4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
4X1IA 3JASA 4YJ2A 1SA0A 1TVKB 3JARB 3E22B 4B46A 3VOBA 4X1YA 5LP6B 4EB6B 5EZYB 1RLUA 1FFXA 2BTQB 1FSZA 3V3TA 5LYJB 4E6EA 4DXDA 5M7EA 3UT5B 1RQ7A 5CA0A 5LA6A 5LOVB 3VPAA 5KMGA 3HKDA 3JALA 4IHJB 3HKBA 3JAKA 4DRXA 4O2BB 4YJ3A 5JVDB 3R4VA 5EYPA 5J2UB 5LP6C 3RYCB 4O4JB 4X20B 5JCOA 3N2GA 4ZOLA 3RYHA 5JH7A 2R751 5MN5A 4IIJA 5GONB 4I4TB 4LNUB 4U3JB 1SA0B 1JFFA 3JAWB 3HKDB 5CB4B 4WBNA 3CB2A 3JATB 5LP6A 1Z5VA 4XCQA 4I50A 2BTQA 4O4LB 4ZHQB 2VAPA 4EI9A 5EZYA 5LYJA 2Q1XA 4EB6A 3HKCA 1FFXB 4F6RA 3RB8A 4YJ2B 5BMVA 3JASB 3JATA 1W5BA 4X1IB 5CA1B 3RYFA 4FFBA 5IJ9B 4O2AA 5JQGA 5GONA 4ZOLB 5JH7B 2VAMA 4I4TA 4LNUA 5IJ0B 4X1KA 4TV8B 5C8YA 5KMGB 5CA1A 5IJ9A 3JALB 5CA0B 5LOVA 2RHLA 4YJ3B 5JVDA 4IHJA 4DRXB 3ZBPA 5IYZA 4I55B 4F6RB 1W581 1TUBA 2RHOA 4TV9A 3HKCB 5BMVB 1OFUA 2XKBA 2VAWA 4EI7A 5ITZB 5LXTA 5CB4A 1W5EA 3WGJA 4WBNB 4I50B 3VO9A 4TV9B 4ZI7A 4O4HA 3N2GB 4U39A 2RHHA 5IJ0A 4U3JA 5C8YB 3N2KA 5MN6A 4TV8A 4M8IA 2Q1YA 3M8KA 4O4IB 3M89A 4O2AB 4FFBB 3WGLA 4ZI7B 4B45A 2XKAA 3ZBQA 4TUYA 3RYIA 5FNVA 5LA6B 4X1KB 2RHJA 4O4IA 1W59A 1RQ2A 3C8LA 4X1YB 3E22A 3RYFB 4I55A 4KWEA 4O4HB 4HNAB 3JAWA 5EIBD 5EIBC 5ITZA 5LXTB 3HKEA 2BTOA 4O2BA 4X20A 3HKBB 3JAKB 5EYPB 3RYCA 5KX5A 5JCOC 1Z5WA 4IIJB 3RYIB 5J2TA 3RYHB 5IYZB 4TUYB 1TUBB 4EI8A 5FNVB 1W5AA 1JFFB 2R6R1 1W5FA 3UT5A 5KX5B 5JQGB 3N2KB 3VO8A 1TVKA 5J2TB 4O4JA 5MN4A 3WGNA 5J2UA 3JARA 3VOAA 3ZIDA 4O4LA 4ZHQA 3WGMA 2GVIA 3WGKA 2VXYA 4HNAA 3HKEB
chains in the Genus database with same CATH superfamily
3IOBA 3V7NA 3MRVA 4G5FA 2Q2VA 1OZGA 4GBMA 4Y1RB 3OBWA 3RI3A 4YJ2A 3H4MA 4PONA 3ELCA 4RYDA 2ZBPA 3KSBC 1ESZA 5JI2E 3IO5A 3PXBA 4KL8S 5DHPA 2GPWA 3MJTA 1QLHA 2I6UA 5LFAA 3D8NA 2IYOA 5A1TA 2VH1A 3RFCA 4BT7A 1WV1A 5E1OA 4OLAA 5G02A 1D5WA 1IJFA 1E89A 2OR3A 2QL7A 2C42A 2VFAA 5LD2B 1CUJA 1R5BA 5CVVA 3CNHA 2ZTHA 13PKA 1SXQA 1OH6A 4YIPA 4H59A 3EZ6A 3CCQV 1Z63A 3K9GA 3TIVA 2VTBB 3HH8A 2PUWA 1D1TA 3I2IA 2IUYA 4G5HA 4ENTA 1SKMA 1B2RA 3U3XA 2P9FA 2RSLA 4FUQA 2IIBA 3H1EA 4INOA 4YAIA 1L7EA 1RHMA 5KNBH 1SCAA 4YQEA 3ZCVA 1JJBA 2XD9A 1T2VA 2XWPA 4I8DA 2P9CA 5DP1A 2JI7A 4QVGA 4H16A 4BO8A 5BSEA 4IJQA 2C84A 1XLWA 2XOXA 3HVUA 2HV8A 2V7EA 4M38A 1ZR2A 3GY0A 3NX4A 4KI0A 3BHMA 5BPFA 3BE4A 4YROA 3WLHA 2L18A 2W6JG 2JVIA 4TWIA 1WQ3A 2X8WA 3OICA 4I46A 3ITNA 1ATZA 4WCFA 1P7ZA 2P22C 3NTXA 1CQWA 3BJRA 2Y27A 4GZRB 1IN4A 4JLSA 3MOIA 4G0WA 4G41A 4PTZA 2QTNA 4AZ3A 1X25A 5K0LA 4JI6O 5TNXA 1L5WA 4LXQA 3S2GA 4WD3A 4IHJA 1ZIOA 5E0KB 3BZWA 2CAZC 3R0QA 1NMYA 4EB3A 4GE3A 2J9XB 4J1TC 3ACDA 2L26A 3LD9A 3GYQA 3EDYA 3FOCA 5EMMA 1UZMA 1Z5ZA 3AR8A 3K92A 2PUSA 1T5SA 3CZRA 4LI0A 2XJ9A 3CD6V 5KUMA 2A9KA 2HADA 2WA4A 4IY1A 4CM3A 4EB8A 2XNDG 2W2KB 3GCDA 4ND6A 2IY9A 3QUCA 2W8BA 2JFQA 3PI7A 2UXDB 2OZPA 2UYNA 3DLPX 1Q12A 1EVQA 1II8B 3LVRE 4CF5A 1BSMA 3GFFA 4MDHA 2PHNA 3WIEA 4XB6B 5CCBA 1CF2O 3DO6A 3DFIA 2ZVZA 3KHKA 4RMIA 1SPBS 1E3LA 3TOXA 1V9PA 4CKYA 2ZTUA 3OKCA 2QP3A 2YR0A 3PQ7A 2XUKA 3W7AA 4OUDA 4YHHB 1SO8A 1AT1A 3T61A 4WXHA 2L2QA 2FEPA 3OT4A 1F17A 3A0RB 3IAHA 4UXHA 4CWAA 2Q67A 1JBEA 1SU4A 2X22A 3N5KA 4OK5A 3PJEA 1A8UA 1NATA 1Q1BA 3PFBA 5EL0A 4OOEA 2XT6A 4I55A 1R1MA 1INLA 2UZ1B 3IEWA 1E9AA 3OZAA 3AKZA 3AP2A 3IP1A 4FOTA 1T2DA 2OGWA 2QL6A 3GLGA 1DP4A 1F6DA 2IQQA 3BVOA 4LP8A 3MBMA 5G53C 5A4FS 8ATCA 1ZONA 1SU7A 3UMCA 1NMUB 2ACEA 2VRBA 1GU1A 2O8DA 5IY5C 3SX2A 2FGYA 4X64B 3ETJA 2XUMA 2W7TA 3R9XB 4KG7A 3PNLA 4ZCSA 3F6BX 4NCXA 5H70A 1WXGA 1AU9A 4NBUA 2W70A 3WG9A 3SYTA 3E23A 5HX7A 5BXYA 4O4JA 3SWWA 3PTZA 4K6FA 3SK0A 821PA 4FX5A 4RTJA 1VKOA 3WYAA 2C2YA 5G2OA 1E79D 1Y4AE 4D4IA 1GZ7A 5EC2C 1X7XB 2YNMC 3HCOA 3EXEA 3T0GA 1KMMA 1WO8A 2JK1A 2O2JA 2ZRCA 3G85A 2F9ZC 4ZI5A 1OXKB 1EESA 1NF9A 3H1KH 2CMDA 3C97A 3CXUA 4QEKA 1JYEA 1V8FA 1ZA1A 2Z2ZA 3O84A 3A26A 4MA4A 4OP3A 1NRIA 3C3PA 4AG6A 2C92A 2Q4BA 3DAOA 5HG0A 4RIIA 1D2DA 2G1UA 4PPFA 4KIGA 3Q2IA 4WNYA 3Q7EA 3JAKA 4UXIA 5IU6A 3F6YA 4Z9YA 2XCSB 5I4CA 1M54A 5F98A 4MCAA 2EJUA 5CLLA 1TT7A 3VSEA 3PYMA 4MHSA 3RS2A 2AHZA 5ALZA 1Z4JA 3K32A 4V24A 4P9PA 3SNKA 2V7TA 1QM5A 1L7RA 2FPPB 2ZB7A 3NP7A 4LXGA 4G5SA 5K0NA 4EWLA 2X9GA 3VX4A 3YASA 5IBRA 3LV8A 2IS2A 3J81M 5LHGA 1L5FA 1J0XO 2V65A 4JP5A 1GA1A 4LKOA 2KG7A 4D4KA 5DHSA 5LWHA 1B00A 1KIMA 2D2VA 3D2BA 3DMGA 3KAPA 5JQGA 1PYOA 1VDZA 4WZ6A 4JI5B 4FLFA 5K1ZA 3UJ9A 4KFMA 3A1NA 5KJFA 4LZNA 4CUKA 4DBZA 4V0ME 4Q9IA 1K86A 3O3MB 2XB4A 3LQ1A 3GJ8A 1GYQA 2AMFA 3BE5A 3F97A 2DQ3A 5KMGB 3GYBA 3GIWA 3F0TA 3MJHA 4Y0AA 2XMPA 3BRWA 2DWEC 1L4LA 3IVAA 3ONVA 5H4HA 1IXRC 4J07A 4V0KA 3TPFA 2DBVO 3JQ8B 3VYVA 4F60A 3LXXA 2B33A 3CLUC 1NFQA 3DGEA 4XUGB 1QTQA 4UNQA 4E30A 3G5UA 5FBVB 4KR7A 1RRVA 4Z9BA 2CKDA 3JXEA 2HNBA 4HEQA 5CIWA 2CE2X 2N0SA 3MT9A 1CPYA 3QLVC 2ZS8A 2ERCA 3KPUA 2VDRB 2HP3A 4FQ7A 2WLMA 4LSZA 2HTFA 3F78A 1TW3A 3EN0A 1JG2A 4M8IA 1IHUA 1PWZA 4PXSA 4XWGA 4EITA 2W6JA 1UBEA 5INTA 2HSJA 1P1BA 5JISA 2XKAA 1A9RA 1JZQA 1KY2A 4H7DA 4PLGA 4HAYA 5ILGA 2O3UA 3RYIA 2N75A 4KH1A 3A3YA 1AQUA 2Q49A 4B8ZA 1C41A 4RFVA 1U8AA 1OV9A 4OREX 4TRMA 3T5BA 2XCUA 1JAXA 4GOMD 3A6GA 5FADA 3MINA 1WNTA 5B55A 3CWZA 3K1AA 1ML3A 2SKDA 2I99A 1Z0UA 3PFFA 4LK2A 4PGGA 4JZGA 1EUDA 4M22A 1PN3A 4K05A 1ODSA 1TIBA 1Y9EA 3K5OA 3P0FA 3DP9A 1N4CA 1V43A 1RABA 2E4ZA 4MDYA 3UMFA 1BT8A 1FFSA 3VR4H 4BNYA 1I9GA 3K9QO 4I1UA 3U7QA 1LFDB 2P4SA 1A71A 1QV7A 4E51A 1RBZA 5TY0A 4ZGBA 2XNHA 5K05A 1EXVA 2VF8A 1GCIA 2EWMA 3OCJA 3JQAD 1E18A 1KR2A 2KWIA 4M55A 3VVBA 2OG1A 3AETA 4ZOBA 4RD4A 3OPXA 4Y1GA 3J80N 2YHUA 3GP8A 1RU3A 4TMXA 2X0LA 1OLUB 3IAM1 2J9FA 4CT4B 4ED9A 4A91A 1O87A 5DBEX 2QWRB 1OVMA 3FAZA 3IAEA 1EWTA 3CZPA 3ZIAA 4Z7NB 2EJRA 2JIRA 2PSFA 2YMMA 1BGWA 4PSAA 2PXCA 4M86A 3MMXA 4IVRA 5KYUB 2TMYA 2ACWA 2DF8A 2P2LA 4Q4HA 3V8VA 2O9JA 1UIRA 3T95A 3SPJA 1BXRB 4M76B 1OASA 4NTZA 4EYEA 2P9BA 2GPNA 3IAYA 4LXYA 4OGFA 3GUCA 4FVMA 2XRMA 2PA0A 3EH1A 1BHJA 4YAKA 4I1SA 4Q15A 3NK6A 2IYVA 1ONPA 2C5FA 1TZKA 1XRQA 1M0TA 2AI2A 2X1LA 3FYSA 3L79A 4YJFB 4E5NA 3ZJUA 1E3SA 4EKGA 2RNBA 1E6KA 2HLPA 2ZDHA 4FQ5A 4Z7QB 2WHEA 5F77A 1YCGA 4M1SA 3UAYA 5C5IA 1T5HX 4UHFA 4H7HA 4KUGA 3D00A 3BILA 3SBEA 1D9ZA 1ZD3A 1KETA 1IOWA 2PZFA 1RCTE 1ENOA 1I7DA 1VCIA 1XMQO 2CZWA 3KT6A 1MFPA 3DCNA 5I7UA 3NBXX 5JJLA 2WOJA 3WBKA 1U9CA 2CMHA 4GBED 4E5VA 1X80B 1FQWA 3KJZA 2JAOA 3UJPA 1G291 1S6YA 1U2QA 4YAGA 4NR0A 2O14A 2HB6A 4L4RA 4G5YA 1GG2A 1P1JA 4F3NA 4DQLA 1T15A 1CP9A 2BFWA 2H17A 2AFRA 4ZOLB 2W90A 2IDMA 3MG9A 1YZTA 3V46A 4WBSA 4CCSA 3NHPA 1OY1A 4IKPA 4WESB 1KC8W 4RETA 3C3JA 4I81A 1VIYA 3H6HA 5FT9A 4F1JA 3MZ0A 3C70A 1T5EA 3W3AA 1SXJC 4JI1B 1NJSA 5AVQA 4OHBA 2QV7A 3OVMA 4PQEA 5E3IA 1GGVA 5E8JA 2FFAA 3BKWA 3AIIA 2QG6A 3V7EA 2Z2XA 3MTBA 1L0LH 2BFBA 4F3YA 3VAYA 1DCMA 3NIGB 3C7CB 3UMYA 2CNLA 4RQFA 3LBFA 1VKRA 1E96A 2NXJA 4GPZA 4L6IA 4G4WA 4GOND 3UA4A 5B64A 2AIZP 2FK8A 4YEDA 4ZYXA 4MTXA 5EJFA 4KR0A 3SZRA 2PR7A 4RY8A 2EDAA 2RKWA 3EVFA 3NYRA 4RHEA 3BXGA 4X3LA 3FFXA 3W5VA 3RKUA 2LKCA 5BUQA 5I6DA 1R27A 1VIBA 3DEKA 3PGXA 2XODA 4YPVA 1WEHA 4X45A 3CWBH 3KE8A 3LWOC 1L5QA 3H2GA 4OA5A 5DHTA 1JPUA 5L53A 2LR0A 3WWZA 1DX4A 1F2UB 5B8FA 4DR6B 1TOAA 1II8A 1TAHA 4BP3A 2GCGA 4C06A 2HP0B 2RI0A 2E3JA 2LBPA 3P0EA 5EI5A 4N1AA 1GR0A 2OG2A 2J67A 2R44A 2XAQA 4NJOA 1Z2DA 4R51A 4BB5A 4UNNA 1K98A 1IV1A 1MPTA 5A7HA 3GARA 3CUYA 1F38A 4M54A 4F91B 1QQAA 6YASA 1B76A 1G3QA 1P3JA 1QAQA 1X1AA 3GUHA 1O95D 1VQ7F 3A37A 1V9LA 3OT1A 3DTVD 4DK1A 3O1JC 2I8AA 2C57A 4EDHA 5LQJA 2QRGA 5KNDH 1VCHA 1MB0A 1G0OA 3I1FA 4UJ3A 1HBJA 4YJFA 2I3ZA 5L4SA 1HEYA 2AN9A 2WVGA 3HNOA 1PV2A 1DAKA 1GSHA 1X9HA 1XTIA 2IRWA 2IYTA 2OGZA 3BA6A 1Z2CA 3P4YA 3NC4A 3TQQA 3ZZNA 2X5XA 1SOMA 2GZRA 1NVAA 4E0BA 1ZJYA 4G85A 4QEZA 1BGXT 1OYOA 3NIBA 4KKVA 3UGQA 3CCSF 3ASYA 3GO4A 4MUJA 3OIFA 5EBMC 4N5LA 1GTJ1 4EKIA 1U0JA 4MW3A 2VZ8A 3P94A 1XELA 1K7CA 3NWOA 3GC6A 1NM5A 3VISA 2OYSA 4RGYA 1E2UA 5A3VA 4TVSA 2DFVA 3VC7A 3VR5H 1OCCC 2C2GA 4GKKB 5ER6A 2IHTA 3E7WA 1JCHA 3IODA 4C29A 1CQIB 2W6IA 3NGMA 2ACKA 1SIOA 4TVBA 1XXLA 3I9MA 1Q7EA 4MP6A 2CUNA 3RVDA 3WRYA 1OHHD 3FYIB 1ZRSA 5A9RA 3DPIA 4G86A 1PEKE 4XIGS 4XZ3A 2IEBA 4LEIA 4ENRA 2H48A 4KSCA 3PIDA 1Q90D 5CM2Z 1NBHA 3D1VA 1O97D 4E32A 2WYOA 4CIWA 4P0PB 4KRFA 5B36A 4TKMA 2E6UX 3BYQA 1R0XA 2JFZA 2ZULA 3H16A 2VQEB 1NM5C 4J0JA 4L4YA 4RVDA 3CXCF 3HU3A 3GBSA 4OJNA 5K0BA 4PHHA 5CA1B 3CCMF 3AY3A 4QUHA 2QUJA 3DM9B 3NBFA 1W36D 3OM8A 3OCXA 3BHNA 2XGSA 2BJVA 2FHPA 1E3IA 2QG4A 1HYBA 3A9RA 4IVQA 2WW8A 4I3FA 4LQCA 3G8YA 4ZMSA 4JA0A 2ONZA 4N41A 3IBYA 4IGGA 1EP9A 2CXRA 4W9NC 4RY0A 1DRVA 3O8NA 5ADHA 1NNUA 4HLNA 5DYGA 2GESA 3V8QA 4QICA 3STWA 1FYWA 2FPLA 2VH5R 3QWHA 3P9ZA 4RUFA 3AJDA 1NG1A 4L87A 3WMFA 1AGNA 2YZKA 4W5NA 4KEAA 4N6GA 1FDIA 3AR5A 4IBOA 3SZLA 4M0UA 2JI4A 3ZKWA 3P2MA 4QEDA 2HJ9A 5A0VA 3C16C 2HQSA 4D6XA 2RK6A 3K9CA 4FC6A 4Z4EA 1EUZA 1YE3A 3EQ8A 2X0DA 1U98A 2VJDA 4RSRA 4C5CA 4QQKA 4CKCB 4EO4A 3ADOA 3I2JA 3G89A 5A3RA 1KQSU 3I1JA 4JI7O 2CB0A 2V7WA 3N28A 5A05A 2JJMA 2QD1A 3H86A 4TTJA 5DNUA 5LLTA 2AQKA 4P1ZA 1XTKA 4UUOA 4F4CA 1C14A 4X65O 1Z6YA 1P73A 1XEWX 4JYBA 5MDHA 3C6MA 4E5UA 5JD3A 3WJAA 1UBKS 3OT7A 2YWFA 3ZD8A 1Y8ZA 2BSQA 1FFBA 1LJUA 3L0OA 3O8QB 2WVHA 2WYIA 2QEXV 2ZWIA 1EUQA 1YUNA 4PJ0Z 3F6SA 4X64O 4U9HS 2L35A 5CIYA 3FPJA 3KQLA 2BEUA 4KWEA 2AD5A 2OTLF 4RTRA 3EGDA 3PWTA 1ZD5A 2CL6X 1W73A 1X7YA 1M1KH 3D5TA 3MT7A 1T9GR 3PNYA 4PELA 3CN7A 1N8SA 4J42A 2D0OB 4DARA 5CEEA 2VBGA 1AURA 2C07A 3ZEAA 2HBQA 2G9RA 4RMHA 5AUOB 2NX2A 1G19A 2EIKC 3HUFA 5I9LA 5IJWA 2VPPA 1ZGAA 4N0EA 1PJSA 3OH8A 3CIOA 3BMOA 4L08A 4QUEA 5ECDA 3ZXYA 3I61A 4QYTA 1J8QA 2XPCA 2XMRA 2ZXWC 4KLCA 5JSZA 1FVFA 2YJ4A 3AEKA 1E79A 2FQQA 3FG9A 4X92A 1J8MF 5D8DA 4V0RA 2JHPA 4DW0A 1MTZA 1QGED 3R3XA 4R5MA 3F6RA 3OM9A 4RLQA 3USCS 1A9XB 5B57C 1MABG 2FWRA 2PYIA 2EJBA 4RLSA 1A4RA 1YDMA 2RHGB 3STUA 4R2MA 3HUTA 4R8VA 3MJ4A 1PR1A 3AUJB 3UO3A 2O8DB 2Q4TA 4JYAB 4XDYA 4YRSA 1OX6A 4RJJA 1EVLA 5C9ZA 5H7XA 3U4QB 4XQ9A 4DM7A 4XWWA 4G8JA 3LSSA 3R8FA 3WJ2A 3ZV7A 4UVIA 1X92A 4IXNA 5IXYA 3PC3A 3T94A 3P9YA 2L17A 1YOBA 4XX0A 1C3EA 2C9YA 3IJ4A 3EMDA 4IWYA 4AMYA 2AJ8A 2O0HA 4LDAA 1R64A 5HDQA 3CVWA 3L7CA 1UMBB 4HH3C 1PQPA 1LZLA 3JSLA 4X20B 3QKWA 3VKWA 1GGMA 4GLBA 3TXAA 1A9PA 1L7VC 4F04A 4YDQA 1B3BA 1L1FA 3SIUA 4BEJA 4EFDA 2CBGA 4QGBA 4K0KO 2NMUA 1VCMA 2YQZA 3BHJA 5COAA 1VYTA 1A77A 1OIVA 5KVVA 3WIDA 1N0IA 1U8ZA 5G4KA 3FTQA 3KNZA 4DCTA 1V4VA 3KV1A 3L02A 1ZH0A 3SBOA 3TZ6A 1ULBA 2NZWA 4ERNA 3TW6A 2GK7A 1DKRA 2IZ6A 2GLTA 4BLOA 4ZVMA 1QQ7A 2R7LA 1RBMA 3H1PA 1F6BA 1GRQA 4K3VA 4G37A 3RC2A 3BC1A 5JSKA 2BEVA 1Y89A 2CDAA 2J30A 4D42A 2YSUB 5AI0A 3K6RA 1TKCA 1BW9B 4RW0A 5HOQA 3A2NA 3ZDXB 1NR5A 2QBYA 2GZ3A 4Q48A 2KQXA 3CZ5A 3LFUA 4GEKA 1J0AA 5C3UA 3G9ZA 1IBMO 1YQUA 2ZRHA 2FPXA 1EGQA 1XKLA 3RVPA 2WHXA 3I1YA 5CLFA 4PQYA 3U4MA 1NP7A 1FW8A 3UFXA 3NNDA 2O2SA 5DIFA 3Q85A 1DFIA 1E92A 3LKDA 2F1KA 3A4YA 5E6UB 1DEHA 2RG7A 2I4LA 4YP5A 3VNVA 3NNSA 5CLQA 1Q95A 3M33A 1VKNA 2ODNA 5CXUA 4CEIA 4UMEA 1R18A 4MMZB 1JDBB 4HUTA 3PCRB 3C14C 4X5OA 3RC3A 4EW6A 4G4VA 2F1JA 5EZYF 3QE0A 2CXUA 1QQBA 1W0JA 4CW7A 2RGYA 2PTHA 2A3NA 2I4TA 3K4QA 4MVJG 2PHZA 1Y3IA 4QPDA 3WGLA 4NXNB 1KS9A 1CCWA 4Q7KA 1XTVA 4B1FA 1Z83A 2O2CA 1YZGA 4OQNA 2GK4A 3SZ3A 4QRIA 1DKNA 3X2FA 2QRNA 4JB2A 2F9FA 5LL6Y 1MABB 1L7DA 2J9ZB 2XTZA 3KBOA 2DJVA 3CXCU 4UD6A 3ZXSA 2PZLA 5KB3A 1IV3A 4ODIA 3FDIA 1QVGF 4KQ1A 4RIGA 2JIZD 4MYCA 2G25A 4Z0HO 1DLBA 2JVDA 5BPHA 1DNPA 1I6WA 2HN9A 5HBRA 4X3OA 4QJFB 3IRUA 1U97A 1YQNA 1RM0A 4HS4A 2FW1A 4QO7A 1NH2B 4HDMA 5A4IS 1B8OA 2IG8A 4HPJB 1FTGA 1B41A 2F43G 3B70A 5HUQA 2MHCA 2F93B 1P4HA 1D5NA 5HY0A 1N3IA 2O7NA 2X8JA 3SFTA 3DVLA 3U9LA 2IDKA 1KK1A 5J4KA 3RSHA 1VSUA 1DO8A 1Y5IA 1TPZA 5KAIZ 2GK6A 1YHQV 1FXKA 1IJEA 2O4UX 3AF5A 3RTAA 5LPNA 3CVVA 1FS5A 4D9GA 1APBA 3CMAF 4WKGA 3UV7A 2DETA 2IA5A 1EB8A 2H5IA 3SY8A 4EHFA 5BV7A 2HJRA 2XYQA 3QPWA 3ER8A 3QE4A 4IJKA 4R3NA 2QSJA 3ZI7A 2WTAA 4EKDA 4NPAA 1YCHA 5TX7A 4ZT3A 5CPFA 2BF7A 5IT4A 3TTXA 2Z1UA 4OJYA 3JWJA 4MUAA 3DDCA 2YUIA 4RD6A 2FXVA 1H1DA 3C6XA 2QMHA 3BD9A 3KKZA 1ZP6A 3B1KA 1KQGA 1P2BA 1VIAA 3GJQA 2C2XA 1QOQB 1RWBA 3ANMA 4QOGA 4UD2A 4E6PA 3NONA 4ADSG 4TXNA 1AQNA 3A1SA 4UTRA 2HS4A 2PGJA 4JP8A 5JXJA 1Z4NA 4IUYA 3TPCA 2X3FA 2GBGA 4LWQA 4H18A 5TQ0A 4E08A 3GZNA 1T0PA 3JRNA 1ONBA 3BWEA 1FXWF 1MW8X 1L8XA 1JZTA 4CQJA 4JC8A 3AYXB 3LKZA 4AC9A 2OFPA 2EJ7A 1DC7A 3UMBA 5E9AA 2GM4A 1HC7A 4DJFC 3MWGA 3ZRSA 1M6YA 1Z0ZA 2O2ZA 2PH5A 2VNJA 4E4RA 2I2XB 3I34X 3H97A 4J16A 2NU7A 4FMTA 2WF6A 4QBIA 1SC3A 2Q3DA 1JEQB 1T5LA 3H4IA 3OQIA 3MJCA 4QOSA 1E3JA 3RJMA 2RB4A 1JMYA 5D01A 1LXCA 3P9IA 4AECA 1G59A 4NZPA 7ABPA 4TLCA 5JFOA 4DB2A 1XJWA 2X13A 4BUCA 3BULA 5THQA 1JBQA 4KRXA 4JCOA 4EW1A 2OHFA 3RDPA 3GFRA 3JALB 1BHSA 4NK5A 3LCVB 5KTRA 1RSOB 1T4GA 3W9SA 4BU1A 3I5MA 3M9XA 1QFZA 3OTHA 3A2LA 3UJCA 1QXSA 2IU6A 2J3DA 1N5DA 3F6CA 5H16A 2EATA 3QLUA 3IEVA 3A3OA 3C3EA 2XUIA 4WJKB 2HF8A 2XCIA 4DG9A 1G41A 4M7RA 3TS1A 1ZVVA 3IIEA 4OLBA 5JBIA 2V0NA 4OX9O 2GJ8A 3FFAA 2LBXA 5ALQA 2WHYA 3G2JA 3VO9A 1A1VA 2FWMX 5AVVA 3LC0A 2YMPA 1GKIA 2ZJZA 3DNMA 2H8CA 1VLJA 3LDFA 4I8IA 1C3LA 4JY7A 4TX1A 3K9BA 4RS3A 1UWLA 4MS3A 1XCOA 2ZVJA 4R8RA 1GRRA 2A33A 4G4SP 5HPYB 4LGYA 4BBZA 1HX7A 2QK4A 4H6VA 2AI1A 2GPSA 3H1TA 1HI9A 3M4JA 3LT4A 1OTHA 3DOHA 4OHCA 1I3NA 2XTNA 2PT5A 3OQJA 2JIZG 3OJOA 1O77A 1PR9A 1K75A 2H9IA 4JLNA 4HAXA 2DOSA 4X24A 1LK7A 5IJAA 1NC3A 5KQGA 3VJKA 1ONNA 1Z25A 3JQ9C 4OHUA 1JJAA 3TD9A 4C43A 3K70D 3CG4A 2WFLB 4FGSA 4MAAA 5EIBC 5DWDA 2MJLA 1WXIA 3RVRA 1GLVA 1GQ2A 4MTGA 2UU9O 2VDPB 2WIDA 2Z9CA 1W8DA 1Y7LA 3H75A 5DGDA 3RJZA 2VXCA 4Y18A 1QRDA 1MV8A 2C0PA 1E59A 5TS2A 2UXNA 3BRSA 3IVCA 1AXGA 5B1HA 4JBIA 5E1AC 4BIOA 4BAYA 1NBAA 2DHRA 4CIAA 2G9ZA 3L18A 1VIMA 1Q0RA 5K3FA 3P45A 5EJEA 3M5WA 2C9ZA 3VO8A 4CMAA 5AKZA 3ZP7A 1JALA 1R6XA 1SULA 1GTMA 4YMLA 3F90A 1SXPA 3OUTA 3SHQA 2BO1A 4PQRA 1A9TA 1SHZA 4NPCA 1N34B 4PF1A 1JR3D 3IGAC 4XVRA 2BWJA 1SUFA 5FRDA 4CKWB 5EJ6A 3QBTA 5TJ9A 3GLIA 1G8HA 3K0AA 4IQGA 4K6KA 3RVKA 3VSCA 3G7UA 2PH3A 1RAGA 3UT5B 1EDOA 1F9EA 3I0ZA 3T5TA 5BOSB 1LDGA 1OUMA 3D7MA 1U8YA 4UAUA 5AOBA 3FETA 1VPVA 1QIKA 2RJ3A 3G9XA 3LUKA 3QE2A 5TE9A 4B80A 2GM5A 1YRAA 2O3SA 2VWHA 1GTOA 3I7TA 4JHXA 4Q9JA 3AVTA 2CHUA 4KK3A 1JL3A 2GV9A 4HDRA 2QJTA 2B83A 3RT1A 4C3UA 3VC3A 3VKVA 2X5KO 3FB7C 3C3AA 1E5TA 3FWYA 3R4CA 4AY2A 3D8UA 1KVTA 3HLYA 4OOFA 4TKZA 4KN8A 4J29A 1QIIA 4M46A 1S01A 3PENA 4JYZA 2VJKA 2D13A 1VC2A 2DH5A 1NF2A 2ZSKA 1CUCA 2Z1NA 3RB8A 5AM0A 5ALSA 1H05A 5KSOA 1MSWD 1K8ZB 2ID8A 3AY0A 2FRDA 4QJ5A 2X1HA 4B3TB 1JLSA 1WP8A 1BKYA 1GNRA 1XUOA 5DYYA 3I9V6 3CO5A 2D2CB 1NTKH 1V4NA 1P44A 4HWGA 2JIOA 4HDRB 3OO1A 5FFNA 4D98A 3ABRB 2H5EA 3KQYA 1U7ZA 3NC0C 5LIPA 2JLUA 1DELA 4LH7A 4MI3A 4DJJA 5J63A 2PFKA 2CEAA 1EXNA 3HCNA 1Z5OA 3PCTA 5EKDA 4Q3DA 1X52A 1Y76B 4RL6A 1Y5RA 2A9JA 1LY1A 1S76D 3F1LA 2WD9A 2Q3LA 1FW6A 1E9FA 1WKBA 2H5LA 1QX3A 4NYMQ 2B21A 3L93A 4L8VA 5EE0A 4P0TA 5JLAA 4DJEC 2VJOA 3UPDA 4F5YA 5JAHA 3CCCA 1AIPA 1HYQA 2R4QA 5JJKA 1JEEA 1YHZA 3KQKA 3QX9A 1JQDA 3ZY4A 1Z7BA 3TNFA 6CHYA 4DGQA 5C8YB 3PQ2A 4WNCA 2WOOA 5LSAA 5EKUA 5K3FB 3ZU5A 3E9QA 1HF3A 3WHIA 4ZARA 4B3JA 2W5UA 3LYHA 4MZXA 3SBXA 2BI4A 4C3OB 4R8LA 2C4MA 2ZEJA 3L49A 4XIFA 3QNUA 5T8KC 1LLCA 4K9KA 2JEUA 4KQ2A 2RHJA 4QPJA 1E2IA 1YJWV 1YL5A 2WLSA 3HJBA 3L8ZA 3L4BC 5KCZA 5BYJA 4LDNA 5LNK6 1CEQA 4K81B 1AI6A 3GG9A 3UC5A 3UVEA 2O05A 3JYHA 4YAUA 1UPXA 3K1TA 3WB0A 1PV0A 3FKSG 2IPNA 1W1WA 2OB2A 1YZVA 3UMGA 3PUVA 2BLNA 1IY0A 1KKMA 3GI1A 2VQDA 1UF9A 2EIJC 5IKOA 3W7XA 1TGOA 3BJMA 4PO8A 3LQ2A 3ZV4A 3I01A 1AUOA 3GRUA 5JRJA 1KP9A 3AESB 1G21A 4FZ0A 3ITDA 3T06B 5IVIA 3GHZA 2VGMA 4MWDA 2Y66A 2D3WA 2W2QA 5CBHA 1I1HA 3PWZA 5A9GA 2OTMA 5HCNA 3QVTA 3B1WA 4PA9A 2R85A 5KDOA 4R40B 1S72F 1XZGA 2XUGA 1IIBA 4I5EA 2AMTA 5AI9A 1YJQA 3VOAA 1NQWA 2IEDA 1KMCA 2J0VA 1HKHA 2Z04A 1KS2A 3AL2A 1YIDA 3KJEA 2BEUB 3KQNA 1MIHA 3CRMA 1CDEA 3AP1A 3IS3A 5E4JA 2F95B 4FYWA 4HWRA 3KU1A 3LYLA 4IZHA 3OBIA 5IULC 3WK7A 3LA6A 2AUTA 2D1RA 2OHHA 4J0EA 1QTNA 3MINB 2IM9A 1TMYA 3MTQA 4OXNA 2C59A 3B13B 1IY8A 1QANA 3D6NB 4KO2S 4M49A 4EX6A 1YKGA 5CJ2A 1ISRA 3V42A 3B3FA 1N1MA 2G8NA 3KALA 3ZHQA 2CV0A 4LJ4A 2QGZA 1YJ9V 4AROA 5C7LO 2X4LA 3CUVA 2LTAA 1SQSA 2AI3A 1XF1A 2HMUA 2XQFA 4KXMA 4DS3A 4DYHA 4BX8A 3IBTA 5A6SA 1A2OA 2CXHA 1P7BA 2M2IA 1OXSC 5ALMA 3P1JA 3CRRA 3A28A 1IN5A 1PWXA 2DWDC 4B4WA 3PGA1 2PWAA 3ZHZA 4KO4S 1RWWA 5EXXA 2Q0OC 1FS4A 2H51A 4DMRA 5JNWA 1ZISA 3DC6A 3S2IA 2IVFA 4QATA 4NE7A 4XYGA 1QCEA 1T8PA 2IIVA 5F4BA 4H4EA 1DAMA 1NURA 2HRUA 1OSNA 2ZI5A 2RB9A 1OKKD 2QMZA 2POQX 2H2DA 1IY1A 4ZIRA 3F2VA 1W0JG 3IB3A 1DFHA 1DHTA 3K5NA 2Z98A 3JASB 3MFQA 4Q16A 3ZY6A 2YINC 4QUGA 2IHYA 2VTDA 4D9NA 4MVQA 4OK3A 3TDMA 4RE6A 2QI9C 2DRIA 3TZLA 4J10A 1J5EO 2C95A 4ES6A 4YCNA 4H6XA 1EZVH 5G0TA 4GS5A 1NDHA 4QDUA 3TX2A 1TJNA 2AEFA 4YP7A 3A4NA 2AYXA 2IODA 3P20A 1NFRA 4IH4A 3EODA 4EH1A 4QSMA 4YRTA 4LFAB 3GNQA 2KQUA 4E7OA 2VSXA 4A2PA 1QKJA 2O06A 1NR1A 3M8AA 1VQLF 4N82A 2PGLA 1OFUA 4HDQB 3QYPA 5DN6A 3LQYA 4P2ZA 4X85A 2X42A 3PKZA 1UOPA 2HEIA 3TB6A 2Z6UA 1BOOA 2NO5A 4JQOA 1KBHA 4BFYA 4QJ3A 3GCXA 2WTUA 3X1JA 1U5BB 5E6SA 3RSLA 5A9SA 1GPH1 1YQWA 2GBLC 2P2NA 5EBWC 1CZOA 2A5LA 2CY0A 3MCVA 1XN4A 3PDWA 1PWHA 1XEXB 1BKSB 4LK3A 1JKMA 1MOQA 2ZBGA 3FPHA 3TRJA 3RADC 1AZTA 5C5DA 3QTLA 4BCDA 2QTGA 2B34A 1OHHG 1R6TA 3GFOA 4LZWA 3MCZA 4FLZA 4UV8A 2NYVA 3ZRWA 3RQSA 1ZLXA 2JGDA 1X3SA 1Y6QA 1P2UA 3TSYA 3UCXA 4H7PA 4ACBA 2XVXA 3K0EA 1H8EG 1KY5A 2WVAA 4PLZA 4AYXA 3T7EA 4KU4A 4EZEA 2H8PC 3TF5A 5IKXA 3N2LA 4H27A 4DE5A 4UB8Z 2QN7A 4FB5A 1A9OA 3DUFB 2AMJA 4KHZA 2KTUA 3AF6A 2PL3A 1YRQA 2EGHA 3I2KA 5T3YA 4MPTA 3SYRA 4U2EA 1XDZA 4JODA 1TL7C 1L5SA 3CH5A 4M89A 3WHPA 2WIGA 4NENA 3ZE2B 1M1YA 3S81A 4BKOA 2QWPB 1GU7A 4DSAA 3EVKA 4F85A 3MBIA 3BFKA 3PKJA 3W5HA 5LMUB 1X15A 3L7IA 3HUDA 4RLHA 1CQJB 2CJFA 3JRXA 1V1MA 1QLEB 4U7HA 1TLTA 1FTSA 2A35A 1OWNA 2B8WA 5GQSA 4J8PA 3UT0A 2W2OA 3TTVA 3VFDA 3V7UA 2Q6LA 5JD6A 2CUGA 2Q6IA 2WDZA 1EX1A 4X8MA 3ZRXA 1JG1A 4OQQA 3U5TA 2EZ4A 2HL6A 1NUQA 3JQBA 3QVUA 3W2GA 1M1NA 2JAHA 3P9NA 7MDHA 3ST7A 4C21A 3URMA 5A4KA 2F4VO 1T6YA 2IK8A 1GG9A 1T3SA 4JP1A 5ILOA 3DTUB 1SVIA 4ATNA 5K03A 2ECQA 3T7IA 3INGA 1UQRA 1O4WA 1QAOA 4G81A 4HDKA 1JHRA 4OFWA 2ORVA 2XYGA 3D6TB 5M34A 4Q6GA 4YRIA 1HDJA 1BJTA 1M34E 5GINC 2FWIA 2DMXA 1YTLA 2ZUVA 4YV2A 1PE0A 1JR9A 2H92A 3E3OA 4PG6A 4DV4O 1IHYA 1T8TA 5DIZA 4YXWG 1CB7A 2MSKA 3G6EF 2VXOA 3Q5EA 4MQFB 2FOXA 5F2EA 3TLCA 5LNK1 1DAIA 3NOVA 4K9NA 1GQQA 1AKYA 2O3JA 2FH5B 4EMBA 4I7ZB 3V1KA 4FCVA 4FFOA 4BT6A 2YC0A 4HBNA 5FPOA 2FXIA 3AXSA 2OORC 4UEWA 3RUAA 2ZJ1A 3LWVC 4PNEA 4Q7QA 3R7WB 1XZHA 3C3WA 3RGWS 3HJGA 5AKIA 2BE7A 4NZOA 3O6VA 1ACJA 3CO0S 4FT2A 3VPDA 2F66C 1GD1O 3ON5A 2FZ4A 1TT5B 3EXIA 3KZKA 5IABA 4LW8A 1A8IA 1N2EA 1GN2A 3IQEA 3F67A 4ZRDA 3LZDA 4DMHA 3AERB 1PAUA 3PICA 1MH9A 1P6XA 2G70A 2OV1A 3QO5A 3FRJA 3GGCA 3P27A 3AI7A 2EEPA 4Y2PA 2WE8A 4BWGA 3L0DA 4B08A 2VP6A 4HLCA 4PSDA 3L8MA 4P38A 4CMJA 1DF5A 3MDOA 1P62B 3WU2Z 3C5CA 3OBYA 1ORWA 1J95A 3Q9UA 4L5YA 3GAZA 5J5AA 2GRJA 1ZD2P 3CUSA 5C5EA 2AVDA 3SYPA 4LF8B 5HHTA 1K4DC 2GPTA 2C0QA 2P5TB 1Q1ZA 4MLDA 4YUVA 1QRSA 4M7PA 4H4CA 3U6KA 4DLAA 1M8FA 1UMCB 3NK7A 1M7GA 3CUUA 4IHAA 3H7AA 3GLSA 2PYJA 3QWAA 5H4GA 4JBYA 2HK8A 1FMJA 2VJNA 3CSUA 6LDHA 2SBTA 4KO8A 4LWSA 2HP0A 3A6KA 1O94C 1AJPA 3VSBA 1J2YA 1T25A 2OHGA 4BKQA 1N0JA 1NE7A 2H4HA 1GZUA 4PWYA 4Z9AA 2VQ3A 2HMSA 4AJLA 3O4HA 4J3FA 4N39A 4GKKO 2CD7A 1OT3A 3UK1A 4G01B 1NVPD 3S02A 1XA0A 2MYNA 4CL8A 5H8WA 4NHOA 4ZANA 2ZUBA 3WMGA 4ZYVA 4ZT7A 1Z7WA 1BXRA 1GRNA 2DY0A 2BHTA 2JAUA 4QELA 1EGAA 5LDGA 4OXXA 4Q1CA 1Z6XA 2XXJA 4GPD1 1ZFNA 4XYBA 4W9MC 1QS0B 2H9YA 2IYLD 3GBVA 4HQLA 1GN3A 4NMXB 1Q6YA 3ZWXA 2EULA 3NKFA 5FUBA 1M90H 4C6RA 2ZJ3A 2B7LA 1R3LC 1SIWA 5IXSA 4M8KA 1Y8RA 3KB1A 4UVAA 3THXA 4DV0B 16PKA 3JSAA 5DCLA 1Y6FA 1V3QE 1IBSA 1CDDA 1Y6ZA 4NARA 2PUGA 3ZD6A 1VJDA 1YR9A 2QAGB 3MQFA 1O0BA 1T0KB 1R4NB 2WE7A 3OBBA 4YXWD 1L8LA 2ZCEA 3L1HA 3LLUA 4TMTA 2DB3A 2R96A 1NTOA 4D80A 3D8TA 3N2IA 5HIMA 2ECPA 2FUKA 4BNUA 1LK0A 4EG4A 3W7BA 1W36B 2P9TA 2QUZA 4LSGA 4WSOA 2COUA 4GX0A 4DC1A 4Y2GA 5LA6F 4P53A 3ZGVA 4UPDA 2I6TA 1NW7A 1J2RA 2PKCA 3AB3A 3KZVA 2ZROA 1KO4A 3P3PA 1TVCA 2AE1A 3BK1A 3IUYA 3W8RA 2VDWA 2PMDA 2GETA 4FDLA 3KSRA 3JQRA 5CCDA 1VMKA 1E4YA 4FLUA 1CFZA 5ALOA 3VNAA 4MVOA 1TYBE 4GSKA 2P3OA 5IM5A 1SJ9A 3QF4A 2D5IA 4TQUS 4JC5A 5AXBA 3FI9A 1QG0A 2AFIB 2QJWA 4YCBA 1JECA 1NNI1 4UHBA 2F55A 1AJEA 2P8SA 4H9GA 2JARA 3VPFA 4HX9A 1ZQ9A 1ETHA 4CDRA 4GT1A 1AD2A 2AK3A 1CG6A 4D92A 4V1CA 3CONA 1M6EX 3GLHA 2PUJA 3DQPA 3PV0A 5CYOA 4R6ZA 3B3QA 1GHTA 5GV7A 2I6QA 4BE7B 3LPMA 1D0SA 5ITWA 3ES9A 1WE2A 4HWOA 5U4XA 3CPEA 2W6ZA 5EB0A 3R23A 2MMGA 4ZYWA 2YOGA 4H15A 3LRTA 1IWBB 5K6AA 4FE7A 1GN4A 1UC4B 2B5UA 2K4MA 3VYUB 4NBWA 1YIJF 5A3SA 4YCLA 4GW3A 2VBFA 5IUKC 4Q4CA 1BIFA 2QG9A 1H94A 5BN1A 5DEDA 1YDFA 3VV3A 5K51A 1C0PA 2OCYC 4INJA 4LHSA 5FF9A 4ZI2A 3LHKA 1JHAA 3FFMA 3G5LA 2J4FA 3H99A 1EZJA 4QU5A 4CLHA 1H4SA 2AIFA 1Y0BA 1UMDA 3GLHB 1RLOA 1VQLV 4I4TA 3PR2B 3O92A 5CDFA 1LX7A 3QUWA 1TYEB 1YJBA 2OP0A 3L43A 3UEOA 1MP0A 2QORA 4B34A 3EVBA 1VMEA 1WBJB 1DBWA 1CUWA 1XZDA 1IVSA 1IM8A 3ZCRA 4MVZA 5L4NA 4O33A 4RJTA 4PBTA 4N5DA 3QW4B 4HV4A 1YAJA 4ZPJA 3K05A 1UFVA 5BMOA 4CEJB 1UBTS 5I9BA 3FSJX 3OPYA 1EFUA 4G24A 4MR9A 1WVGA 1AB6A 2XCLA 3E9RA 1YF3A 5HY2A 1YAHA 3DYIA 4I9WA 4HQ0A 2PKQP 2VT3A 4LDJA 2PX0A 1FPOA 1FAFA 3DCJA 2BSKA 1NOJA 2LDXA 3LDTA 1G98A 1T2CA 1NKTA 1RJ9B 2A9OA 5EZQA 4AJ2A 4LBEC 3ZZ1A 4BFTA 4CIXA 5K0GA 1QFYA 1JDJA 2QVLA 4ETIA 2IU3A 1V8DA 4QE3A 3ER6A 4YR7A 2JJ1G 4C2TA 4UUAA 3AERA 2VZ9A 2BSKB 3BHPA 1R5NA 1N0NA 3U4HA 3EPPA 2HIGA 4R5HA 5L3ZA 2O8EB 5DX8A 1BVHA 3FUWA 4LHZA 3W7UA 3HNRA 4MVRA 5LA6B 1U3CA 3L8DA 4JBWA 1XZMA 5IM4A 4MR9B 1K3FA 3IOCA 5EOVA 1U0FA 1V16A 2IPXA 3RWMB 3TNJA 3K6SB 4LF9O 2CVZA 2WQZA 4GKJB 1VE3A 1M7BA 4GNRA 4H3SA 5CX4A 1BWQA 3D36C 4YY3B 1JIKA 1XVUA 2DWQA 3PC8C 1SUAA 1FQJA 4G0YA 3B9RA 4X8HA 3TK1A 2Q7EA 1UFIA 3KK0A 5KREA 1UOQA 1YK0A 1U1FA 1Z6PA 3GCGA 4MUBA 4UULA 3TCNA 4B35A 1SKQA 1PZEA 5KNDD 221PA 2Q1TA 3AFGA 1E79G 5DM6V 3RYHB 2J0EA 3K9HA 5EWJA 2PX3A 3A0RA 3BREA 3N2NA 1EWYA 4FW8A 5AKGA 3REQA 4LGCA 2JIDA 3D0KA 1JY8A 2JGFA 4LMAA 1KDVA 1KJQA 4OATA 4BKRA 3S06A 3PQ5A 4C1NA 1GZ0A 5EWJB 4I2VA 2ZJ2A 1T10A 4HN2A 2HDNB 2KE5A 4I9UA 4R2XA 5A5GA 3R5FA 2A94A 2UZ1A 2ABWA 3C3SA 5K7SA 3F4LA 4C9BA 2C2AA 3EOBI 3LXUX 3QFFA 1Q91A 4LY6A 4XDHA 1NL3A 1QH0A 1S0UA 5FNVF 1R3JC 3T5GA 4O2LA 4PG8A 3CMEF 1IZ7A 1GN9A 3ZJTA 1B73A 4CM8A 1EX7A 1C1YA 1NRWA 4MYSA 3NBKA 1YA8A 1ZH8A 3W79A 3ROQA 3ACBA 4JOQA 1GL3A 1CY1A 3CC8A 2HQSC 3W04A 3WS7A 4KUMA 4N03A 3NAZA 3PEYA 3MWDA 4UFZA 1UT6A 1Z36A 1DQPA 2YYZA 4YAFA 5JVDB 1X2BA 5JIBA 2C98A 1KYIA 2OC4A 2O7SA 3MYYA 3WLJA 5JCOA 3EFBA 3QQPA 1JGTA 1XXHB 5JLJA 4A27A 1KNQA 1PEAA 3OX4A 5I8PA 4TS3A 3V1YA 3GJTA 3UPUA 2ZAUA 4LTDA 3WK5A 4F4HA 1GQOA 4WGFA 3QBDA 4G0MA 1AGRA 5FR2A 2BOBC 2A6PA 1XQXA 2I7CA 3O8DA 4G1VA 2O5RA 4HVTA 4KXUA 4GGOA 4QDJA 3X2QC 1GG8A 4YV1A 2YZGA 3L07A 3G02A 3T1NA 3QKRA 3NTRA 1MF7A 4P82A 1NN1A 4PRZA 4JR1A 3B6EA 5EGSA 2JRIA 5FJ4C 5JHGB 3HMQA 3JQ7A 4JLPA 4LV8B 5DP2A 1XXHA 2IJJA 4LH6A 2ODQA 3L2OB 3L82B 3MS4A 5L3RA 3WJ1A 3G2OA 2V6FA 3FDZA 2EKZA 1PR5A 3KT0A 4WJZA 2WJVA 1HE1C 4FJCC 4O02B 3TE6A 3ZTYA 4NFHA 4G2KA 1VQ6F 1TCVA 2QTCA 4FOPA 4JITA 4J2TA 4LNHA 3JVDA 4NC9A 5KTOA 2GEKA 3ZWMA 3MHHC 2WFLA 3UYLA 2LDBA 1KI1A 3LKBA 3KJKA 4YN3A 1NVGA 3NR2A 2HCJB 5TEWA 3C7AA 1QCCA 1X19A 1ZM4A 2FWJA 3MERA 2LFSA 2N1BA 3PHLA 4L2IB 4MJ3A 4MV5A 4YRFA 3SM3A 1MOZA 2DBZA 3UJ3X 4FJ0A 1OCEA 2H4JA 1UMDB 3K5WA 1JT9A 3RRYA 5K1PA 1Q1QA 3D64A 2XZTA 2LBTA 3OQHA 3LFOA 3T7DA 5B1AC 4CM7A 4LYFA 2HFJA 1DEKA 3HN2A 4Y1FA 1JEJA 1YA4A 3OIGA 2O5CA 1P17A 2NG1A 1XZKA 5B12A 5C5CA 1L8DA 2KW5A 2Q5HA 3QF4B 4JBXA 3WPWA 2WWIA 4HZGA 3SZUA 2CCKA 2PD3A 1K8XB 4CDNA 3WGHA 1JX9A 1AZLA 4HUQA 1AVTA 2OP1A 2GAJA 3VU8A 3OWOA 1FF9A 1FXUA 4CF7A 5J58A 4YMWA 3ZS8C 2NOAA 3A9WA 1IBMB 2P9QA 4X9QA 3CKKA 3KKKA 2XMDA 3H2SA 2ZZMA 1J20A 4J4TA 4GM1A 2P3SA 3SXJA 2X2EA 2P4EA 2XA2A 1N7GA 3BTUA 3X1MA 2G88A 1GO3F 3AU9A 5EZ6B 3V9PA 2WA3A 3F5WC 3PXUA 4LGMA 2C58A 1YULA 4N6NA 1Y3FE 1QG6A 2IZ1A 5FWXA 5H3HA 5IBQA 2B9VA 4OK6A 2VF4X 4A7PA 1ORRA 3ZY2A 3I56F 1DB3A 3PLAC 4FINA 1RHKA 1TT5A 3EXIB 3C5WP 3KPJA 3GMDA 3BAZA 4HGRA 5HGXA 4RX1A 3H01A 2MINA 1XLUA 3OIWA 2E75B 5MN4A 1GCOA 1RAAA 3NYWA 3RC7A 3VPXA 3N0RA 5HZMA 2BJHA 2ORIA 3AG4C 2RHMA 4RHFA 4C4ZA 2EKBA 2OILA 2WPDD 5JV5A 1NN5A 3NUGA 4EAQA 2ZG6A 2Q2OA 2ZVPX 3AG1C 5ELLA 4Z6KA 4L0CA 3R3JA 4O5OA 1ZK4A 5AUPB 3ZRVA 1H65A 1DWOA 4AKGA 4LWZA 3VU3A 5H9WA 1Y8QA 4CF3A 4DZRA 1DEXA 4FFKA 3HR7A 8MHTA 5KOIA 2IYWA 5E2BA 4DV6O 5ALYA 2A0LA 1J09A 4GZ5A 4LJSA 5AVKA 4P7BA 3KDSE 1M0WA 2R97A 5H5JA 4RHYA 2AOWA 3G2QA 4BR6A 1R73A 4R2KA 3U1BA 3WA7A 1TDJA 2Y8EA 3AHHA 4NBTA 4J7CA 3L0ZA 2Q1UA 4MRAA 3HO8A 5CH5A 3G71F 1Y1KE 3KQHA 4UC0A 1BJRE 1O6FA 3C4VA 4MW2A 1T34A 5EKTA 2ILVA 2E5FA 2PT9A 4X93A 4CR7A 1VYVA 2W6ID 1P19A 2TS1A 3TTTA 3M1IA 4QXMA 1JT2A 4PC3A 4CGZA 4IIVA 2DG2A 1B6GA 2BEJA 2CHGA 1Z35A 2PBRA 2M6YA 1DJPA 3IMKA 3JD3A 4RKEA 4C4AA 3PBKA 3OHPA 1NOKA 5EJGA 4YJ2B 2BKLA 5KYKA 2ALEA 5EFZA 2NAFA 5TXGA 1UBGA 3RIGA 2QAGC 2FPRA 4J1NA 4EHKA 4IGEA 3NWPA 1G5TA 1KC1A 1ECPA 4GZ3A 3WL4A 4G0XA 1QU3A 2X4DA 1C30B 3I05A 3DMHA 3PHBE 3TSOA 4DWVA 2ADPA 2A7QA 1TA0A 5CFRA 2I6DA 1DWUA 4ILKA 1PFVA 3WYDA 1K88A 2ET6A 2ZUTA 2HDHA 4ZCMA 1KL7A 2F4NA 1EYZA 3IFXA 4FLVA 3PDHA 1J0EA 3BAAA 1MLDA 4P7KA 4D4MA 4WFBV 1MQ8B 1FP4A 2FAXA 2YC2C 5AI5A 3RREA 2YY6A 1YL6A 3LNTA 3RIEA 1J2UA 3TRFA 4MVJH 1KYQA 4CMCA 2O20A 2QRVB 4AJEA 1LK5A 1ZEJA 2OECA 4C5AA 3QVSA 5J3JA 1W5EA 3IIJA 4IOMA 2P6JA 1GAXA 5FQNA 3HB1A 3AB7A 3CLRD 3ZMSA 3U26A 4BLSA 4NY1A 2F90A 2EGGA 3S3XA 1GT6A 1E6CA 1WZEA 4HWTA 4C6HA 1FSFA 1PD1A 1PEYA 1C1XB 1WSDA 2JIZA 5K8IA 2PGNA 2WUVA 3DT8A 3IJEB 4XUCA 2MU1A 4CFZA 1K4YA 3OCVA 1A88A 4CN8A 1BHAA 7MHTA 3HLTA 1VHAA 2XNDA 2E5LO 4PAOA 1KK0A 1A50B 2YI8A 1UK8A 2QNBA 4CCAA 1FJHA 1XU7A 2NQ2C 4MUEA 4DNFA 4EEXA 3ZI0A 3H1FA 3GJ7A 4OFZA 4AF7A 4FHZA 5DO9A 2C4WA 2WSSD 1VHQA 2OV2A 4QVIA 4G0VA 4EEQA 4OU5A 3QBJA 2XHEA 4GWKA 2R1VA 2UVPA 4PA3A 4BNLA 4BO5A 2VQFB 2FRVA 4C4WC 3ZWQA 1DAEA 1W35A 4K8RB 1VBMA 3WBJA 3NEYA 4RJKA 4DIUA 3DXRB 4YMTA 4FDMA 4DDVA 4P58A 2DVMA 1T9ZA 4WKCA 1PNRA 2WWGA 2QZ4A 4TXHA 4HN9A 1OXBB 3DAGA 3COZA 1K2WA 2GHIA 3QIAA 1DFGA 4UHCA 2BP7A 1QGUA 1YZLA 2B1RA 3NS7A 2JH3A 3QV1A 4LA4A 1TRHA 4QDOA 2ZE7A 4BMSA 4UNPA 5DU2A 5BUCA 1JPXA 4EJSA 3U7IA 1ADBA 1OILA 2X3UA 1GGJA 3GVXA 3LWBA 4UTXA 3C6ZA 3DDZX 3H1BA 2JIQA 3TLGB 1L5HA 3MAQA 5DJ5A 1SA0A 1XNRB 3HU5A 3RA5A 4BGIA 5AG2A 4MX8A 3V8NA 1VE7A 4BGUA 2RH9B 4FLTA 4K2HA 3NATA 2PRZA 2XB2A 3V3TA 1TJPB 1XMOB 4TMWA 3U4CA 2BMFA 3L41A 2GYYA 3OFKA 4JQCA 2F1OA 4QOFA 4XDKA 3TE7A 5KNDA 2ZB8A 2BGGA 4YRLA 2CB9A 1N2OA 1VLLA 5BNFA 5EYPA 1YFKA 1G2IA 3PUHA 4FGUA 1Q14A 3RBXA 3BA1A 3V7FA 2E9SA 3W5IA 3P3NA 2Z3VA 3MNFA 1QD9A 1C4WA 1HLFA 1LPSA 1C3OA 1P2TA 1QYXA 2EKLA 2P2SA 3N8DA 4JBLA 1IG3A 4WWHA 1QBKC 1WPQA 4M7WA 3GLFE 2O48X 2OOKA 3B1YA 2NVOA 2X4IA 2UZHA 2G28A 3A6JA 2ZUUA 3K2IA 3BH6A 3I3FA 1ZWLA 2W4MA 4KXQA 1D9XA 5MF6A 4MTOA 1X87A 2QPOA 4JV5B 1X1BA 3FCEA 2YICA 1UR5A 2O59A 5B3SB 3AG4B 2OQVA 2O54A 2R6FA 2JZCA 1PJTA 1CQZA 3DL2A 2O0JA 2WLIA 1NTZH 1E7YA 4RCVA 3V8RA 5DYNA 3TXYA 2P75A 2Y4NA 3TLJA 3C85A 3WE7A 3IVXA 4U9UA 4ALKA 2NXCA 4KX3A 1TKAA 1UXOA 2AJCA 1ZGZA 5FOVA 3RV4A 5I48A 4ETNA 1E1MA 4WA8A 1ZVMA 5TF0A 3ZIAD 2QJ1A 2Y48A 2I62A 4B3GA 1FYXA 1JWAB 1CHDA 3QRWA 4F6RB 4P33A 1QPZA 2JHAA 2R8ZA 1UJ6A 1TZBA 5CR9A 5DN9A 4KR9A 3U37A 3I37X 3BX1A 3VR6A 4Y2VA 2N48A 2AC2A 5DX1A 1J23A 2G1JA 3MA0A 3Q3EA 5CFOA 1QHIA 1EFRG 1SVUA 1HT1E 3IILA 2OCDA 4E2WA 4F8JA 1Z4MA 4N0QA 7ADHA 3BWVA 1XILA 3GVCA 4G0QA 3FB1A 3OQMA 2MYUA 3KOOA 3LPAA 3GVHA 4IXTA 4PANA 1QHFA 1G7TA 1Q6ZA 4K6HA 3NAGA 3N58A 4ZHYB 4R6XA 3V2HA 4KFUA 4KMRA 4N01A 1WQ4A 1V1MB 5JATA 1O3YA 2DSNA 2FN7A 1I4WA 3B09A 2HNKA 4Y6PA 3RRMA 3PG5A 5IMBA 5I45A 5CM9C 8ADHA 4DV1O 5E9WA 1HQCA 4DUGA 1K7FB 3QMMA 2OXRA 3GX1A 2V7BA 4NEGA 5HTOA 3WWPA 1QPBA 4XLLA 4GGMX 4CLRA 4IDPA 4IDAA 5ECWA 1EX9A 4OI2A 3TLMA 4E21A 1WOMA 3ZX4A 5HKKD 2OM6A 1GM5A 1AJQA 1FJ2A 4BWVA 1E58A 1MW9X 2BI7A 4MS4A 2IP1A 1YDXA 2ILTA 1L4MA 2QMOA 3IMCA 3TQOA 1NI4A 1RI4A 3QXHA 3ZUGA 4CMIB 5JCOC 4BFXA 1XCJA 5HIIA 5FH9A 1ZRHA 2EF0A 3IP6A 5TMDA 1XTTA 1QBGA 3G2PA 1BVRA 4D79A 3MILA 3TXSA 2R6R1 5BR8B 3HBAA 4WDRA 1EBBA 3KEOA 5EIFA 1XD9A 4Q3AA 2AL7A 3E8FA 5IYDO 1LDEA 1DTSA 4PBRA 5DVZA 1IRIA 4EL5A 4ARAA 3F3KA 5GOTA 4A1OA 4BNKA 4KXWA 3FSGD 2GFQA 1ABEA 3MJRA 4MUYA 5SZKB 3H65A 1JA8A 2C8LA 3D6MA 4FDAA 1HOXA 1WY7A 5AVRA 2YBDA 1TADA 4LC1A 4DA4A 4AWAA 1AA6A 1ZNQO 3G0IA 5CDGA 3C87A 1KO1A 4PLPA 3OPMA 3VYTC 1T5BA 2C2KA 3WLEA 3GJ4A 4FX2A 5LU9A 4YRZA 1YQTA 3BEDA 3HKDA 3KQTA 2WUGA 3EGXA 5F2KA 1BDBA 5JROA 1HEUA 4RVHA 4ASUA 2YIDA 2OHOA 5DTEA 3F73A 3IKVA 2F4VB 4UDYX 2FEAA 2MSDB 4RXTA 5MN5A 1XHXA 4YRPA 1IVNA 2X58A 4X8AA 3HCWA 1E2NA 4PFJA 4Y9SA 4KQWA 1RS0A 3CJRA 3HRIA 4OHXA 2HVJC 1XBLA 1Y82A 1C0LA 1FNNA 3FNGA 3K5LA 5C18A 1NH2D 3VPCA 4UQLA 2O5EA 2PAAA 5IKMA 5DLEA 1FRQA 3F4KA 4FGLA 4KQMA 2FC3A 1Z7YA 2PV0A 2ZNIA 4MICA 2OXTA 3DZJA 3FOZA 5GTIZ 3BIOA 4N5IX 5KKAA 2W2LD 3RYTC 4C20A 3NBYC 5BMVA 3GXBA 4EIWA 5EAZA 2Q6AA 2OWDA 4FYIA 2BGKA 2P11A 4OQLA 2J0SA 2JCYA 5U1PA 2O8FA 3ZGNA 2Q0XA 1XPRA 4JC4A 3DWEX 1XTRA 4I36A 4NTYA 5EUCA 3GFBA 4IDFA 2R1TB 3SHTA 5CFLA 4Q9NA 1MQSA 1PT8A 4LN1A 4NJEA 4CJXA 1ZNZA 2ZYSA 3DZCA 4BC0A 4OVKA 4P9OA 1M67A 3Q6MA 5CVDA 3G7SA 3OSZA 5DGIA 4ZXPA 3FKJA 1EGHA 4DR5O 1GYRA 1T0JB 3W2TA 2G40A 1XTZA 3GEPA 1ZINA 1UUFA 1N6LA 3NKVA 4NH4A 5EEGA 1A8SA 5IAGA 4BVKA 4EJSB 4G6ZA 5I7EA 3IQWA 1QP4A 4J7ZA 5EBLC 2VS1A 3H11A 2Z5VA 3H8JA 4G3XA 5DGTA 1H9BA 5JS2A 2GT1A 3HJTA 4LI3X 5CXSA 4AZ0A 2REQB 1PK9A 2I4NA 3TQCA 2AUMA 5IZ4A 1XD2A 3ER9A 3U61B 5K1XA 2CV1A 3L7KA 1IB6A 3L0CA 4PX5A 5HA5A 4B3FX 4DNOA 4Z8YA 4G1CA 4EUFA 1TK3A 3U0OA 4P81A 2W22A 1ETUA 4RZXA 2DKNA 5TVGA 3TRIA 5BV8A 5JAMA 4LTMA 3I9JA 3MTDA 3U31A 3S0HA 3KKPA 5JNRA 1H2LA 1DXHA 5FBQB 3VU9A 2PKWA 2CCGA 2PO5A 2YWXA 4PV1B 3EC7A 1QK4A 2AX3A 2R6JA 5H59A 3AG5A 2XSZD 2H8EA 1HE3A 1RXUA 4XRRA 5TEVA 3EPKA 1L7QA 2VT6A 3L6EA 3LKVA 3GB7C 4EF6A 1P0FA 5DMHA 2ZUCA 2WIAA 2EZTA 2R9RB 4H7EA 1SS3A 4KBYA 4BS9A 1R4MA 2QTVB 4ZVSA 3TW8B 3FF4A 7REQB 2KM1A 4EX7A 2HU7A 3ZTTA 1F8GA 2C2ZA 1HDZA 4WH0A 4PWZA 4IVNA 3SKXA 4RAQA 4BMNA 1N6PA 1XJ5A 1CYEA 2AOVA 5EP3A 2YEVB 1KJIA 4KMSA 5SY9A 2EKPA 3TGLA 2YHBA 3QXSA 1FXKC 1C3OB 4S1NA 1TPYA 1UFKA 4ILEA 4CDGA 2VQFO 3ILXA 2YNMD 3IESA 1EBUA 2YHSA 4KN9S 1WRBA 3MW8A 3EWNA 3RODA 1W5TA 4HH1A 3TXXA 2CVQA 3ZQKA 1B6RA 5GAJA 4DNPA 1NS1A 2CVLA 3WGKA 1RMTA 1ZUNA 3BPSA 3KC2A 4MVXA 4C7JA 1AR4A 2C5EA 4O08A 4RKWA 5KIAA 3LCRA 4TLAA 3D0RA 1I7QB 2J0QA 3FMOB 3R3SA 3UAXA 4AWXA 4Y2JA 3NP9A 3ON1A 2V6IA 4I9QA 2PQMA 3E5RA 2DW4A 4JROA 4KAAA 3Q5GA 5ULLA 3TFWA 3T1HB 4B8WA 1WHSA 1VQNV 5AVUA 1O58A 1K66A 3I9LA 4HZUB 1OI4A 1MO4A 2FWNA 3DEJA 3IBCA 2PGXA 3H2HA 4OEHA 4DV7O 2QYHA 2D06A 5AVXA 1FUEA 1C9MA 1O8CA 3CEJA 4U2CA 1Q82W 2MQEA 1KKCA 2VTVA 3BS4A 3F2IA 1JLLA 4DEVA 1ZM2A 2G4CA 3CCSV 4LFAO 4QGHA 4OI4A 3WOHA 1U81A 3CM0A 4CG1A 4DLKA 3I52A 1KF0A 4N65A 1C8VB 3A6FA 3LP6A 4FIDA 2B61A 3RT3C 1IPFA 4DLUA 1G6Q1 1JEOA 2F67A 4ZVRA 1A4XA 2Q3EA 4MEBA 4JDUA 5GGXA 3ZWNA 5AI4A 2NNWB 3GHYA 1GY8A 3E1GA 2Q6OA 4TL7A 3F4BA 5IVPA 4MRVA 1T3HA 2C4VA 3N05A 3S99A 3JWPA 4KXYA 1Z0IA 2H1VA 1URFA 2L19A 2B6HA 3GLFB 5ALPA 3ZN0A 4UBOA 3JATA 1QLNA 5CFMA 4ALJA 3EY9A 1BZYA 1USWA 3AHJA 3HAXD 4BMCA 3D3WA 1OXXK 3EEQA 2VQ6A 5FTLA 2JAXA 4LOHA 1BMQA 4G67A 3AG3B 3K9FC 4F3RA 3M2TA 3GPCA 5G0SA 1R10A 2QVZX 2AFIA 1T0UA 1Z0FA 4UQPA 1E0KA 2JFWA 2XQKA 1BL8A 1NW5A 1XLVA 1GO0A 1YJ8A 1DO2A 3LBIA 4NS4A 2RARA 3C3CA 4X3CA 1CY6A 4QFCA 1IY2A 3TMAA 1KFJB 3PE4A 1R8YA 4AJ9A 1QHNA 2XBUA 1WU7A 2O1WA 1XU4A 4NNJA 4R1UA 3JYPA 4DRZA 5B4VA 2BTEA 2W37A 1MABA 3U0ZA 4I4LA 3ASVA 3PT9A 3NFRA 2YV3A 4CTMA 3K1AB 3UQZA 3GTZA 1Q8RA 2EU8A 3BE8A 3RSFA 5DBGA 3VBBA 4HTFB 2XMZA 4TS9A 3UB3A 3H6KA 1N6IA 2EOAA 4EJ6A 1AQYA 1Q5PA 4XM0A 1EDBA 2DQZA 1XRNA 2XUQA 4LYYA 5FHQA 5EPEA 1L2TA 3QHPA 3BY6A 4JTAB 4MMXB 5CG1A 5JDIA 4QULA 4QFMA 4BW9A 3ZDCA 4GM4A 1RLIA 1K89A 5AIAA 4LTNA 3TOSA 5I7FA 5JWHA 1GNTA 3UHAA 5CITA 3QVXA 4GLXA 4PCUA 2HPZA 4P80A 1KVRA 5AOVA 3I0NA 3WWYA 3WBBA 5JSQA 4KFCA 4X44A 3TM5A 1M2OA 1XEWY 2CW5A 1W3EX 1K8AH 3MS2A 5AWFC 2H8GA 1JQJC 1WL8A 1N5IA 1PX2A 2HRZA 2VYFA 3RF7A 5A3QA 2Q8PA 1C7IA 2CNDA 5EJ8A 4MDEA 5TT0A 2OYQA 3UIEA 3QU9A 3CCRF 4NYMR 2YXEA 1CS0B 1PG0A 4L0MA 1M0EA 3PGKA 4R1LA 1WB6A 1AO3A 3NTOA 4PO1A 3ZJVA 3WYBA 2Q2WA 4FYVA 5TPWB 3MDSA 4ZBMA 3GCWA 4H7IA 1TK2A 2IT1A 3DDUA 3HJAA 3UY4A 1MEOA 1V8OA 2B0JA 3F71A 3BIJA 3ZMZA 3OKPA 3PEWA 2GCIA 1HEIA 2XWQA 2Y0CA 3IXQA 4KOAA 3P2YA 4CRWB 4ZHQA 2NYUA 3T1YB 2G8LA 4L2IA 5BVGA 3WISA 3NJRA 1FTQA 3OZRA 3RUDA 3T9AA 2H5JA 2XMSA 1C4XA 1E7MA 1OFHA 1ZBDA 4MR8B 1CJSA 1GPUA 1N2IA 4YTEA 5JD5A 4TXLA 1ZD4A 4ZIBA 1D04A 1PW5A 1VOTA 3ZI4A 1BMFA 1D1QA 5KAMA 4HATA 2ORYA 1G6UA 1Z4OA 4KK4A 5HKBA 3GFGA 4PFQA 4JZKA 1G7RA 4X6UA 4F2PA 3MHSC 3FDZB 4L95C 2Q6VA 3OUZA 2REXB 5TSDA 2XT9A 1QGDA 2RONA 2ZIVB 4AIRA 4EGFA 1UI9A 4A1FA 2ODEA 1P31A 4JOSA 3N6VA 5JSHA 1Y48E 4RJIA 3T0IA 2B37A 2UYKA 2EQBA 4WUTA 2I29A 5B1YA 3T3GA 3I2HA 4J3NA 2FSIA 1XCPA 3FOFC 2R87A 1T2FA 4F97A 4ZK6A 2QDOA 2C99A 4MQMA 2WYUA 2BGTA 2A0YA 3HCCA 3MWFA 3PGVA 1XL4A 4ER7A 3AK3A 5YASA 3JV7A 4PI2A 3SC3A 3CCJV 1KMHA 3ZW8A 5KZMB 5G3YA 3TTSA 3IP9A 2OIEA 1TJ4A 4DM3A 3HJFA 2NSYA 4JI1O 4OB8A 3H3XA 3QEKA 4M6WB 3MGAA 3Q8WA 5DECA 1G6HA 1SNYA 1ZUQA 2P9GA 3DV0B 3QVKA 4JOCA 3KKQA 4KYUA 2B2XA 4M9CA 1JP7A 3RJ9A 5JI3E 2ATKC 2Q62A 1H2YA 2H1FA 5MGBA 1XQWA 2QL5A 3ZNPA 5JANA 4TYWA 2GCOB 3M1YA 4GWLA 3QPCA 4U7PB 3HDGA 4JJ7A 1LPMA 1M1XB 5FOUA 3WHLA 2VATA 3AG7A 3OM1A 4RA6A 2UV8A 1LVHA 5EQTA 4CS2A 3K6KA 1VQ9V 4RCZA 3UGKA 5KYXA 5CW2A 5EUBA 3A2FA 3JVHA 4EI7A 1NKDA 3IVRA 1CT9A 2HCTA 3QUTA 2BFMA 4OXQA 4MARA 1RKVA 4DADA 2Q7HA 4OMCA 1XNQB 3QE9Y 1Z38A 3LHSA 1AS3A 3OECA 8ABPA 3W5CA 8AT1A 3EZFA 4L28A 2JBAB 3SE0A 5KJ1A 2R1TA 2VO1A 3E9MA 4FT4A 1EKXA 2XR1A 3ZH9B 5AH0A 1E2PA 3CJQA 2BONA 3WZMA 3MD0A 4K3AA 1EE2A 1RKXA 2YXNA 1WZCA 1H8EA 2HJHA 3G0GA 4ZVOA 5SY6A 2XF8A 4NENB 3STTA 1JG7A 2PCLA 2VHWA 4LYDA 3T38A 1AP5A 1IWOA 2YRWA 4IH9A 2QSZA 3ZDFA 4BWFB 4C0QC 1ZL8B 3W8DA 1CUEA 1W8IA 1I1QB 4MSUA 4AWBA 2BFEA 2JLSA 4RHXA 4WN9B 3U7HB 2HIAA 5FBHA 5TGTA 3Q3GE 1YQ9A 2O8CB 1RACA 4E13A 1NIPA 3ZP4A 5L6LB 2WFAA 2MT9A 2RDCA 4CQLB 3SR2C 3SQLA 4UPEA 4AS1A 2XHBA 1O95C 3EDMA 3LHDA 4ZO7A 4KQIA 2IX3A 1SBYA 2ATIA 1QVFU 4K40A 4O0LA 2PE5A 1T2AA 1ZN9A 3I53A 1NDQA 1O5IA 2R2GA 3T7TA 4FYPA 3ANLA 5LUBA 2N42A 3MBKA 1CIJA 4X91A 2ACVA 4NQRA 4NBSA 1KE1A 3CPJB 3UG7A 5L8VA 1M83A 5DT9A 3CC7F 4JS0A 1HNWO 1O96A 3OONA 2CFIA 4XDZA 3VAAA 3CRNA 2D6FA 4MQ4A 2ZRNA 3SPCA 3I12A 3Q3VA 4LXIA 2ID9A 1EGMB 5I47A 1E8NA 3DEFA 4B3SB 3D6JA 2ZI6A 4D7SA 2BM0A 1MN6A 5DMXA 3DZKA 2HYDA 4TRJA 2UXCB 4I7EA 1ACLA 2GFIA 1CZLA 3FROA 1K97A 4H3KB 4BB9A 1W48A 3PRKE 4AJIA 5KAFZ 2AZ4A 5A2QA 2E48A 2GEDA 5CFQA 1TYCA 1EXMA 3ZWAA 1W85B 4XLZA 3PHCA 4EG7A 5JJEB 1W41A 5T67A 1G2PA 4BNDB 5AKHA 1N32B 4EPYA 1XLTC 3MWKA 4OXYA 4YFYA 5JFTA 2PANA 1UM8A 3BDAA 3ZWKA 4B3DA 1GOTA 4WFJA 1GL6A 2QEQA 3E58A 4B7UA 2Q2NA 4OD0A 2AGAA 3GJYA 1I4TD 1T4DA 2Q5ZA 2VSOA 3ENVA 4N7JA 5KBYA 4X7RA 2IIQA 4EMSA 1E8DA 1ZJZA 1JMKC 2Q45A 1GNQA 4ZOAA 4BQQA 3PGJA 4ZJUA 2IITA 3FDJA 1MC1A 3QP9A 3WLSA 4U0KA 1WPXA 4MV1A 5CMLA 3OX1A 4XB2A 1R8SA 1C9YA 1RFGE 4WK4B 1X1TA 3B2EA 1YTFB 1OAOC 4U2FA 4JQZA 5ABPA 1W36C 4F1WA 3KYCA 4FGZA 5ALVA 1QWOA 5BR4A 1K3TA 3LRXA 2H2AA 3GRVA 4KQKA 1Z56C 4MV9A 4CKCA 1R1BA 2YZMA 3PU6A 4BMVA 4EM6A 2AG5A 2O50A 3PUWA 4UNIA 4TV8B 3K9WA 3KQOA 2VJBA 1DBRA 2Q9BA 3DL4A 3OHMA 4M9SA 3IOMA 3UMVA 5CFZA 5FHRA 1F7YA 2JDIA 4TXMA 3ZHXA 3FTNA 1NGSA 1OU4A 3TZEA 1DKPA 2BFFA 3QG1A 2QGFA 4OQXA 4QJ4A 4WVFA 4QLBA 2AQ8A 3KUXA 1XDBA 2HD4A 1GAQA 3CIFA 3KCQA 3ZZTA 5DFAA 3UMRA 3L0BA 2P4HX 5ITZB 3WNBA 1FDRA 4JJ4A 5IRCD 2W8ZA 4YRKA 3QKIA 4ZEOA 1EIWA 4CKEA 2ONYA 3NT2A 3OR6C 3ZJ4A 1HORA 4FIZA 5GJCA 1P4RA 2ADMA 2MDTA 2O52A 4V2IA 2BYTA 1IN7A 3ZXIA 4XR9A 4JENA 3H9EO 2O3QA 3AEKB 1TAEA 3PFNA 5KKCA 1N25A 2R2AA 3LT1A 1YHQF 4N5NA 1DIOB 5IWAO 3K6JA 4R16A 3WIOA 3ZBQA 1DKLA 2RGEA 2ZRQA 4JVOA 1LA2A 2P2DA 5GVRA 3UO8B 4DSTA 3JX9A 2DKOA 2GPYA 3AESA 3DWGA 5A2GA 2P6UA 3EDOA 3IX7A 1T5OA 5L9AA 1S0VA 2XNDD 1FX0A 2LCAA 1K9SA 4HBZA 4Y7CA 3GJ5A 1YI8A 1Y7PA 1WDTA 3N6XA 4TMFA 1I14A 4W1QA 4XWAA 4YV7A 3DTNA 1QGAA 2DYYA 3NI2A 4ARCA 1VL2A 3ANNA 3ULKA 4H7KA 5HP7A 5EIXA 1JTFA 2OMEA 1FJGB 3ABZA 4J0GA 4BX2A 3IBFA 1WZNA 2OTJV 2GN4A 2VK8A 3QLUC 3K1YA 2HA2A 1PL4A 2ICAA 2DFLA 1F20A 1EBOA 1W1IA 2V7XA 3R3YA 1WCIA 1Y3CE 3TLYA 2JD0A 2WTBA 5JRZA 3DW1X 3KG2A 1DMSA 2QTSA 4C0WA 4MSWC 4GZ6A 4WZAA 3U0BA 2RK4A 1FMCA 2CNNA 4M0DA 5K8UA 5KDLA 3W05A 4OP2A 4X62O 3LQKA 2WALA 3T1HO 2D1FA 2VZ0A 4EOGA 1J42A 5EGNA 1DUVG 5AM1A 2RH8A 1QGYA 2JDIG 4MJ7A 5I7VA 2VXYA 4HNAA 2JPDA 1NSYA 2QQFA 5EJIA 3MN1A 3PXEA 4DLRA 3GVIA 5H83A 2XUZA 1U1EA 4LF4O 3CH4B 3PEUA 4PPQA 1K73H 2ADFA 4O4IF 3ZHRA 2RB5A 3OIYA 4P35A 3TD5A 1N1EA 1QO0A 2NN3C 3FNRA 4YJDA 3T12A 5L3VA 3JCUZ 1BDMA 2A1UA 2OE2A 1E7KA 1VJ1A 1NVPB 1Z5UA 4NXMB 2BKAA 3CEPB 2OCIA 2ZIXB 1RIIA 3QMPA 3NBZC 1RXSA 5HWEA 4FHDA 3V4OA 3ILHA 5AK3A 3LI2A 4EMUA 4FM9A 1KDOA 2AUNA 2MSNA 3OTWA 1LPPA 2WYVA 4YRRA 2IPMA 2PUEA 3NEAA 5CXXA 3LY7A 1G2OA 2CWJA 1VQPV 4UE2A 1AUQA 2EYUA 2COEA 2G77B 4JV5O 1I33A 2AQHA 2I76A 3KTDA 3R0IA 3QFSA 4EAAA 1H5UA 4X66B 1U0HC 2J7PD 1QU7A 5IEBA 1SZQA 4I9GA 1TU3A 2AHOA 2V9ZA 3RVLA 4XW2A 4LQLA 5FLXA 3JAMM 2HSWA 1Y6XA 2N74A 2CE7A 2YUTA 5HEKA 1KY4A 3KVVA 2PZBA 4G26A 4A0HA 4AS3A 3O3CA 3EEFA 4QBKA 3AYZB 2X14A 3AF2A 5EJ9A 2WUFA 2GUWA 3QLVA 4JCCA 1HWYA 3QY9A 5H68A 4YJ2F 3HTNA 1YT5A 1MEEA 4L4SA 4R40A 3S1AB 4EYQA 2ARHA 1H1LA 4M60A 5J9PC 4F21A 3CRZA 1RXWA 4PI0A 3P9XA 4GZMA 4L7VA 3O3NB 3JD0A 2F43A 3TLAA 4QKQA 3AUYA 2IV3A 3TUIC 2Y0EA 2A0UA 5B2FA 3W8FA 3HCEA 3DHYA 4EHLA 4Z9FA 3ZCSA 5I4BA 1FX1A 3GEBA 3C1OA 3V4FA 2HNAA 4QGAA 3N75A 4JI3O 2VDKB 1T4BA 4B3BA 4C1BA 3DZGA 4TV8F 3L72H 5ALEA 3WRXA 2X7XA 3QKRB 4IGFA 4Q4DA 1NKVA 5LQSA 1OR8A 4FKZA 5IWAB 2I33A 4ZHVA 3Q0IA 1LC3A 4LZPA 4LVCA 5IN5A 4HGNA 2YH2A 3E61A 3R9KA 3GG2A 4YMVA 3ZQ6A 1IUOA 3BOSA 1J2TA 2B20A 1ZAKA 1TM5E 3HADA 3KJQA 4C04A 1J5EB 4W5QA 2AJDA 2IUUA 3M89A 1YSCA 1IUNA 2PZGA 5FTWA 3TOZA 3VHXA 3QHQA 1XNRO 3BRCA 1MJFA 1OKKA 1KI4A 3ME5A 1IOVA 2C9OA 3OEHD 4ZQBA 4KYIB 1WHTB 5GV8A 5B3SC 4L9WA 4QVKA 2PFGA 5TLSA 1EB9A 5JO0A 2CLEB 4E2ZA 3KKOA 3K9SA 3VYRB 2WAYA 4KQXA 3L0PA 2QV0A 5EVCA 3WYNA 2IHZA 5HCIA 5D85A 1DCTA 4R7GA 2UYQA 4JBHA 2R6GA 4S0ZA 3U4GA 3DF7A 1H69A 2VT2A 4RELA 1PQWA 4RTNA 4HQKA 1EWQA 1QIEA 4E22A 3BA9A 2QX7A 1BS1A 2ZS7A 4FB4A 3F98A 2IW5A 1GM8A 5COQA 2QWOB 1E60A 2JW5A 4HZIA 1YI1A 3BBPA 2BC9A 3RSOA 2HO4A 3TPZA 1M6VA 2F59A 1P60A 3GA7A 3UMSA 4F2WA 4L75A 2NMVA 4X3MA 1Y4UA 3ZDQA 1L5OA 2V5VA 4QYMA 5D3MA 3JZMA 3CF4A 5CEJA 5FEUA 3FD8A 2WJJA 1ULAA 2WNSA 3TI7A 1Q44A 1XQ6A 2NLOA 2VJMB 2JJQA 2NUBA 2A5YB 3M4XA 3IMGA 3OEED 4HS9A 3QKUA 5AHOA 1JB9A 3B9BA 4B76A 4F2DA 4AP5A 4E1AA 2WKPA 4FJ2A 2WTXA 1TZJA 3ED5A 4G4GA 3HSYA 2QPLA 1I2MA 1IE3A 4TWJA 5DF1A 5CDYA 4CI0B 2V7QG 2LUOA 5BSUA 1V5FA 3RRNA 1AHHA 1NJIW 4QE7A 1JKJB 1RYNA 3ZDZB 3N8HA 3ZPXA 2PXHA 5GJWC 3VV2A 2EBUA 1EI9A 2EIXA 4JTCB 1PJBA 2XDWA 2BMDA 3IR6A 1VF6C 1W6RA 3C1AA 3EFOB 2GTSA 2OXIA 5CBKA 1H4QA 2G07A 2BJWA 3C3DA 3D8HA 2RBEA 2G9NA 4DBLE 1HKUA 1X7XA 2J3MA 1BCSA 3FB5C 1CZKA 1D2HA 3HJCA 3KOMA 3BZUA 3W0LB 4ABYA 4AQDA 2Q1SA 3GEGA 4GWGA 5KNCD 3VH2A 3CCUF 3CSXA 3WMEA 2A1UB 3UICA 3M83A 2B6NA 2HJVA 2IBMA 4FE3A 1RC8A 2AGVA 4JWTA 2ZDIA 2IV7A 4CKZA 2DGDA 2XVZA 1CXZA 2WT8A 2DKFA 1BN7A 3BD7A 2BFEB 4ND7A 4AYWA 2WMNB 3F0EA 1IAVA 1XU9A 2PSJA 2Y77A 3RNLA 2XQVA 1XL0A 1Y74B 1W87A 3R5HA 4YRAA 5ALKA 5BVGB 1EFPA 3DBRA 5K0EA 2V9PA 2YFHA 1CP3A 1FNCA 1IHPA 4LSMA 2ERYA 3EVAA 4QRDA 4TKUB 4R8KA 2NU8A 2ZI9A 2JI8A 3CLHA 2QNRA 1LI7A 5EE5B 1OFTA 4AP9A 2AKEA 3RBZA 2Z2IA 1II9A 4M9XA 1KI6A 2JGKA 4LAFA 2YWDA 3EMVA 3AJ8A 1JU3A 4ENSA 5HQ3A 3B5IA 1UZAA 1TA4A 2ZNJA 2YOHA 1A4UA 3QK7A 1RXYA 4L16A 1U6KA 1YJ9F 2IZOA 2QX9A 3ENZA 3ETEA 3BUSA 3ETHA 2QN6A 4ZT5A 4XR4A 1GVNB 4QGSA 5ICGA 5HJ7A 3C6QA 2C88A 4TTPA 4Q3NA 5LMNO 2C00A 2FR1A 2JFXA 1FFCA 3V6LA 3PPYA 2OUIA 1J33A 5HXZA 1EEHA 1HP8A 3P52A 4TKUA 1JE1A 4YJGA 1MJNA 1SBTA 4D3YA 1V3VA 1ONOA 2F9LA 4ZC1A 3CCFA 4HNQA 1RYFA 4KDRA 3SKYA 2VYNA 2IKSA 3WJPA 1CUFA 1BCRB 2LVBA 3KL4A 4J03A 4QBFA 3TEMA 5BV2P 1WSBA 4F38A 2WIKA 2WNIA 2ZZKA 3M1AA 4E33A 3PFKA 5C52B 3LQQA 2CGEA 2GM9A 1GKYA 3N8NA 4M6WA 1Z7EA 1JLHA 2YXHA 3I04M 4S2EA 1UJ2A 1K5PA 5BURA 1QIJA 1UT5A