2HP3A

Crystal structure of iminodisuccinate epimerase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
446
structure length
446
Chain Sequence
MFTTKLAEKVVSAWKAKISQPALKAAQDGVIDTVAAALGGVTEHSVQVALKYVAATGGSGDSKLWGVNQRSNMFDAAFVNGMAAHAIDFDDSFPVMRGHPSSSLVPAIFAVGEHVGANGHNCLKSYVLGIEVVATLGRAVGKGHYLAGWHPTSTLGVFGATTAAALLLGADEEQLRNAWGIAASNSCGIIKNFGTMTKPMHTGSAARNGVLSAWLSMQSFTGCQTVFDDAEGILAMYGAQPGPELFNAMQKFGTPWAIIAPGLYKKSWPSCYANHKPLAGLFAIMKEHGLTGQDISHVDVGFLPGVEKPLLYMDPRTTEEAKFSIEANIGAALLDGEVSLASFEIEHLDRPAMRAAMKKVTRFDMPSETTFSGTTGYTDIVVHTADGKIERRIEATPGSLEDPMDDAHLERKFKDCTAWMPFGESGLLFDRLRSLTADQGIKTVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional Structure of Iminodisuccinate Epimerase Defines the Fold of the MmgE/PrpD Protein Family.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords IDS-epimerase
total genus 170
structure length 446
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03972 MmgE_PrpD MmgE/PrpD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4100.10 Mainly Alpha Orthogonal Bundle 2-methylcitrate dehydratase PrpD 2-methylcitrate dehydratase PrpD 2hp3A01
3.30.1330.120 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-methylcitrate dehydratase PrpD 2hp3A02
1SZQA 2HP0B 2HP0A 2HP3A
chains in the Genus database with same CATH superfamily
5HY0A 3JARB 2GVIA 3CC4F 3VCZA 2PHNA 3D00A 3M84A 4E6EA 3VOBA 1COMA 3JVHA 1Q82H 1M90H 4IIJA 5IYZB 3SIUA 3P0ZA 4EI8A 1K73H 1GX1A 3ESJA 2K1SA 4TV9A 2BTOA 5ITZB 5AVMA 4O4HB 2UYNA 4ZHYB 2OTMA 1T0AA 3F6MA 3JARA 5FNVA 1KC8H 1W41A 4O2BB 4X1YB 1TVKA 3RYHA 1FNKA 4O4IA 1KNJA 5JCOA 3CCMF 1VH8A 3IKFA 5EO3A 1VQMF 3HKCB 3CPWF 5B8FA 3C9RA 5HY4A 3U0OA 5EB1B 1Q81H 2BTQB 3KJJA 4U3JB 3CCEF 1IPAA 1N8RH 3WXMB 5HP8A 5IJ9A 1FFXA 4X1IA 2IG8A 2GLZA 3P4EA 1K8AH 1QVGF 1W581 1X25A 2FC3A 3VOAA 3CC7F 4B5CA 1PXWA 1QAHA 3F0DA 3KHNA 3E22B 3IR9A 3I56F 2LBXA 4BT2A 4C82A 4BT5A 3ZP7A 1RLGA 3ZOPA 3MCAB 3CC2F 1FFXB 3KE1A 4X1IB 3WPXA 3AGKA 1FNJA 5IYZA 3J80M 4C4WC 2MQEA 5HXUA 2Q1XA 3RE3A 3GYQA 1KD1H 1NMUB 3VYUC 5CA0B 3V7QA 3E22A 5JH7B 4BT7A 5HP7A 1VQKF 1RA4A 1GO1A 2OTJF 1XBIA 3VI6A 3HKBA 1W5BA 2ALEA 4O2AA 1TVKB 3RYHB 4G4XA 3CYPB 3CMEF 2HRYA 3OBYA 2UYJA 1RQ7A 1JJ2F 3MBMA 5LXTB 3C9TA 2ZOVA 3D01A 2R6R1 1SA0B 3TD4A 1NJIH 3B6NA 5JH7A 5DCVA 1CK2A 3NMUC 3PAFA 5LP6B 3CPQA 5KMGB 4BT4A 3S0YA 4F6RB 5LXTA 4O4LB 2V9YA 4C8EA 3CCLF 4KWEA 2H8CA 3J7AR 4RQOA 3MDOA 5GANK 4I55A 5GIOC 4X1KA 3WJRA 4F6RA 2N48A 2HS4A 1PF5A 3TD3A 4G4VA 2QI2A 4NUTA 5KMGA 3KJKA 5HXZA 2EWCA 3IEQA 3BYQA 2ZODA 4TV8A 5FJ4C 2RHOA 1X52A 2I6DA 4WBNB 1JN1A 2I6RA 1T0KB 2Z1UA 1KQSF 4ZHQA 3S0HA 1TUBB 3C9SA 4C81A 3S02A 3VYSC 5G4UC 3L7QA 2YYEA 1IV2A 3IEWA 4X1YA 4BY9D 2KGWA 1K9MH 1JFFA 3RYFB 1FSZA 3S03A 2VAMA 3WGKA 1S72F 4C8GA 5J2TB 3N2GA 4TUYB 4BVSA 4BVRA 2OZBA 2HQSC 5GIPC 4B45A 4LNUB 5EB0A 1OFUA 5EWRA 1R1MA 1W40A 4EB6B 3NVIB 3C8LA 3DC2A 1VQLF 5EYPB 3J81M 3FFMA 1YHQF 1JD1A 3QTYA 4DRXB 1X7OA 1H47A 3I55F 5ITZA 4TZZA 3NK7A 3WJPA 2KG4A 2RHHA 4TV8B 3GHZA 2AIZP 3ON1A 1XHOA 3HWUA 1VK3A 1Q7YH 2HS3A 5CA1A 2WALA 4C8IA 1IV4A 5LP6C 1CN7A 1U3PA 3QUWA 1RLUA 1W42A 2IAFA 5IJ0A 1GO0A 3CCVF 4YJ3A 5HY2A 5MN5A 3WGJA 4O4JB 3M4SA 3JAKA 3HTNA 1W3EX 5GINC 5A2QM 1W59A 3CG6A 3CCSF 3LWOC 3GTZA 1YITF 1W57A 3C9UA 3LFOA 3CD6F 3F0FA 4BT3A 4EI9A 1SZQA 1SA0A 3IKEA 3ELCA 5C8YB 5FNVB 1ODEA 4O4JA 4BW0B 5MN6A 3FBAA 3HAXD 4M8IA 5BMVA 2QEXF 3HKDB 2DYYA 3RA5A 5CA1B 2G9IA 3VMFB 5IJ9B 1VQ9F 1VQPF 2ZF8A 5LYJB 2CHSA 3JAWA 3SIVA 1VQ7F 4U39A 4YJ3B 3TD5A 1U3LA 1JY8A 3JAKB 4BT6A 1W5EA 2JNBA 2KTVA 4ZOLB 1SDSA 2VAWA 3JATA 1TUBA 5GONB 2UYPA 1VQOF 4YJ2B 3RYIB 5EYPA 2Z1TA 1Q86H 3D54A 2RHJA 3P10A 2OHWA 4I4TB 2HP0A 3N2KB 2ZVZA 2LBWA 5EZYA 1H7MA 3Q8HA 5G4VC 5BMVB 1VQ5F 4B46A 1Z5VA 4YJ2A 2VXYA 3RYIA 2HX0A 2HRUA 3G4SF 2AIFA 3RA6A 1KNKA 2UYNB 3CYQA 4O4HA 1QD9A 4ZHQB 3N4YA 4NWOB 4ERHA 5CB4A 3LWPC 1VQ8F 3JAMM 1IV1A 2HP0B 3CXCF 4IHJB 5EIBC 4X20B 3V3TA 2BO1A 3HKEB 5JQGB 3FD5A 3IMPA 2CW4A 5LA6A 1W2BF 2RHLA 2NMUA 3I3FA 3CCUF 1YGYA 1YJ9F 3WGMA 5FLXM 4I55B 5EAZA 4X1KB 4DXDA 5JVDB 3CCJF 1W5AA 2B33A 2ZVYA 4FFBB 5IJ0B 2GZLA 2VAPA 2ZAUA 2QTPA 3FD6A 1ZWZA 1YJWF 3K12A 4ZHVA 2W8BC 5EIBD 5JVDA 1YJNF 1VQ4F 2QA4F 4G4ZA 1ONIA 4I50B 5LOVA 2Z1EA 3KIZA 5EZYB 4X3MA 3F0GA 4HNAB 2R751 4G4YA 1X7PA 4EI7A 1QVFF 3I7TA 3WPWA 2YXZA 2P6YA 3K2XA 3LYBA 3V7EA 2AMTA 3UT5B 1DBFA 1YQNA 3MQWA 3HKBB 2IQQA 3JALA 2F9ZC 4O4LA 1W5FA 1QU9A 5JCOC 5KX5A 5LOVB 3HJWC 4IIJB 3V4DA 3N4ZA 2Z01A 4HNAA 5LA6B 4G88A 1J7HA 4EB6A 2CVLA 1YI2F 4TV9B 3HKDA 4I4TA 3RYCA 2VGNA 5LYJA 3N2KA 1DT9A 3O85A 3ZO8A 4FFBA 1VHAA 2H8EA 3EORA 1Q8RA 3F0EA 3CCRF 3NVKE 1VQ6F 4O2BA 3HKCA 1CLIA 3OONA 3K14A 2CZWA 1JFFB 4XCQA 3RYFA 4PWTA 5C8YA 5GAPK 2Q1YA 2OTLF 3T80A 5GONA 4G4WA 3QHDA 4ZOLA 5JQGA 4LNUA 4NQ3A 3RYCB 2VGMA 4B62A 3S0WA 2HS0A 1GZ0A 3LWVC 3JASB 5J2TA 4X20A 3N2GB 2CSLA 5HY1A 5J2UA 1W55A 1UI9A 3ZP4A 4RHAA 2Z1FA 1NQ3A 4DRXA 4ZI7A 3LWQC 1VQNF 2LCAA 3E20B 4O4IB 1UFYA 1U43A 3JALB 1YIJF 2CWJA 5KX5B 1XV2A 3VTIC 2DT4A 2HVYD 3G71F 4X3LA 3S06A 3JASA 2RB9A 3NK6A 4LCKA 1M1KH 4U3JA 5LP6A 3CMAF 2UYKA 3VIUA 4ZK7A 4IHJA 3FPIA 2CHTA 3LDTA 2LBTA 5CA0A 2BTUA 4I50A 1U40A 2FGYA 1XRGA 3OW2F 3HKEA 3R0PA 5MN4A 4R40B 3DDNA 2HP3A 1E7KA 3OBWA 4WBNA 3UT5A 3M1XA 2KTUA 3MCQA 3LMEA 3CCQF 3PLAC 1OAPA 3JAWB 4BVQA 3E1YA 4ZI7B 5HWEA 1RQ2A 2H6LA 3WJQA 5IT9M 1VQVA 5J2UB 3LWRC 1IV3A 3VO8A 3WGLA 3WGNA 3CB2A 3JATB 5CB4B 4TUYA 2L26A 3VYTC 4BVTA 4ZHWA 2PMPA 3K0TA 3ERNA 1H48A 2UZHA 3JCMM 3G6EF 1Z5WA 4O2AB
chains in the Genus database with same CATH topology
1SZQA 2HP0B 2HP0A 2HP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZQ A;  2HP0 B;  2HP0 A;  2HP3 A; 
#chains in the Genus database with same CATH topology
 5HY0 A;  3JAR B;  2GVI A;  3CC4 F;  3VCZ A;  2PHN A;  3D00 A;  3M84 A;  4E6E A;  3VOB A;  1COM A;  3JVH A;  1Q82 H;  1M90 H;  4IIJ A;  5IYZ B;  3SIU A;  3P0Z A;  4EI8 A;  1K73 H;  1GX1 A;  3ESJ A;  2K1S A;  4TV9 A;  2BTO A;  5ITZ B;  5AVM A;  4O4H B;  2UYN A;  4ZHY B;  2OTM A;  1T0A A;  3F6M A;  3JAR A;  5FNV A;  1KC8 H;  1W41 A;  4O2B B;  4X1Y B;  1TVK A;  3RYH A;  1FNK A;  4O4I A;  1KNJ A;  5JCO A;  3CCM F;  1VH8 A;  3IKF A;  5EO3 A;  1VQM F;  3HKC B;  3CPW F;  5B8F A;  3C9R A;  5HY4 A;  3U0O A;  5EB1 B;  1Q81 H;  2BTQ B;  3KJJ A;  4U3J B;  3CCE F;  1IPA A;  1N8R H;  3WXM B;  5HP8 A;  5IJ9 A;  1FFX A;  4X1I A;  2IG8 A;  2GLZ A;  3P4E A;  1K8A H;  1QVG F;  1W58 1;  1X25 A;  2FC3 A;  3VOA A;  3CC7 F;  4B5C A;  1PXW A;  1QAH A;  3F0D A;  3KHN A;  3E22 B;  3IR9 A;  3I56 F;  2LBX A;  4BT2 A;  4C82 A;  4BT5 A;  3ZP7 A;  1RLG A;  3ZOP A;  3MCA B;  3CC2 F;  1FFX B;  3KE1 A;  4X1I B;  3WPX A;  3AGK A;  1FNJ A;  5IYZ A;  3J80 M;  4C4W C;  2MQE A;  5HXU A;  2Q1X A;  3RE3 A;  3GYQ A;  1KD1 H;  1NMU B;  3VYU C;  5CA0 B;  3V7Q A;  3E22 A;  5JH7 B;  4BT7 A;  5HP7 A;  1VQK F;  1RA4 A;  1GO1 A;  2OTJ F;  1XBI A;  3VI6 A;  3HKB A;  1W5B A;  2ALE A;  4O2A A;  1TVK B;  3RYH B;  4G4X A;  3CYP B;  3CME F;  2HRY A;  3OBY A;  2UYJ A;  1RQ7 A;  1JJ2 F;  3MBM A;  5LXT B;  3C9T A;  2ZOV A;  3D01 A;  2R6R 1;  1SA0 B;  3TD4 A;  1NJI H;  3B6N A;  5JH7 A;  5DCV A;  1CK2 A;  3NMU C;  3PAF A;  5LP6 B;  3CPQ A;  5KMG B;  4BT4 A;  3S0Y A;  4F6R B;  5LXT A;  4O4L B;  2V9Y A;  4C8E A;  3CCL F;  4KWE A;  2H8C A;  3J7A R;  4RQO A;  3MDO A;  5GAN K;  4I55 A;  5GIO C;  4X1K A;  3WJR A;  4F6R A;  2N48 A;  2HS4 A;  1PF5 A;  3TD3 A;  4G4V A;  2QI2 A;  4NUT A;  5KMG A;  3KJK A;  5HXZ A;  2EWC A;  3IEQ A;  3BYQ A;  2ZOD A;  4TV8 A;  5FJ4 C;  2RHO A;  1X52 A;  2I6D A;  4WBN B;  1JN1 A;  2I6R A;  1T0K B;  2Z1U A;  1KQS F;  4ZHQ A;  3S0H A;  1TUB B;  3C9S A;  4C81 A;  3S02 A;  3VYS C;  5G4U C;  3L7Q A;  2YYE A;  1IV2 A;  3IEW A;  4X1Y A;  4BY9 D;  2KGW A;  1K9M H;  1JFF A;  3RYF B;  1FSZ A;  3S03 A;  2VAM A;  3WGK A;  1S72 F;  4C8G A;  5J2T B;  3N2G A;  4TUY B;  4BVS A;  4BVR A;  2OZB A;  2HQS C;  5GIP C;  4B45 A;  4LNU B;  5EB0 A;  1OFU A;  5EWR A;  1R1M A;  1W40 A;  4EB6 B;  3NVI B;  3C8L A;  3DC2 A;  1VQL F;  5EYP B;  3J81 M;  3FFM A;  1YHQ F;  1JD1 A;  3QTY A;  4DRX B;  1X7O A;  1H47 A;  3I55 F;  5ITZ A;  4TZZ A;  3NK7 A;  3WJP A;  2KG4 A;  2RHH A;  4TV8 B;  3GHZ A;  2AIZ P;  3ON1 A;  1XHO A;  3HWU A;  1VK3 A;  1Q7Y H;  2HS3 A;  5CA1 A;  2WAL A;  4C8I A;  1IV4 A;  5LP6 C;  1CN7 A;  1U3P A;  3QUW A;  1RLU A;  1W42 A;  2IAF A;  5IJ0 A;  1GO0 A;  3CCV F;  4YJ3 A;  5HY2 A;  5MN5 A;  3WGJ A;  4O4J B;  3M4S A;  3JAK A;  3HTN A;  1W3E X;  5GIN C;  5A2Q M;  1W59 A;  3CG6 A;  3CCS F;  3LWO C;  3GTZ A;  1YIT F;  1W57 A;  3C9U A;  3LFO A;  3CD6 F;  3F0F A;  4BT3 A;  4EI9 A;  1SZQ A;  1SA0 A;  3IKE A;  3ELC A;  5C8Y B;  5FNV B;  1ODE A;  4O4J A;  4BW0 B;  5MN6 A;  3FBA A;  3HAX D;  4M8I A;  5BMV A;  2QEX F;  3HKD B;  2DYY A;  3RA5 A;  5CA1 B;  2G9I A;  3VMF B;  5IJ9 B;  1VQ9 F;  1VQP F;  2ZF8 A;  5LYJ B;  2CHS A;  3JAW A;  3SIV A;  1VQ7 F;  4U39 A;  4YJ3 B;  3TD5 A;  1U3L A;  1JY8 A;  3JAK B;  4BT6 A;  1W5E A;  2JNB A;  2KTV A;  4ZOL B;  1SDS A;  2VAW A;  3JAT A;  1TUB A;  5GON B;  2UYP A;  1VQO F;  4YJ2 B;  3RYI B;  5EYP A;  2Z1T A;  1Q86 H;  3D54 A;  2RHJ A;  3P10 A;  2OHW A;  4I4T B;  2HP0 A;  3N2K B;  2ZVZ A;  2LBW A;  5EZY A;  1H7M A;  3Q8H A;  5G4V C;  5BMV B;  1VQ5 F;  4B46 A;  1Z5V A;  4YJ2 A;  2VXY A;  3RYI A;  2HX0 A;  2HRU A;  3G4S F;  2AIF A;  3RA6 A;  1KNK A;  2UYN B;  3CYQ A;  4O4H A;  1QD9 A;  4ZHQ B;  3N4Y A;  4NWO B;  4ERH A;  5CB4 A;  3LWP C;  1VQ8 F;  3JAM M;  1IV1 A;  2HP0 B;  3CXC F;  4IHJ B;  5EIB C;  4X20 B;  3V3T A;  2BO1 A;  3HKE B;  5JQG B;  3FD5 A;  3IMP A;  2CW4 A;  5LA6 A;  1W2B F;  2RHL A;  2NMU A;  3I3F A;  3CCU F;  1YGY A;  1YJ9 F;  3WGM A;  5FLX M;  4I55 B;  5EAZ A;  4X1K B;  4DXD A;  5JVD B;  3CCJ F;  1W5A A;  2B33 A;  2ZVY A;  4FFB B;  5IJ0 B;  2GZL A;  2VAP A;  2ZAU A;  2QTP A;  3FD6 A;  1ZWZ A;  1YJW F;  3K12 A;  4ZHV A;  2W8B C;  5EIB D;  5JVD A;  1YJN F;  1VQ4 F;  2QA4 F;  4G4Z A;  1ONI A;  4I50 B;  5LOV A;  2Z1E A;  3KIZ A;  5EZY B;  4X3M A;  3F0G A;  4HNA B;  2R75 1;  4G4Y A;  1X7P A;  4EI7 A;  1QVF F;  3I7T A;  3WPW A;  2YXZ A;  2P6Y A;  3K2X A;  3LYB A;  3V7E A;  2AMT A;  3UT5 B;  1DBF A;  1YQN A;  3MQW A;  3HKB B;  2IQQ A;  3JAL A;  2F9Z C;  4O4L A;  1W5F A;  1QU9 A;  5JCO C;  5KX5 A;  5LOV B;  3HJW C;  4IIJ B;  3V4D A;  3N4Z A;  2Z01 A;  4HNA A;  5LA6 B;  4G88 A;  1J7H A;  4EB6 A;  2CVL A;  1YI2 F;  4TV9 B;  3HKD A;  4I4T A;  3RYC A;  2VGN A;  5LYJ A;  3N2K A;  1DT9 A;  3O85 A;  3ZO8 A;  4FFB A;  1VHA A;  2H8E A;  3EOR A;  1Q8R A;  3F0E A;  3CCR F;  3NVK E;  1VQ6 F;  4O2B A;  3HKC A;  1CLI A;  3OON A;  3K14 A;  2CZW A;  1JFF B;  4XCQ A;  3RYF A;  4PWT A;  5C8Y A;  5GAP K;  2Q1Y A;  2OTL F;  3T80 A;  5GON A;  4G4W A;  3QHD A;  4ZOL A;  5JQG A;  4LNU A;  4NQ3 A;  3RYC B;  2VGM A;  4B62 A;  3S0W A;  2HS0 A;  1GZ0 A;  3LWV C;  3JAS B;  5J2T A;  4X20 A;  3N2G B;  2CSL A;  5HY1 A;  5J2U A;  1W55 A;  1UI9 A;  3ZP4 A;  4RHA A;  2Z1F A;  1NQ3 A;  4DRX A;  4ZI7 A;  3LWQ C;  1VQN F;  2LCA A;  3E20 B;  4O4I B;  1UFY A;  1U43 A;  3JAL B;  1YIJ F;  2CWJ A;  5KX5 B;  1XV2 A;  3VTI C;  2DT4 A;  2HVY D;  3G71 F;  4X3L A;  3S06 A;  3JAS A;  2RB9 A;  3NK6 A;  4LCK A;  1M1K H;  4U3J A;  5LP6 A;  3CMA F;  2UYK A;  3VIU A;  4ZK7 A;  4IHJ A;  3FPI A;  2CHT A;  3LDT A;  2LBT A;  5CA0 A;  2BTU A;  4I50 A;  1U40 A;  2FGY A;  1XRG A;  3OW2 F;  3HKE A;  3R0P A;  5MN4 A;  4R40 B;  3DDN A;  2HP3 A;  1E7K A;  3OBW A;  4WBN A;  3UT5 A;  3M1X A;  2KTU A;  3MCQ A;  3LME A;  3CCQ F;  3PLA C;  1OAP A;  3JAW B;  4BVQ A;  3E1Y A;  4ZI7 B;  5HWE A;  1RQ2 A;  2H6L A;  3WJQ A;  5IT9 M;  1VQV A;  5J2U B;  3LWR C;  1IV3 A;  3VO8 A;  3WGL A;  3WGN A;  3CB2 A;  3JAT B;  5CB4 B;  4TUY A;  2L26 A;  3VYT C;  4BVT A;  4ZHW A;  2PMP A;  3K0T A;  3ERN A;  1H48 A;  2UZH A;  3JCM M;  3G6E F;  1Z5W A;  4O2A B; 
#chains in the Genus database with same CATH homology
 1SZQ A;  2HP0 B;  2HP0 A;  2HP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...