA 5EIBC 3WGNA 3TD4A 5HXUA 3WPWA 4O2BB 1GO1A 3UT5A 3HKCB 3HKEB 2GVIA 3Q8HA 1U3PA 3ESJA 3WGLA 1VQ9F 5LA6A 3NVKE 2R6R1 3RYHB 1KQSF 3K2XA 2FGYA 4X20A 2QI2A 5ITZB 3JAWB 4YJ3B 3VYTC 4YJ2A 3FD6A 3OONA 1X7OA 1Q82H 3VO8A 3KE1A 2QEXF 1VQPF 3IKFA 4IIJB 2LBWA 5LP6B 3WGKA 2HRYA 3BYQA 3N4YA 2HS0A 1ODEA 4BY9D 5CB4A 3JARB 3JAKB 4I4TA 4O2BA 1W5FA 3HKCA 3HKDA 3CC4F 2K1SA 4O4IB 1PF5A 2Z1EA 3G6EF 1FNKA 3V4DA 3V7EA 4LNUB 1Q8RA 3JAWA 2PHNA 3VMFB 4BT5A 4YJ3A 2WALA 5LYJA 3M4SA 3JVHA 1KD1H 3GHZA 4BT6A 3IR9A 2VGNA 3F0FA 3CC2F 3RYFB 2HP0A 1ONIA 3I56F 1W2BF 3U0OA 4U3JA 5MN4A 1X7PA 2UYPA 3D01A 1QVGF 3VYSC 3WPXA 4C82A 3VI6A 1CLIA 4C8IA 4BT2A 4KWEA 3J7AR 3VCZA 3ON1A 1IPAA 1VQ8F 3JARA 4M8IA 2ZOVA 5EZYB 5KMGB 1YJWF 3S06A 1VQNF 5KX5B 1YI2F 3CCQF 4RHAA 2ZAUA 2BTUA 3G71F 1GZ0A 1ZWZA 5IT9M 2HX0A 2IAFA 2V9YA 3CCSF 3JALB 4DRXB 3FFMA 4NWOB 2Z1UA 2EWCA 4BVTA 2RB9A 4X1YA 1W42A 2VXYA 1RQ2A 4ZOLB 5IJ0B 5EAZA 3LMEA 4TV9B 2IQQA 2P6YA 1K8AH 1GX1A 3RE3A 4WBNB 3OBWA 4C4WC 3KIZA 1CK2A 3B6NA 3WGMA 4X3MA 3RA6A 1JFFA 2JNBA 2ZODA 3CPQA 3R0PA 4F6RA 5IYZB 1RLGA 5FLXM 5HY2A 1DBFA 3N2GB 3CCMF 3IMPA 5KX5A 2Q1XA 4RQOA 3C8LA 3F0GA 1VQ4F 3DC2A 1TVKB 3CXCF 4ZHQB 1XRGA 1VQLF 1E7KA 5J2UB 1FNJA 3HKBB 3LWOC 4G4WA 5B8FA 3S0WA 3QUWA 5IJ9B 5JQGB 3SIVA 3JASA 2PMPA 5LXTB 1Q81H 2KGWA 3RA5A 1U40A 1U3LA 3KJKA 4IHJA 2UYKA 3MCQA 1UFYA 3DDNA 2QA4F 2VAMA 3LWQC 1NJIH 3CMEF 4EB6B 3CCEF 1VHAA 4O4HA 3HJWC 1W55A 2RHJA 1TUBB 2QTPA 4TUYA 2N48A 3ELCA 2CHSA 4X1IA 1FFXA 2CHTA 3J81M 3M1XA 2B33A 5J2TB 4G4ZA 4ZI7A 2CWJA 5HXZA 4X1KB 3RYCB 1N8RH 5JQGA 3CCRF 1RQ7A 1IV3A 3QHDA 5CA0A 3HAXD 1VQMF 2HQSC 1W3EX 3NK7A 4EI8A 3KJJA 3MDOA 4FFBA 1JJ2F 5FNVA 3S0HA 4I50B 3LDTA 2RHOA 3HKEA 4ERHA 4ZHYB 3LWVC 2AMTA 3HWUA 2F9ZC 4B46A 3C9SA 3RYHA 3WXMB 3JATB 2KG4A 2AIFA 5ITZA 4O2AB 1W581 1VQVA 3NK6A 1W59A 1GO0A 1VQ7F 1X25A 3J80M 2G9IA 1YGYA 3WGJA 2FC3A 2CSLA 3HTNA 2BTOA
chains in the Genus database with same CATH topology
2HP0A 2HP3A 1SZQA 2HP0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP0 A;  2HP3 A;  1SZQ A;  2HP0 B; 
#chains in the Genus database with same CATH topology
 4IIJ A;  4E6E A;  3I7T A;  5LP6 A;  4ZK7 A;  3S0Y A;  3G4S F;  1YJ9 F;  1VQ5 F;  1QU9 A;  2UZH A;  2HS3 A;  4B62 A;  3JAK A;  2LBT A;  3CYP B;  2KTV A;  5LP6 C;  1Q7Y H;  2RHL A;  2VAP A;  5MN5 A;  4O4I A;  1IV1 A;  2CW4 A;  1KC8 H;  4LNU A;  5HWE A;  5HY4 A;  2AIZ P;  4I55 B;  3GTZ A;  1QD9 A;  1YIJ F;  1XHO A;  3MCA B;  2ZVZ A;  2UYN B;  3CMA F;  3CD6 F;  3LYB A;  4O4J B;  1X52 A;  4NQ3 A;  3JAM M;  3D00 A;  3RYF A;  3F0E A;  5JVD B;  4O4L B;  3VOB A;  2OTM A;  5HY0 A;  4BT7 A;  1SDS A;  3K12 A;  3CCJ F;  3N2K B;  1XBI A;  2I6D A;  3L7Q A;  2HVY D;  5EZY A;  5KMG A;  1VQK F;  2BO1 A;  1W5A A;  3CC7 F;  1IV4 A;  4C8G A;  1M90 H;  5EYP B;  3JAL A;  4HNA B;  1VK3 A;  4ZHV A;  4ZHW A;  4DRX A;  3E1Y A;  3MBM A;  1Q86 H;  5DCV A;  3FPI A;  3CCV F;  4ZOL A;  5IJ0 A;  3P4E A;  1VH8 A;  4TV9 A;  5CA1 B;  3CPW F;  2IG8 A;  3EOR A;  5C8Y B;  1J7H A;  3CCL F;  1KNJ A;  5BMV B;  4WBN A;  1DT9 A;  1COM A;  5HP8 A;  3D54 A;  4DXD A;  1YQN A;  3OW2 F;  2DYY A;  3UT5 B;  3P10 A;  3N2K A;  5GIN C;  5IYZ A;  3S02 A;  2HS4 A;  1VQ6 F;  3E20 B;  3K14 A;  3N2G A;  5LA6 B;  4X20 B;  5AVM A;  3PLA C;  1Z5V A;  2YYE A;  3LWP C;  4EI9 A;  2KTU A;  1TVK A;  4ZHQ A;  4G4V A;  3VIU A;  5J2U A;  3HKB A;  3CG6 A;  4BW0 B;  4R40 B;  4LCK A;  1T0A A;  1NQ3 A;  1H48 A;  2OZB A;  5JCO A;  1W40 A;  3V7Q A;  1CN7 A;  5EB1 B;  5IJ9 A;  5MN6 A;  1KNK A;  5LXT A;  1SA0 B;  5CB4 B;  3WJP A;  3ZOP A;  5G4U C;  4XCQ A;  1JN1 A;  5A2Q M;  4I4T B;  1RA4 A;  3LWR C;  5JCO C;  3HKD B;  1IV2 A;  2RHH A;  1W5E A;  3M84 A;  5EWR A;  3CYQ A;  5EO3 A;  4EB6 A;  4U39 A;  5GAP K;  1YIT F;  1TUB A;  1SZQ A;  4BT4 A;  2LCA A;  5LYJ B;  2VGM A;  3MQW A;  4PWT A;  5J2T A;  1K9M H;  5GIP C;  3F6M A;  3ZP7 A;  2HP0 B;  4X1K A;  2NMU A;  3RYC A;  4U3J B;  1QAH A;  2ALE A;  5EB0 A;  3CCU F;  1FSZ A;  1SA0 A;  1K73 H;  2L26 A;  3FBA A;  1H47 A;  3IEW A;  3E22 B;  3NMU C;  2YXZ A;  3F0D A;  3TD5 A;  2Q1Y A;  4X3L A;  2OTL F;  3WJQ A;  4I50 A;  2ZF8 A;  1YHQ F;  3ZP4 A;  4X1Y B;  4C81 A;  1VQO F;  3CB2 A;  1M1K H;  4G88 A;  3JAT A;  2VAW A;  3V3T A;  5EIB D;  2R75 1;  1W57 A;  2HRU A;  5JH7 B;  2Z01 A;  4O2A A;  4BT3 A;  1JY8 A;  2W8B C;  1JFF B;  4F6R B;  5GON B;  4TV8 B;  3I55 F;  3P0Z A;  1OFU A;  2OTJ F;  4BVR A;  1UI9 A;  1U43 A;  3T80 A;  3E22 A;  2I6R A;  3C9R A;  5G4V C;  3C9T A;  2CVL A;  2Z1T A;  3PAF A;  3IKE A;  5GIO C;  2ZVY A;  1W41 A;  3RYI B;  4G4Y A;  2CZW A;  3JAS B;  3JCM M;  1W5B A;  2OHW A;  5JH7 A;  4B45 A;  4B5C A;  4C8E A;  4I55 A;  3KHN A;  4BVS A;  5LOV B;  2UYJ A;  1RLU A;  3WJR A;  4IHJ B;  3NVI B;  2UYN A;  1NMU B;  1XV2 A;  5GON A;  5GAN K;  2DT4 A;  4O4J A;  1YJN F;  3VOA A;  4TV8 A;  2Z1F A;  3VYU C;  3LFO A;  5HP7 A;  3TD3 A;  2LBX A;  5JVD A;  4O4L A;  3ZO8 A;  4EI7 A;  2BTQ B;  3GYQ A;  4O4H B;  3N4Z A;  4TUY B;  3QTY A;  4X1I B;  1FFX B;  2HP3 A;  2GZL A;  5FJ4 C;  2H8E A;  2H8C A;  4ZI7 B;  3ERN A;  3RYI A;  3O85 A;  5EYP A;  4HNA A;  4NUT A;  2H6L A;  3S03 A;  3OBY A;  4YJ2 B;  3C9U A;  3AGK A;  3K0T A;  5CA0 B;  4BVQ A;  5LOV A;  3FD5 A;  4TZZ A;  4G4X A;  5CA1 A;  3I3F A;  1Z5W A;  1JD1 A;  5C8Y A;  3VTI C;  5HY1 A;  3SIU A;  3IEQ A;  1T0K B;  1QVF F;  5BMV A;  4FFB B;  2GLZ A;  2MQE A;  1PXW A;  5FNV B;  1H7M A;  1R1M A;  1S72 F;  1OAP A;  5EIB C;  3WGN A;  3TD4 A;  5HXU A;  3WPW A;  4O2B B;  1GO1 A;  3UT5 A;  3HKC B;  3HKE B;  2GVI A;  3Q8H A;  1U3P A;  3ESJ A;  3WGL A;  1VQ9 F;  5LA6 A;  3NVK E;  2R6R 1;  3RYH B;  1KQS F;  3K2X A;  2FGY A;  4X20 A;  2QI2 A;  5ITZ B;  3JAW B;  4YJ3 B;  3VYT C;  4YJ2 A;  3FD6 A;  3OON A;  1X7O A;  1Q82 H;  3VO8 A;  3KE1 A;  2QEX F;  1VQP F;  3IKF A;  4IIJ B;  2LBW A;  5LP6 B;  3WGK A;  2HRY A;  3BYQ A;  3N4Y A;  2HS0 A;  1ODE A;  4BY9 D;  5CB4 A;  3JAR B;  3JAK B;  4I4T A;  4O2B A;  1W5F A;  3HKC A;  3HKD A;  3CC4 F;  2K1S A;  4O4I B;  1PF5 A;  2Z1E A;  3G6E F;  1FNK A;  3V4D A;  3V7E A;  4LNU B;  1Q8R A;  3JAW A;  2PHN A;  3VMF B;  4BT5 A;  4YJ3 A;  2WAL A;  5LYJ A;  3M4S A;  3JVH A;  1KD1 H;  3GHZ A;  4BT6 A;  3IR9 A;  2VGN A;  3F0F A;  3CC2 F;  3RYF B;  2HP0 A;  1ONI A;  3I56 F;  1W2B F;  3U0O A;  4U3J A;  5MN4 A;  1X7P A;  2UYP A;  3D01 A;  1QVG F;  3VYS C;  3WPX A;  4C82 A;  3VI6 A;  1CLI A;  4C8I A;  4BT2 A;  4KWE A;  3J7A R;  3VCZ A;  3ON1 A;  1IPA A;  1VQ8 F;  3JAR A;  4M8I A;  2ZOV A;  5EZY B;  5KMG B;  1YJW F;  3S06 A;  1VQN F;  5KX5 B;  1YI2 F;  3CCQ F;  4RHA A;  2ZAU A;  2BTU A;  3G71 F;  1GZ0 A;  1ZWZ A;  5IT9 M;  2HX0 A;  2IAF A;  2V9Y A;  3CCS F;  3JAL B;  4DRX B;  3FFM A;  4NWO B;  2Z1U A;  2EWC A;  4BVT A;  2RB9 A;  4X1Y A;  1W42 A;  2VXY A;  1RQ2 A;  4ZOL B;  5IJ0 B;  5EAZ A;  3LME A;  4TV9 B;  2IQQ A;  2P6Y A;  1K8A H;  1GX1 A;  3RE3 A;  4WBN B;  3OBW A;  4C4W C;  3KIZ A;  1CK2 A;  3B6N A;  3WGM A;  4X3M A;  3RA6 A;  1JFF A;  2JNB A;  2ZOD A;  3CPQ A;  3R0P A;  4F6R A;  5IYZ B;  1RLG A;  5FLX M;  5HY2 A;  1DBF A;  3N2G B;  3CCM F;  3IMP A;  5KX5 A;  2Q1X A;  4RQO A;  3C8L A;  3F0G A;  1VQ4 F;  3DC2 A;  1TVK B;  3CXC F;  4ZHQ B;  1XRG A;  1VQL F;  1E7K A;  5J2U B;  1FNJ A;  3HKB B;  3LWO C;  4G4W A;  5B8F A;  3S0W A;  3QUW A;  5IJ9 B;  5JQG B;  3SIV A;  3JAS A;  2PMP A;  5LXT B;  1Q81 H;  2KGW A;  3RA5 A;  1U40 A;  1U3L A;  3KJK A;  4IHJ A;  2UYK A;  3MCQ A;  1UFY A;  3DDN A;  2QA4 F;  2VAM A;  3LWQ C;  1NJI H;  3CME F;  4EB6 B;  3CCE F;  1VHA A;  4O4H A;  3HJW C;  1W55 A;  2RHJ A;  1TUB B;  2QTP A;  4TUY A;  2N48 A;  3ELC A;  2CHS A;  4X1I A;  1FFX A;  2CHT A;  3J81 M;  3M1X A;  2B33 A;  5J2T B;  4G4Z A;  4ZI7 A;  2CWJ A;  5HXZ A;  4X1K B;  3RYC B;  1N8R H;  5JQG A;  3CCR F;  1RQ7 A;  1IV3 A;  3QHD A;  5CA0 A;  3HAX D;  1VQM F;  2HQS C;  1W3E X;  3NK7 A;  4EI8 A;  3KJJ A;  3MDO A;  4FFB A;  1JJ2 F;  5FNV A;  3S0H A;  4I50 B;  3LDT A;  2RHO A;  3HKE A;  4ERH A;  4ZHY B;  3LWV C;  2AMT A;  3HWU A;  2F9Z C;  4B46 A;  3C9S A;  3RYH A;  3WXM B;  3JAT B;  2KG4 A;  2AIF A;  5ITZ A;  4O2A B;  1W58 1;  1VQV A;  3NK6 A;  1W59 A;  1GO0 A;  1VQ7 F;  1X25 A;  3J80 M;  2G9I A;  1YGY A;  3WGJ A;  2FC3 A;  2CSL A;  3HTN A;  2BTO A; 
#chains in the Genus database with same CATH homology
 2HP0 A;  2HP3 A;  1SZQ A;  2HP0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...