4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
3HKBA 5CA1A 5BMVB 1SA0A 3HKBB 4DRXB 2RHLA 4O4LA 4ZHQB 4TUYB 1SA0B 1TUBA 5CB4A 1TUBB 3WGNA 5JQGA 4O2AA 3WGKA 5JCOC 5JQGB 2Q1YA 2R6R1 4B46A 3JAWA 4IHJA 4I50B 3M8KA 5LYJB 4IHJB 4I4TB 3JAKA 3HKEA 4ZI7A 3RYIA 3JAKB 3HKEB 4ZI7B 5EIBD 4X20A 5EZYA 4X20B 5EZYB 5LOVA 5JCOA 4KWEA 5MN6A 5LOVB 4HNAB 3V3TA 4F6RB 2R751 2VXYA 1RQ2A 5J2TA 4WBNA 5CA1B 3UT5A 5J2UA 4WBNB 5LXTA 5J2UB 3UT5B 3HKDA 4O4LB 3VPAA 4M8IA 3JASA 3HKDB 5CB4B 2Q1XA 5JVDA 4TV8A 3JASB 4O2AB 5JVDB 1W5AA 4TV8B 3ZBQA 3VO8A 5IJ9A 3JAWB 3VO9A 1W581 1FSZA 5IJ9B 3E22A 5IJ0A 4O4HA 3RYIB 3E22B 5IJ0B 2GVIA 4O4HB 4TV9A 1Z5WA 5KX5A 3JATA 1TVKA 4O4JA 3JALA 1W5EA 4TV9B 1Z5VA 5KX5B 3JATB 3HKCA 4O4JB 4B45A 3JALB 3RYCA 4XCQA 5ITZA 1FFXA 3HKCB 4EB6A 3RYCB 5ITZB 1FFXB 4I55A 4EB6B 3CB2A 4O2BA 4I55B 4U3JA 4FFBA 4O2BB 5LA6A 5J2TB 3M89A 4IIJA 4U3JB 4X1IA 5IYZA 3WGMA 2VAWA 4IIJB 4X1IB 5C8YA 5IYZB 5LXTB 2VAMA 4EI8A 1JFFA 4LNUA 5C8YB 1W5FA 2BTQA 1JFFB 2XKBA 1W5BA 5JH7A 5KMGA 3N2GA 1RLUA 1RQ7A 3RB8A 3RYFA 5JH7B 5KMGB 3C8LA 4X1YA 5M7EA 3RYHA 5CA0A 3RYFB 5GONA 3R4VA 4X1YB 3RYHB 5CA0B 5GONB 5EYPA 4U39A 3WGJA 4E6EA 4ZOLA 5EYPB 4ZOLB 1TVKB 4DRXA 4ZHQA 4EI9A 5EIBC 4TUYA 1W59A 2RHOA 1OFUA 2BTOA 4DXDA 2RHJA 4O4IA 5FNVA 2RHHA 4O4IB 4I50A 5FNVB 5LYJA 4FFBB 5LA6B 4I4TA 4X1KA 5MN4A 3VOAA 5LP6C 4X1KB 2XKAA 4LNUB 3ZIDA 2BTQB 3N2GB 4YJ2A 4YJ3A 3N2KA 4HNAA 4YJ2B 4YJ3B 4F6RA 3JARA 5MN5A 4EI7A 3N2KB 3JARB 5LP6A 2VAPA 3VOBA 3ZBPA 3WGLA 5BMVA 5LP6B
chains in the Genus database with same CATH superfamily
1E1LA 1N6NA 5JALA 4HMPA 5LKRA 4PBTA 2OENG 1KRXA 1XDUA 2IIBA 3QF4A 4IW3B 1FYEA 4LF8O 4C7MA 3H86A 3OWHA 3UHOA 5AJTA 3NWJA 4RZSA 3FSRA 3ZIUA 2PT7A 3KETA 1FSPA 1UOQA 4UEOA 1RW4A 3RSQA 1NVAA 3WDKA 2IH1C 3VUFA 2WUVA 1M57C 5K0JA 1ZIOA 5KX5B 1MT3A 4AP9A 2H7YA 1SKYE 1GZDA 2VYND 1NUTA 5LOVF 8AT1A 2GN1A 2QN6A 1NXPA 1O6ZA 5BN4A 3OCCA 1DZIA 1U8CB 1IYZA 2HHHO 5EMMA 4K3VA 1USKA 4DV0B 1G9XA 3QP9A 4C6SA 4CF4A 1C4WA 1E9DA 3AG2B 4KPYA 1RQNA 3AVUA 3B52X 3FFAA 1NJFA 3R5XA 3NTLA 3MLEA 4O2BF 4W82A 1Y7LA 2O3SA 3GIWA 3M4ZA 1W2BU 4AO6A 1Y6XA 5EJ7A 3QUTA 2GCPA 5EOVA 3A25A 4WV3A 3GB9A 3ZN1A 2CHUA 1U9CA 2QP3A 4QX6A 1KVTA 3OQHA 3C9UA 3CYQA 3N0TA 3GGCA 3VVMA 5CX4A 5G4VC 4J1TA 4R69A 1ZM3A 3KR9A 4EPXA 2Y1GA 1JXOA 3IAS6 4NBNA 4Y67A 3LYUA 1ND5A 4O2LA 3BFPA 3CUYA 4XSHA 4J8PA 4N12A 5KNDA 3GHHA 3IKTA 3GDFA 4M1EA 1CYEA 4FOPA 1JHMA 1BVHA 1L6RA 2QYHA 4HOYA 1PWHA 4H08A 5DCUA 1NY6A 3VDMA 3I4CA 1JG4A 3MIZA 4F9GA 4N3BA 3PQDA 1GEGA 2FU5C 2KMLA 4KJZA 2OE2A 2Z3ZA 1CR1A 2GNPA 2IYUA 2Q6KA 2I91A 3TEMA 4HN9A 4MW3A 1REQA 1DCKA 1IE3A 5AVQA 1JH9A 4YT4A 1LEHA 1ZJ5A 1OXXK 4MV1A 5CFZA 4MEBA 2WWWA 1PDVA 4NECA 1KQNA 2RJ3A 2NVUA 4X61A 1A5SB 1HOTA 5MN6A 3HWSA 2IG8A 2JD1A 1RXEA 2VDUE 1COWG 4UFZA 1FNKA 2EYUA 1YCFA 3KBOA 4B6EA 2GZDA 1EFCA 4PHZA 4YRCA 4IHJF 4B7EA 5K5EA 1PI3A 4YV2A 3PXDA 2G3YA 1O9GA 3NJ4A 4Q1AA 4U2KA 5JNRA 1Q81W 2PWAA 1XHOA 2Z2IA 3CNQS 4GBED 1K4MA 5ADWA 2QI2A 2XRYA 3WJ2A 3CSSA 3R8XA 2YC4C 3DH0A 3RJ5A 4C05A 1RQXA 4KR6A 3RKRA 3EVEA 1C9JA 2BMAA 1R74A 1VE1A 5C80A 3ZZ1A 2Z95A 1N6RA 4LYJA 2F1OA 3F7YC 1P8JA 1YQ9A 4BKQA 1NVUQ 2F4VO 3KJGA 2GK6A 4B2YA 4BZXA 1PZHA 1V5WA 4EG4A 1XTBA 2BGWA 4CS4A 1I01A 1GGJA 3AGKA 4JR0A 4A0QA 2BFMA 4RTQA 1CR2A 3R5TA 3SC2B 1FDVA 2I2DA 2BV3A 4AL4A 1YDEA 3B51X 3ORFA 2B5WA 2I2WA 2X0JA 2LFRA 2RGBA 4RZQA 4QU9A 3FYUC 1XEQA 1RZVA 2HR3A 4FMBB 1T4GA 1FQKA 2JVJA 1VIYA 1ISJA 3R4CA 2NO6A 5DSXA 2AOUA 2IFTA 2LIPA 4ALKA 1GRQA 2F59A 1QFMA 4C2AA 2ETNA 2V59A 4YRAA 4DBVO 4BZWA 1QOZA 4RCZA 2IS4A 4BRWA 4DZRA 3J81A 2MW2B 1D2AA 4EHJA 4EKIA 1GIAA 1QHFA 2LBXA 3TZQA 2FPGB 2Z8XA 1M5TA 2AFIE 4LOJA 1MNGA 1BW9A 3GT0A 3U1TA 4OB7A 4V2IA 3WR5A 4PTZA 3EZ2A 1U28A 3DWFA 1CUVA 2V55B 3NALA 2CVHA 2ZT6A 3SICE 3GWZA 4A0GA 1LLFA 2PY6A 3K4HA 3QLVA 2QSZA 3TL3A 3GELA 2QLLA 1G3QA 2O3TA 2OCIA 3WRWA 1MXFA 2HCFA 4RU1A 3WZLA 1K8AH 5F73A 3N76A 2AVDA 3GPBA 3BILA 1YJWF 2I7TA 3EPJA 4NOLA 5EIAA 3ZWPA 3OAAD 3C1TA 4BY9E 5EE5B 3KB8A 4NXNB 3LVBA 3V8VA 1T6ZA 1JJ7A 3QUCA 2XGOA 1G42A 1LVHA 4Z9BA 2DQ3A 4TS9A 5EVCA 2KSQA 3GLIB 4MUXA 3G85A 4ZOLB 3CM0A 4JN6B 1O7JA 4TWKA 3W8EA 4QLOA 1VQ7V 3H2BA 4EK9A 5CT8A 4GVPA 2WJYA 3BD7A 1I36A 1I1QB 1DT5A 3DD5A 4F6RA 2YHSA 1ZCBA 5EEHA 2WRZA 1QKJA 4WZAA 3DDHA 3JZDA 3JZAA 3EPRA 1Q84A 5KAMA 4XGNA 3T5BA 1F2UA 5BYKA 3U61B 3NAZA 4WADA 4NBKA 2GFQA 2HCTA 2JK1A 3N2YA 1H3FA 1UF9A 1F8FA 3K53A 4ZEXA 3QO5A 2JJ2G 4P4UA 1YVRA 4M7WA 1CIPA 3ECCA 1OYYA 4L3VA 1PR1A 3KXDA 2HMWA 3A6KA 4PRZA 1L8DA 4M1SA 3EVCA 2FEKA 2J3JA 2R2AA 3SKXA 4ZQFA 2ROQA 3RE1A 2VRZA 3DNPA 4MDYA 4EI8A 3INYA 5CYPA 3KJFA 4DM7A 4LVCA 2X0RA 1TU0A 3B1ZA 4DV4O 5FKJA 3T4EA 4TUYA 1U0NA 1KMCA 1UBLS 4G0MA 1J2YA 3MQ4A 4KLCA 1IXKA 3N7UA 1XI2A 5HJEA 4E5VA 1AGPA 3OOWA 4ECAA 3DV0B 3HU5A 4IZHA 4NB5A 4X88A 1YBMA 3QWIA 2X8AA 4I5GA 4DHEA 1SK8A 1ZD3A 2YIVX 3IIKA 4DCSA 2XIQA 4P2ZA 4PXAA 3KOMA 1AO3A 1EZVH 3WK9A 4KE7A 1E2FA 1XCOA 3RRFA 2E48A 3KOXA 3BCUA 2PH7A 1KGSA 1SCIA 3FUTA 3K5MA 4G2KA 1I0HA 4WOPA 3EYAA 3LBHA 5MDHA 5B1YA 4MMXB 2HG5C 4LG1A 1R0BA 2GUZB 2R1VB 1U3TA 1S3GA 4FLYA 6LDHA 4GPD1 3PFGA 4OMCA 3K70D 4TMVA 4B4KA 3H65A 2QI9C 1V39A 3NHZA 1BCSA 4WNIA 1H2HA 2IV2X 3L06A 4QPCA 4REMA 2A7WA 3OD4A 1KMNA 1IXSB 3RVDA 3BXGA 2VWGA 4YRNA 3WGJA 4LWSA 3PFHA 4JZYA 4WCDA 4JEMA 2NT3A 2FW7A 3WNVA 3GVXA 4GMGA 3CG4A 8GPBA 4CW7A 5KSPA 1YF3A 1HDIA 3L0CA 4U2EA 4EQ6A 1CP9A 2HXSA 1GU7A 2P9BA 4F7WA 1BEZA 4YACA 4L87A 4N3GA 3HTNA 1PQ4A 2IZ1A 2FGYA 3I42A 2NZJA 2V4MA 4URFA 3NBXX 4Y1RB 1XKLA 5D5PA 3KHTA 2Q1YA 5IAJA 3RTAA 3BABA 2C8JA 1XCMA 3D7RA 5CDFA 4DYHA 4LH7A 1IY1A 3UWMA 1YR2A 4I4LA 1K3EA 2EZUA 1GTZA 5J23A 1M2FA 4AO8A 1I4OA 1P80A 4BLVA 1PGQA 5HYVA 3GRPA 2VDNB 1JV2B 2QMOA 3KD3A 1EP9A 1RQRA 5I7RA 2WSSG 1M8KA 4NPAA 4F92B 1TMKA 2ZYRA 1VCHA 3S2ZA 3K0CA 5NLLA 3N5CA 3WQHA 3JVIA 3JQFC 3V97A 4PC7A 2XGMA 3GEPA 4LZAA 1HI9A 3B36A 4YMGA 1PEKE 1Z7BA 4LSWA 4TKZA 3S3WA 3UKDA 2N3ZA 2GF9A 3CH5A 4I99A 1O5TA 3HFGA 3CUUA 2ATVA 3UA4A 2DETA 4CZZA 5LL6Y 1XDGA 1Z5GA 4GBGA 4EBFA 1Y9JA 4W9NA 4E5SA 2A5GA 2QPAA 3FFMA 1JPJA 2GGSA 8ATCA 4L95C 4MKRA 4RHTA 1ZNWA 2GEVA 2O9JA 5C32A 3QV1A 5DB4A 3O84A 5T6BA 4YWJA 1LNZA 2MYPA 1NT2A 3HUDA 4MPPA 3A4LA 2AN5A 1ZSNA 4OAPA 3IDSA 2A0YA 4L28A 3AVXA 5HKBA 4XCXA 1LRKA 1GUAA 3AIKA 3WL5A 3UO2A 3VU1A 2NR5A 3RGWS 3OU7A 3F6MA 3WLLA 4KXQA 4KITB 2Y05A 1L5MA 3EGOA 2IYOA 1RJGA 3QMWA 5JH7B 1XCJA 4J80A 3GRUA 4QTYA 2J5XA 2WPNA 3V4OA 4BQEA 2VIIA 1DRWA 2FN4A 5IRCD 1FRQA 1CJTC 1AXRA 3VMMA 4QD3A 2MSNA 2VHQA 1LBIA 5HDBB 4Z7QB 1EFDN 2QZZA 5C51B 2ZB2A 4UCVA 3KYJB 3N2KB 5I7HA 2AF3C 4G5XA 2UZ4A 2Y93A 3D8UA 4KE6A 1FS6A 4PFJA 1BHAA 1HLGA 4NBTA 2FQYA 3IAEA 3E7XA 5JSHA 1MOSA 5T8KC 3OWXA 3LPNA 3ZCUA 4F4JA 3KLNA 3QOXA 3NPAA 3BK7A 1GEEA 2ZCJA 1CNMA 3OP4A 2XMQA 1NVFA 1WMAA 1XDDA 1PBNA 3EGIA 3LQ4A 3SFZA 2ITCC 4DR4B 3WAGA 4ZT5A 3BWBA 2WZBA 4MW8A 2C2ZA 1NNLA 2JJYA 3HB5X 1S3FA 2XUKA 2CMGA 3C4VA 1JIKA 3IR6A 1YNOA 2C7VA 1DB3A 3I2GA 1MJ5A 1TA0A 4WXEA 3RWOA 5BNTA 1VP9A 3F78A 4NLLA 2Q2VA 4CS3A 3IB6A 2ZLBA 5JE8A 1S3IA 1TIPA 5KVQA 1NI8A 4FHGA 5CT5A 2ZZKA 1VLJA 3U3KA 3KZOA 3NTRA 1TUEA 3H4IA 5KYKA 3ZGVA 3QXSA 1VGRA 1Y81A 5FAXA 1C3LA 4A92A 5LQUA 3ZKWB 1JIVA 4GKKO 1Y7TA 3IEPA 1KDRA 4MV3A 1N2BA 3I9OA 5THQA 3JYHA 1Z7EA 4LWQA 3TZHA 3ABZA 1GM8A 1AN9A 4YJHB 4EKYA 3T9BA 4CFSA 5FWNA 1WMDA 1EKXA 3VO2A 3KWMA 4KQHA 4DBZA 2JKYA 4PYQA 1JHXA 1J07A 1J23A 2D0IA 2GCOA 3X1WA 1Q14A 6REQB 2AR9A 1BMFD 1YDWA 1U1CA 1KVUA 2WHYA 1XMOO 3WGVA 2OGZA 4NYIR 4BVGA 3ZDYB 1EDBA 3RVKA 1EX9A 4GZMA 4J6EA 1E3LA 2AG8A 4D1YA 1SNYA 2XI4A 3M5WA 4UJ3A 1T2FA 3VJRA 2WQ6A 1RU3A 1FP2A 5B7QA 1IVYA 1LS6A 2R97A 1JSZA 1ECGA 1Z75A 4PF1A 3EMKA 4JI3O 3JAMA 2MMCA 3ZE7A 4GX1A 4AS2A 1SM4A 3NTOA 1C8KA 3R44A 1VXRA 3MJ4A 1H6AA 5L53A 2YQZA 3EXFA 1UKAA 2I55A 5KJFA 3TCNA 1N32B 1RKQA 4GHWA 1RWNA 1M8FA 1HZZA 3MMSA 3CC7V 4AJ1A 3MLAA 1M5RA 1AM4D 1U3CA 2P9TA 2X86A 3ICEA 4Z0NA 5FADA 5A7HA 4TMYA 4ZZ1A 4V0NA 2R7LA 3KT6A 4OF4A 5HUJA 4W63A 1CY4A 4AG6A 2C5FA 3R09A 1MC8A 2P75A 2LKCA 4Q3OA 5K6AA 2C0PA 1Y5IA 3QHAA 2FN9A 4PGHA 1XXHE 1FXKB 5FLXA 2PGDA 1PE0A 5L95A 1W9MA 2JCXA 2ZE7A 4YHHO 2IV7A 1Z17A 4WUTA 1YIJV 4TV9F 3TETA 3FF1A 5I8PA 1UBEA 3QTCA 1TCCA 2GERA 5KNDD 2X5KO 2KI5A 1TUGA 1ZHHA 3FBWA 2WI8A 3KQVA 5IAKA 4YPVA 2XE6A 2UVQA 1OAOC 4P0TA 2EP5A 1JSCA 3HCRA 2YH2A 2IWRA 3MHSC 5L3QB 4E70A 1SG9A 5GIOE 4LQ4A 3K1AA 4F12A 5FD8A 1KJZA 3Q1KA 4QHTA 1JAIA 3O83A 4LJKA 4F3CA 3ICVA 1OW3B 2BP7B 3P30A 4B83A 1NTOA 4JLNA 2B98A 4YQYA 1IULA 4WH0A 2HUNA 2I9PA 2OORC 3R6LA 1ORIA 1EVIA 3D3IA 4PC2A 1IZ8A 1RS0A 3SYRA 3WMEA 1KOGA 2PYZA 2D2FA 4R05A 4CR7A 1U6IA 4FI3F 3SWWA 3RJMA 5CNIA 4TOIA 3PD0A 3LKVA 2L6LA 5LPNA 4HS4A 1OLOA 3DBIA 3VBBA 4J16C 3PUKA 3UCSC 4ZCRA 3V7UA 2DH6A 4EKEA 4BJ3A 1EK6A 1PVVA 2IDMA 2XTMA 4RS3A 5L3SA 5EE0A 5ALDA 2HCBA 4TTVA 3F0GA 1EB8A 4HAXA 3RC1A 4IIVA 3HXLA 2XOKG 3GEDA 3IVRA 3I8OA 2VF2A 3ERNA 3FW1A 1OFTA 2MYUA 4G4SP 5BN5A 5JS7A 1BMQA 2VXOA 3CCRV 4CM7A 1VL5A 3V6MA 4ARIA 5A71A 3BY6A 2JZCA 4DARA 4UVHA 2OUKA 1F6BA 3TLKA 1SXJE 2XUJA 2R00A 4ZVMA 5EZYF 1E3EA 1P33A 4LJ8A 4BU1A 3L7BA 2R68A 4OXQA 4CDMA 4Q6WA 1Q19A 4CWAA 2CZGA 5LQKA 3KR0A 4BNWA 4INZA 3DEZA 1QIDA 2QRPA 4IH9A 1PHPA 1TFUA 1W7AA 1IJKA 4JBLA 4IGGA 4L8WB 1J9GA 2D6FA 4XYEA 5SZHB 3CHYA 3PHGA 1VQ8V 1Z56C 2JGKA 1UMDB 3WO0A 1W30A 2WVJA 2HS0A 3G2IA 1W73A 2GJ8A 4G8CA 4DJEC 3WG7C 5JDCA 4LRTB 3A2NA 2HUPA 1NZFA 2A84A 2FJPA 4TS3A 2ERXA 2QJ1A 4A2CA 3QTYA 3ZDRA 3ZP4A 3R8FA 3G9XA 3I9MA 3AHGA 2XT0A 2VDLB 4HP8A 3JYCA 4LOIA 1OTHA 5DCVA 4GMXA 3PPWA 3SYMA 2NXCA 5F51A 3L72H 3JAWB 2V9ZA 2GVIA 2H3HA 3OUFA 2Q0SA 2JHPA 3EVNA 2NAFA 3QKUA 1U9IC 3CEIA 1OR8A 4DUYO 3M6VA 4BECA 1Q15A 2ZSIA 1GFSA 3CMAV 3NDJA 4DJFC 1K7FB 3IVGA 3H2JA 4E4RA 1H8EA 3H5WA 2VHTA 1E7RA 4YUAA 1P6XA 1D7OA 4P4SA 2PSJA 4H6PA 1Q1EA 2VDMB 1YFZA 1O97C 2I76A 3CJHA 5IZCC 3I23A 4MI6A 4EJSB 1U2GC 4YALA 2HB6A 1EUYA 1TUBB 1TA4A 4O2AA 4LXTA 5G41A 3GU3A 4AFNA 1ZRSA 2YYZA 3JXEA 4ZCMA 4ZEMA 2YXHA 3ZJ4A 5A9SA 3D43A 3W5IA 5DHAA 1U0JA 4DR6B 2IX3A 1FVXA 1I0ZA 2Q3FA 4FD3A 4TTTS 1VF6A 4DCVA 2Z1MA 2VO1A 4B48A 4II7A 1TF2A 3LOPA 3VZQA 3GUCA 4Q3EA 4JBWA 3GGPA 1SY7A 4L02A 4KGXA 4B3MB 3PL1A 4HR7A 3LDCA 3TPFA 3G89A 1S72F 1MA1A 3B1WA 3RC7A 1I3CA 3AVPA 1PQUA 3O9OA 3F0FA 4CM5A 5IZ4A 2I2CA 3EUFA 3GV0A 3WLRA 2J3KA 1I30A 4B7UA 1X86B 3T1CA 2O2YA 4WD3A 2OKCA 3B1YA 2IS1A 4MS2A 4CEJA 4CZ2A 1PTJA 5B3JA 3X2FA 4AUEA 1AUPA 4GW3A 1V8FA 3VOBA 1MPTA 4OHOA 1H9BA 3NBMA 1NONA 2R11A 2IOYA 3DZBA 3Q88A 3EQ9A 1VQ5F 2QTBA 4I4TB 1GXSB 1TQ4A 4L9AA 4KK4A 3I2YX 2UZ1A 4IGKA 5K1XA 1YB7A 4UBNA 5C3UA 3R76A 3WMWA 2YMQA 2I5PO 4UCTA 1F9EA 5DXAA 2G67A 1SKAA 3ONFA 3AGPA 1J8DA 3H3XA 1ESCA 3ZHCA 3UY4A 5JRZA 4GFDA 2PQMA 2P5UA 4RWEA 5AP9A 2OD7A 4NFYA 3GLTA 2LP7A 1E69A 4JYYA 1Z36A 4R1QA 3PN1A 1FVOA 2VYNA 2GSDA 1Y7PA 5E4FA 3OLVA 4I5FA 1F8XA 1JG7A 3E35A 4RD4A 2ZWVA 4JBNA 2I6QA 1AT1A 4HGPA 5DE3A 1IZ9A 3ILXA 2X6QA 3BA8A 4GYYA 2CE2X 3OMIB 2QI9F 4AJ4A 1XILA 4DG5A 3W3AD 1K9VF 2HRRA 3FDZB 2SKEA 2HA6A 1ZI9A 1FSFA 1RTKA 3IJEB 4I4TF 3DDSA 4YBZA 2G5GX 5ICMA 3IPCA 2RGRA 3GJQA 3OW2U 3IFXA 4C4WC 1Y98A 3GLFB 3FAVB 3PQ8A 4M8KA 2QWOB 3C2QA 2DCUA 2C99A 2O0KA 4V0ME 2NO9A 4DLAA 1KIAA 3WYFA 1KMHB 4U3JA 4QFDA 1T2VA 2DWOA 3QMVA 4ZAVA 2B6HA 3GUYA 3LPDA 2OCPA 4PR3A 3QEKA 5IK2D 4YECA 2FZCA 4LZOA 2LBPA 2UYNA 4NKRA 4DUGA 4QYWA 3MBIA 1W59A 2VSQA 4MINA 4DLKA 2IHBA 5DN6G 4UFPA 1JI0A 1SUBA 3KWLA 2AIZP 2A3RA 1M7BA 3WWYA 1FP7A 4KWCA 3HVKA 1NRJB 5FO1A 2ILMA 5CMLA 3FIJA 3CX8A 5FI3A 1FBNA 3UBTA 1CSEE 9ABPA 2XQIA 5I4CA 3PKZA 1Q57A 2PR7A 2Q6IA 2WJ4A 1OWOA 2DT4A 4IEFB 2CWJA 3UK2A 3R0PA 2D1TA 1KC1A 3V1TC 3BFXA 3AFHA 4OPHA 2RK3A 5FPTA 3ETQA 1BOOA 5CK4A 4PYMA 4KMMA 1GYQA 1YE8A 5KX5A 4QJ4A 3ASYA 4PCUA 1AQ6A 4I4CA 2NU8B 2IKQA 1M10A 2QKAA 2EBWA 2F3QA 3VUEA 4NFLA 5IX8A 4ACBA 1SZXA 3MCWA 2NP7A 1GYPA 2V7PA 3BK1A 5FYQA 4AN1A 1LWOA 3QMMA 2OV2A 1XT6A 2NZVG 4WLFA 2JAPA 3V7YA 3EMVA 4D6PA 4C3ZA 2ORWA 5HFAA 1KAQA 3SC3A 4RQBA 4O29A 3E3LA 4HSEA 3FOWA 2VT2A 1AVTA 2H7VA 2O2XA 4ETWA 4EW3A 1UZUA 3P9NA 4FDMA 1Q0LA 4L5JA 2JFBA 1QDLB 1DI0A 4DQ0A 1BJRE 3TBKA 2QYTA 5DTEA 2DT5A 1WCYA 2QDXA 1R3IC 2I6DA 4M87A 3HI6A 1Z16A 2FTKE 3KJHA 4YYEA 1U1FA 3K14A 2JG3A 2W2NA 1OXBB 4PEVA 5DN9A 3I4LA 3UGKA 1KYVA 1XXLA 4CMEA 3CWBH 4OMDA 2I1VB 2PHZA 3L4EA 3TPZA 3AERB 4MVRA 4XCQA 5JBQA 4YRTA 3K0DA 3TWOA 2B9VA 4GM4A 4PI2A 1OKKD 1Z34A 3OT5A 4QC2A 2AG0A 5JR3A 1IU9A 3CNOA 1ST3A 1KKCA 3TRHA 3EPKA 2C7GA 3MTAA 3I72A 1CUBA 1PNOA 2W6NA 3HFRA 2GX6A 1DRKA 1GVNB 5CDGA 2GBFA 2QWXA 2QWRB 3T8YA 4UU8A 5BWBA 2E4AA 2I4MA 3OZIA 3B3FA 3H8SA 2YTZA 1QH0A 4OHRA 3QWFA 3D6UA 4YCSA 3CCQV 2NAPA 1KD1H 2FWMX 1NQOA 2Q1UA 3OFKA 2DF8A 2XCTB 4UXHA 5T4FA 4JI4O 4I3HA 3CC2V 4LF6B 3FRHA 4D74A 4K40A 2QJRA 1MR3F 2X9VA 5HMMA 3JSXA 1EVEA 1XU9A 3T3MB 1IHDA 2ZKOA 3WJ7A 3WNQA 4J9VA 1IHYA 1XJQA 1VJCA 3DT8A 1HE5A 5JLJA 1UCFA 2YYAA 3DE6X 1M2JA 2G77B 2PZFA 3TCKA 4X62B 3CGWA 1VSBA 5AJZA 3IMFA 4IXNA 4JROA 2I4RA 3E2IA 1XRRA 3CRZA 1X8XA 4ZWNA 3IILA 1YVDA 1W42A 5ALUA 2CTQA 2CDCA 3G7SA 3FPGA 1KQSF 1CFZA 1XK6A 4DO2A 4BV8A 2WA2A 5EQDA 5G3YA 5C2JB 4NDNE 4AY5A 4JSYA 4KQ1A 1FIUA 3WAJA 2C5BA 1UINA 2JGDB 3WGKA 2R6R1 1FW8A 2AW3A 1SXHA 2J9GA 3OJOA 2Y4NA 1BFUA 3SC2A 3I0MA 5CDUA 1HYHA 2B7BA 1K3FA 3UUEA 3WE7A 4RMJA 3IT1A 3IOYA 3HL4A 1A69A 1QKKA 5LMNO 3CCSF 5HS4A 2M2IA 4DLSA 2LJ2A 1RAEA 1DQNA 1MQ8B 1NOKA 3DOHA 4FE4A 3RSOA 1BWSA 4WGFA 1R15A 3D5QA 3E8SA 1CPYA 4I55B 2Q9CA 4MR9B 1P4RA 3HP7A 1V1JA 2CNBA 1BXKA 3GHZA 3I6IA 1UZMA 1YZNA 4PLVA 4QAJA 1VA5A 1KY4A 1H2XA 3DAGA 3HC7A 3HR0A 2QQFA 4A6EA 3KEOA 4QUDA 5DM1A 2IJKA 1G8JA 1L5SA 2FPGA 4JAVA 4L8VA 4JTCB 3P10A 4ID3A 1SZDA 5DBHX 4GOLD 4UMDA 3FCAA 4Z5XA 2IPXA 3PGVA 4AROA 1E7QA 5KHGA 4MB6A 1N1GA 1JLLA 4NOJA 3BWVA 4HAYA 4LXUA 1GARA 4B3DA 1PR4A 1WJZA 2XT6A 1J2RA 2BOVA 5JOQA 4W6ZA 1QIHA 3ANYB 1A9QA 4OUDA 4FFVA 3DMTC 2CHTA 1BYUA 4DR3O 3IQDB 3P97A 2PY5A 5HXAA 3ZJYA 2OR3A 1VQ6F 5CEJA 4DQKA 2H06A 1Z6QA 1B6GA 3EXHC 4BGDA 2OY0A 6YASA 1EFHA 3KQLA 3ZV4A 3STZC 1SGWA 4TN5A 2ERCA 2VQEB 2HMYB 3DAYA 3GLIA 2RHBA 3GOHA 4EUHA 4NCBA 1FDIA 2JGAA 4ZOLA 1NXWA 3ILYA 3DL0A 4JJ4A 1AR1B 3O3NB 5IJZA 5EI5A 1QQ5A 1QDEA 4B79A 2ZGVA 3WWOA 3PSAA 2JLUA 3GLQA 4TX1A 2J31A 1YJ9F 4LTNA 3MCUA 1OY1A 1Z0IA 2HIAA 1IURA 2UXXA 3HFSA 1Q74A 3R6WA 1DAMA 3C7DB 3K9CA 1RVV1 3CCEV 3L92A 5A0VA 2YOHA 5GTHZ 5JAUA 3FJ1A 1TJNA 2XCIA 1MVNA 4L6CA 1P7BA 3AVYA 2XLBA 4C30A 1AF4A 2YVLA 1FQJA 1LQTA 1WDWB 5JZ9A 2EL7A 4G5HA 2X0EA 2HQSC 2BBTA 2FSFA 3E5NA 4JP8A 4II2A 1THMA 4V3CA 1KK0A 3ANXA 3Q87B 3DV0A 1WA8B 3MG9A 1H9AA 1Z6GA 4RE6A 3JZMA 1VFNA 5EXSA 3E81A 3IDZA 1XEFA 1KC8H 4R9VA 2CNDA 4YMUA 3PPXA 5D8DA 2OC9A 3ETNA 2IF2A 1RHQA 2G08A 5CGZA 1H2EA 1SCKA 1B0AA 1VYUA 2KM1A 3OQMA 3C4QA 2VGNA 8ABPA 4EHHA 2M6KA 3FIUA 4F3RA 2WWTA 3DZ8A 1WSBA 1PR2A 1RYHA 1NUQA 3Q7SA 3PUJA 2Q8QA 1B04A 5IPFA 2R1VA 3ZOPA 4MYDA 2ZJOA 3HH8A 5DM6V 4MSWC 5BY1A 2VPZA 5JIBA 1NMSA 1EXVA 3ASOB 5CIQA 3NIWA 2PD4A 2BTQA 1TMOA 1ECFA 3H2SA 1SCBA 3OBBA 1PJZA 2JCGA 1VK3A 4XVCA 3X2SA 3UENA 1X6VA 1GNSA 2WJWA 1TCAA 4U7NA 2VC2B 2SICE 3M82A 3RD5A 4LBEC 1NZDA 1NU6A 3G6EF 4IMRA 1HPLA 3SXUB 1GCAA 5B5EZ 1P5RA 3K9AA 4PCLA 7GPBA 3LC2O 1CBUA 2ISCA 4NFSA 1QIJA 4EYGA 2H17A 2YICA 1E59A 2X2PA 1T5OA 5DRYA 1XTSA 5HP7A 1G4UR 4REQA 4AI6A 4JB3A 1M2EA 2OBYA 3I2FA 4PYIA 5EXXA 2J6BA 5JNWA 5K3OA 3GDHA 4L16A 3SKYA 2FFQA 1Q83A 3IHKA 4HQ6A 5H0IA 4ZVKA 2VZ8A 1Q0HA 1IN6A 2WJGA 5KOJB 4LYYA 4EFDA 1G59A 3GDGA 1UBUS 3ZDBA 3RSSA 2J6CA 3C70A 3FVTA 3V4VB 3WSVA 5K01A 3L7IA 2FR1A 1D09A 3GUVA 9MHTA 3THWB 4TVBA 4Q9LA 2JIZG 4CKXA 4PNPA 2Q3DA 4PSCA 5DEOA 4XM2A 1G0NA 5FBZA 3O1JC 1PDOA 2P1ZA 4MUEA 1Y9DA 4Q48A 3FAZA 5D3QA 1V8ZA 5KVCA 4R7TA 3T9FA 2PDAA 1NT4A 1WXHA 3QU7A 2CXUA 3SHFA 2AN1A 3HJUA 2ZKIA 4INJA 5LOVB 2JFHA 4ZV9A 4AY2A 1L8OA 2FHSA 5EXPA 1K88A 4G4GA 4YRZA 2HCJB 3F71A 3IIJA 2QLFA 3ZOZA 3RLFA 3Q0TA 1JP7A 2QUZA 3SDSA 4HWRA 4MYCA 1DWOA 2QA4V 3QPBA 1QVFU 4G85A 4OLFA 5TEVA 4K28A 1DTOA 4O2BB 3ZHXA 1QR6A 4BEWA 4LI3X 5FOTA 3P9KA 4G0PA 5JH7A 4G4SO 3R3SA 3T1YB 3O4JA 2IELA 5EESA 3K2IA 3NHKA 3HJFA 2BFWA 3RT1A 2XE4A 4OA8A 2IHVA 1H93A 3STLC 4KKXB 2VF7A 4UHFA 5DCYA 4IDNA 1HM5A 1Z0ZA 4Q01A 2FWJA 3N2KA 3ZXSA 2FQ1A 2WNIA 5D2CA 3L8ZA 1GQSA 2OHOA 3HJNA 1KHHA 3GMTA 3UAVA 2F3RA 3T5MA 3N0RA 2QKSA 5K0NA 3LPAA 4FLEA 3PX2A 2F6RA 4UCOA 2UYYA 3FPJA 3GLKA 5I7WA 2Q45A 1CB0A 5ECWA 5IG2A 3ENZA 2V6MA 1XK7A 5COQA 2H94A 2WA1A 3SG0A 1ABBA 4HN2A 3PC4A 1IPEA 5IVPA 4Z2YA 4MWZA 4YYZA 4XIGS 1LA2A 1EZ4A 5JSKA 2AMJA 1N33B 2BEWA 4LRUA 5FHQA 2N05A 2QN1A 2JI9A 3A26A 4LZPA 1H94A 4GE0A 1PVDA 3BEOA 4MPJA 3GUHA 2JCVA 5HK9A 5GJBA 5CM8B 1L0NH 1U0BB 2YXDA 4DMCA 4ISCA 5K20A 3CKMA 3WDSA 1XRMA 3ZKWA 4X65O 5EFZA 3CX3A 1Q1NA 4IHJB 1JDSA 1JFVA 2IVZA 4CFZA 1KQ3A 2AD1A 5K3CA 3TS1A 2JJ1G 4V2UA 4D0GA 1VRCA 3L0DA 3U7QA 4DUGD 4YASA 4BQQA 5ITWA 4YJHA 4YS6A 2FPPB 1I10A 3JASB 1R3KC 1KYTA 1OIXA 3OEEG 1BHSA 3EA0A 1P0FA 3STXA 4C7JA 1RCFA 3AL3A 3QKIA 4MULA 2TMKA 3AEQA 5FUMA 2PJDA 1JG1A 3GFTA 2Y3IA 3A05A 4GYJA 3TLJA 2YZNA 3WQBA 3SC6A 2JGIA 1P2UA 4AHCA 1K06A 2XCSB 4FMPA 3OTFA 1NBEA 5EYPB 4D9GA 3FZNA 1JR6A 2IXBA 2XX3A 2VHVA 3C3JA 2HA4A 4WKGA 2NADA 2KKWA 3VX3A 3MCVA 4EMTA 1H05A 4FMDF 3U4MA 2FWRA 3ZHTA 3TR0A 2HREA 1T3SA 3E9MA 4C21A 3GZNB 3FHCB 5CPBA 1CQJA 1NSFA 4PX3A 5KOYA 1IHXA 4JU9A 2P6MA 4UTNA 3FMPB 1XQ9A 3HKDB 3PE3A 5IM4A 2IVFA 3OM8A 1R8JA 3E8XA 2G9ZA 4MVUA 2HXYA 3H5NA 4ER3A 3U13A 4ZD6A 3ZCXA 4TQDA 1FXKA 3ELCA 3ZS8C 3S0JA 2QWQB 4X64B 4RD2A 5A2GA 4KDCA 4TWZA 4RGQA 2YJ4A 1VJRA 1P5JA 4D5EA 1L7EA 4CMAA 4B6JA 3EFOB 3V3KA 4I5IA 2CDNA 4NMHA 4UBMA 1SQFA 3V8RA 2HP3A 3RK0A 3P0IA 2QLTA 4FDVA 3AHCA 1ZAKA 2A1TS 2ZTMA 3TNYA 1NH2B 4GKVA 5C4GB 2CXXA 2IHZA 2WPDA 2YZ7A 4PO1A 1G16A 2C7BA 4J94A 2ZQYA 1K7YA 2XODA 3DLBA 4LKRA 1ULTA 2C1ZA 3OMXA 2ZBGA 2BUCA 3ZY6A 5DGXA 5L3QA 1XV2A 3DAFA 1SQPH 1L4UA 1MA3A 2BP7A 1ZJJA 1M72A 1AQJA 1IJFA 2YWXA 4OM8A 2FYTA 1U0GA 4NH0A 5CITA 4OPAA 4JS0A 2Z1DA 3D6TB 2IEIA 3SPCA 2BIFA 3ZK9A 2RMKB 3V55A 5LL6P 1HWYA 3DWIA 3BCRA 2ZYIA 1T0AA 2HQ1A 3TZEA 1PZEA 4O4HF 3GQVA 3A6JA 3LFUA 2FRDC 1Z8DA 2HPZA 3Q7RA 4NARA 3KZ1E 1WNSA 1KI8A 4LF9O 1QRUA 2WALA 3SDBA 3D2BA 4DIEA 1QVVA 3OO0A 1G5HA 4BYMA 2NSDA 1AN0A 1ISRA 1Z2OX 2X2OA 4IJQA 4KLNA 5HMLA 3RFRA 2UXBO 1N36B 3N7TA 2AXEA 1RFYA 4LKOA 2HNAA 4G0VA 4URYR 1NJIW 1LDGA 1XNHA 3O95A 2XWPA 2IEAA 3IURA 1Z6YA 4H7DA 4UNQA 1R00A 4M9XA 2QW8A 4Q03A 4Z6KA 4LXGA 4CM9D 2GA8A 4D6TH 4G28B 1EZZA 4QBKA 1A98A 1ZGJA 4Y9RA 3DVRX 3H2HA 3IBSA 1J0DA 4JT8A 1YB5A 2DFNA 4R2LA 3YASA 4ENVA 4FZVA 5F2NA 2CC2A 4GXTA 2AOVA 4RYDA 3VDNB 4PZEA 3W78A 5FTKA 1QFJA 3JQPA 4LHSA 2IPLA 2EKBA 2H92A 4KP4A 3MJDA 1G6Q1 4HDCA 1QCZA 1UMDA 5I4IA 1VQOF 2XUHA 2PWYA 4DQUA 4G81A 1BDMA 5CA0F 2I2XB 4TMZA 4XRRA 3WKCA 4UEJA 1A9OA 2I65A 1GZ6A 3RHTA 3QIAA 3QBVA 3MGAA 5CCXA 4ZTUB 1U7OA 3OE1A 3O7MA 2EFYA 2YBEA 3HA7A 5LFAA 3VMFA 1CY0A 2RAUA 4LRSB 4G4IA 2BKVA 3DEHA 2MHCA 4CKWB 1U8TA 1O54A 4U6SA 2A5DA 3QA3E 1E63A 5EAZA 1KZ7B 4KDRA 2HSWA 4GBJA 1K5DA 4G0NA 4QECA 3G0CA 1PZNA 4CG1A 3K09C 1B6QA 3JYNA 4YMIA 2L82A 3DFUA 4UD2A 2AW5A 3NBYC 1GKFA 2FFBA 3M9XA 4OQPA 3FUWA 2Q3JA 5F78A 1T25A 1L4BA 1NNUA 2C2BA 3L82B 4ALLA 1OBFO 2XOEA 2GPYA 1QYIA 3I73A 1JT9A 1DTWB 2UXNA 1H85A 1T1IA 3ZVRA 2N42A 2PL5A 1CVLA 2XXBA 4GSKA 1ZN9A 1KDZA 4BT2A 4EJSA 1RFLA 4N1AA 3V2GA 1N1EA 2IQ5A 4N6OA 3R7AA 6PFKA 1TUBA 3WBKA 5DI9A 4X71A 1K0UA 5DNVA 4K1LA 3LY9A 4DR5B 1OHHA 2DCMA 2BF4A 3AKDA 4DB2A 3W3AA 2ODAA 3KEQA 1R6XA 2X0NA 3M1XA 4X3LA 5L4LA 3CRRA 1A1VA 3OQIB 2AJBA 2ZYVX 1KZ9A 1GL9B 4ID9A 4WOKA 3R7SA 1HLFA 2H4ZA 4AZVA 1ZNXA 3JCUZ 4WZBB 3CHXA 2IGTA 4IIXA 3VZCA 3LLSA 2VA8A 3FR7A 3RSGA 1JQEA 2KQUA 3GTZA 2QM7A 4NE9A 1RIFA 1D6NA 1DBPA 2P11A 4DDTA 3OUUA 3HU1A 1Y63A 3DDCA 3DE7X 4MGEA 2CJYA 3X1KA 5LMUO 4F85A 3A3PA 5B37A 5IK2A 4H37A 4RHFA 1ECJA 1N6IA 5KB3A 2Z3YA 4N5HX 3OOJA 2RHTA 3F5WC 5BSFA 4BVQA 5KPDA 2QRVB 3E84A 2WAYA 3CP1A 5EIOA 1GPUA 1GXSA 3MTGA 4NK5A 3OHPA 1UAAA 3R7DA 2VDWB 1HORA 2AQHA 3J7AU 3QE2A 1VSUA 1P5ZB 5JG7A 2CK3G 5AVXA 2RARA 3OTGA 1GTJ1 3KOUA 3P4XA 1NM5C 3E2MA 4BNVA 1YQDA 4NATA 5KTNA 1A77A 2R7NA 1O8BA 3DOIA 2F48A 1JKIA 2WF9A 3V7WA 5DOVA 3EWSA 5BN3B 2Y1WA 3W8FA 4I5SA 4OYLA 3GGOA 1QYCA 5JNUA 3AJ8A 4IRMA 4LJ5A 4UCSA 4X6LA 3H2GA 3H2KA 2YHBA 5AW5A 2G07A 1YHQF 5LZ7A 1KKLA 3MB8A 4WJKB 3NIBA 4RJKA 5DPMA 3ELDA 1X13A 2OZLB 1SUPA 3TNLA 1X9HA 2JK5C 3OF5A 5K0TA 3FDZA 1ZVJA 4UCFA 1XVIA 2XMDA 4IDBA 2AI1A 1CR6A 4Y2SA 3A2FA 1YI0A 5EJ2A 1ATZA 4YNBA 3GLFA 1IV3A 3UN1A 2WHXA 4EI2A 1II8B 2ONZA 5AKEA 3AQ4A 2C29D 2HBYA 1YZQA 4YT2A 5C52B 2VAXA 2O7SA 1JDTA 2OVFA 3PJEA 2QNIA 4NCXA 1KMHA 4M1KA 1M1YE 3DMGA 2CMDA 4ZQIA 4PN7A 1JR3E 3WGUA 2XCOA 4MCAA 4AD8A 1PVOA 4JMPA 3B09A 3II6X 4YLEA 2J7KA 1CX9B 3TZLA 3V9PA 1OKKA 4OJYA 4ZVUA 3DR5A 4PV7A 4UPDA 3QIVA 5B3SB 1Z37A 3WGZA 1G98A 2GEBA 4YHBA 3NUGA 3AXTA 3VNSA 5LD2B 1Q7EA 1QHNA 5MN5A 2OCCB 3V1KA 2BCJQ 1SVSA 3OX4A 1IBKO 3IP3A 4HH4A 4AMYA 2QMZA 1ZM7A 2JLZA 5JXWA 4RLSA 3VYWA 4Y6QA 2D8MA 3QEAZ 3COYA 5DNAA 2ISSD 4PIVA 2RG7A 3TPCA 2V1UA 3LQ1A 4DN6A 3BKXA 3MS4A 3CNHA 1J4AA 4FBLA 3AL0C 1BIFA 1DBWA 3QUBA 3ESXA 3VR4H 3BMOA 1IQUA 1COWA 3K1JA 2H2AA 5EZQA 4A2QA 2W4QA 2NU8A 5K2MA 3PNSA 4JI1B 2NP6A 4GIBA 3AIMA 3LQKA 4C8EA 4E3ZA 1M57B 3M81A 1QQCA 4PYNA 4Z54A 1F4NA 3IC9A 1H0RA 2A2ZA 4UTOA 2NQ8A 4S24A 4HBNA 2KTVA 2CLMB 5E79Z 4TKUB 4MO2A 1XJWA 2VFAA 4LIPD 1LQUA 4JENA 4CKCA 2FKXA 3UM7A 2H0AA 2W2TA 4EI7A 4RTRA 4CLOB 1IB6A 4ZT3A 1Q6IA 4YROA 1QNFA 2HV9A 1SCJA 1G6HA 1BXGB 1G3IA 3LFHA 4LCEA 4DLPA 4R8SA 3T4UA 5K3DA 2VOJA 3C85A 1JFSA 4BQIA 2P5SA 3HDYA 3IPRA 2JATA 4K1XA 3EIQA 1QAMA 2OEPA 3UMSA 1IK6A 4PNZA 4NPCA 1NHWA 1U5BB 3E1YA 3RC9A 4RV9A 3FSJX 3VPAA 3HDGA 4PHCA 5A5FA 4U3FH 4X6UA 2V6JA 5EE9A 4IICA 3ZHZA 2WYOA 3D1VA 5JZVA 5LZ8A 2IITA 1G20E 1CDZA 1DBFA 1FX0B 4TV9B 2EQBA 3ZRVA 2V6FA 1CF9A 4XOIA 3ZLJA 4GO1A 5HY1A 1E3WA 2V7TA 2E6KA 1Q86H 2YOGA 4W8OA 4RCVA 2C2HA 3WWEA 2QVGA 2OCYC 4D99A 3CRW1 1J25A 3E23A 3IC5A 3L46A 5AFSA 3IIIA 2FR8C 5T6MA 2LGWA 3KUCA 2ZS9A 1JG3A 3AM4A 3DW3X 2RQ6A 3MILA 2I7VA 2E5LB 4QDXA 3DTNA 3AU8A 3DXYA 4NQZA 1JB9A 3G71V 1L1FA 3G9ZA 3CXUA 2QD3A 4QOGA 5CUQA 3B38A 2KHZA 3UB4A 1NNSA 4Q66C 3HN7A 3JRNA 4U1RA 1YASA 2CBZA 1UK8A 3ZY2A 5TQ0B 1O6CA 4D8YA 4HXYA 5KCZA 3Q5GA 3U10A 5EXTA 3W1WA 1XLWA 4L08A 1BWQA 1XZCA 4YB8A 2ZCEA 3IVAA 2P06A 3DFMA 1Q3TA 2H9YA 1BDIA 4C0JA 4ENRA 5BORA 1ZU4A 4AS3A 2GKSA 1WEKA 2HXGA 1K8YB 4ZXFA 5B66Z 1KK3A 1ZH6A 3DO8A 1C8BA 3LGXA 1RWBA 3RWBA 4FIZA 1UWCA 3A6DA 3WS7A 3VTIC 4Z49A 2WT9A 1LK7A 2GHRA 1H9CA 2Q0OC 4WESB 1ISMA 3DZKA 3K2EA 4J11A 2E3JA 4C07A 2WFLB 1Q82W 2JGDA 5D1HA 4X44A 3WU2Z 3NRCA 2VG8A 1SZQA 4Z4FA 1BVUA 3ZZTA 1DELA 3MAQA 2ZPUA 3KLOA 2IZOA 3R3ZA 4HX9A 2A9JA 1J49A 5EZYB 3RHFA 5GJCA 5KYGA 4OG2A 2HOQA 2FZGA 2O2CA 2QTVB 2WM9B 3ZXUB 5ED4A 5AKYA 1JG6A 3A1EA 2JJ2A 2RGAA 4FILA 3W90A 2WDZA 3DBLB 5K8IA 4LHYA 2OYRA 1RQPA 2HF7A 4I55A 4GVXA 1P5FA 1O0BA 3OFVA 3L7QA 4MR9A 3FYUB 4KB5A 3NWPA 2ZW9A 5FDFA 3G0BA 5F3WB 2XT9A 2YXYA 1D2MA 4N4AA 2QY9A 3VJKA 2GFIA 3W7SA 3TLZA 3D00A 1JS1X 4KQFA 3GFOA 4KO2S 1ZWLA 4JLDA 1JT2A 4IKEA 3JPYA 4R16A 4I1SA 2OWOA 2PRZA 2WSIA 1MA0A 1FJGB 4PICA 5IY5C 2UYHA 3CTMA 1EM1A 2OKGA 4DRYA 1NBMG 4ARBA 3CU5A 4D96A 4O3FA 3PGXA 4QOFA 1W0KD 3I04A 4F91B 3ZVNA 4DPMA 3DXRB 4WXMA 1LR1A 5CA1B 3BZUA 1NI5A 5DF1A 1C7IA 3UEOA 1YZYA 3BGSA 5FPHA 5AW0A 5J5AA 4PYRA 1C3OB 5JO0A 1WETA 2D62A 4G0YA 4CTMA 3KP1A 2FG6C 1J2UA 3C3WA 3VIUA 2AC7A 1NDHA 1Y6QA 2P65A 1AS0A 2WPDD 2Q8VA 5EKUA 1NUHA 4IUYA 3NT2A 1EHIA 5CVEA 4IUCS 3BUSA 3NBZC 4DYVA 4DIBA 4H4CA 2ZRLA 3OIWA 2PUAA 4BO8A 4RJLA 5EHIA 1VQLV 1Z8NA 4WRRA 1DARA 4O4JF 3N86A 1DC6A 4ENSA 2YJZA 3LDFA 3OY7A 4QU8A 1M34B 2OWDA 1T0BA 4AWBA 3F4LA 5DHPA 2QTZA 2HKIA 3DO6A 4MVCA 4URHA 1JHAA 2HMUA 1SBNE 2HBZA 2UVPB 1JVBA 5FCDA 2QTNA 5TR9A 3VV2A 2GBGA 4DR1B 4RH1A 1TT5B 1ZMBA 1VDZA 3LUGA 2VLIA 3WFJA 1Z7GA 1LKZA 2VNSA 1UFIA 4DMHA 4BMDA 3S29A 1PSWA 3RCBA 5CA1F 2QGNA 2EEZA 4HAMA 1WIWA 2CFCA 3RFTA 1NU8A 1ZM2A 3I61A 4RBNA 1WB6A 5G2OA 1OAAA 5GM1A 2PS0A 2VEDA 5FPOA 3W2FA 1G5IA 3KQMA 4YJDA 2WSSA 3GGGA 2W9XA 5A02A 1GQYA 3MDOA 3P2IA 1X1SA 2PX3A 3Q8HA 4S1OA 1J8FA 1BC5A 4B87A 2K2WA 3W7WA 3TTUA 1WA8A 2Q5OA 1R9GA 4OO3A 3HBMA 1EE2A 1ZU5A 2YJ6A 4FDUA 1L0BA 1W0JG 2P3LA 1SJ9A 2GB4A 3TQFA 3AZQA 3JQBC 3Q4HB 2VS1A 4PHHA 4M8NE 1TAEA 2D54A 1GT91 3OZCA 3SEAA 1ACJA 2X0IA 4ALNA 3H3FA 2H9AA 4PONA 2HJFC 4JA2A 4FC7A 1F3OA 2ZAYA 3FYDA 4B2IA 2XVYA 1IM8A 1ODJA 1WTCA 2BKEA 4F6EA 2HQRA 2DPGA 5TJHA 3EOBI 3R3WA 3WK8A 2E2WA 1HW7A 3PLAE 1PFUA 2O23A 5F77A 2CHEA 2Z6AA 4R4JA 4OQXA 3NC4A 4FE3A 3HV0A 5DBIA 1DEAA 4WT7A 1O2DA 4U2CA 3T3EA 3CQ9A 1RKXA 5G1PA 2ZTHA 3ZLVA 4DY4A 3DPSA 3V5NA 1KE1A 3R7LA 4NV0A 4S04A 2ODWA 3NV7A 3TG8A 3SXUA 2ZSJA 3KQSA 1FFSA 4Z8YA 1QHYA 3VHRA 2FMKA 2D8AA 2H3OA 1LSJA 4HFJA 2XNHA 4AX4A 1NVEA 3FPHA 5AJWA 2ZODA 4HATA 1M4UA 3D2LA 2ZIWB 3D01A 1B0PA 3QHQA 1CEEA 3UICA 1QTIA 3K0EA 3MT8A 3PJDA 4QJ3A 5AQ1A 2W70A 3UMJA 4MR8B 1PP9H 2NZUG 2F17A 4E11A 2B69A 4RC9A 4J2HA 5KOJA 1UPAA 4WJZA 2DBRA 4PZAA 1KU9A 3ORHA 5L8VA 1KVQA 1Q8RA 1OBCA 3ROZA 3RAJA 1OHHD 4XEHA 4QG3A 4LJRA 1A96A 4UM7A 4OB8A 4KBGA 2GD2A 5HOEA 2XDAA 1RZ3A 3CW8X 3O9ZA 4H2DA 4RIEA 1J2TA 3KR2A 3MJHA 3KSDO 4ICGA 1P2SA 2FW0A 4MQ5A 3GAAA 3GD5A 5AI4A 3T3HA 2ZB7A 3OCUA 1WZUA 3TLBA 3ZJUA 5LOVA 2HI0A 5H4GA 1DEKA 1JJVA 1KP9A 4N0DA 5C8ZA 2DLNA 4WACA 1V8PA 1JIJA 2ATEA 2YWDA 3E6AA 2P2SA 3ID6C 4WXRA 1YJ5A 2Z5GA 4N76A 1GN8A 4U2GA 4O2BA 1BQ0A 4R2KA 5TY0A 3C9TA 3MGKA 3DBRB 1TO6A 2Y0IA 3F6PA 4MV9A 1T9AA 1DLJA 3QWBA 4YJGB 1G9TA 2V7UA 3M7MX 3V7QA 4PDVA 1P1HA 2IZ6A 5AI5A 3LDEA 3LHDA 4LFBO 2QEXF 3KSAC 5I8ZA 1QMGA 3TJRA 1GOTA 3GP8A 4ZU3A 4W7IA 1MQAA 5A62A 4FKBA 3GRZA 2WU0A 2WWYA 4O4IF 2DWCA 1M2NA 2ODQA 4PZ9A 3W5AA 1RBZA 1ADBA 4H7JA 4V0LA 4K9MA 4G6ZA 1TX4B 5K9ZA 1Y8AA 3CC7F 4J07A 2G71A 3T06B 1SELA 4MJLA 4CQLB 3WIEA 1XEXB 4F2DA 1I3NA 4JLSA 1RWXA 1YO6A 4FPXA 1V16B 5IEJA 3CCFA 3F90A 3UQ8A 1P4HA 3P9QA 5KVAA 1N5MA 2EJRA 4EFNA 2QXYA 2C03A 3R41A 4IVPA 5F12A 4WZ6A 2GWRA 3AM1A 3A3KA 4F5WA 2C7RA 2CD9A 5HK8A 4TMXA 2OK8A 4I6EA 5IYZF 1Y48E 3IAS1 1Q5PA 4BMOB 3REOA 3NH9A 1SKQA 4JYBA 4KSBA 5I5GA 2ADPA 3O1LA 4BNXA 1AB5A 1DC4A 3A6HA 3MHPA 3LT4A 4ZPJA 5JAIA 4IHJA 4I50B 5HTKA 1J8QA 3QELB 3GFFA 5BOSB 1VLMA 2IKSA 5JHHB 1ESEA 3PA8A 1SOAA 3DG9A 4BJ6A 3WPXA 3IVXA 3TR5A 3RVQA 1L5GB 3OEED 4O4LB 4M1QA 2AFVA 3JASA 1Z28A 2PUTA 1Q0SA 3ASVA 3IERA 4FOOA 2R8EA 4C0QC 4HGRA 1B2RA 5E6RB 3S0WA 2YXBA 1FU8A 4WFEA 4J1QA 5AI9A 4YAFA 1VJTA 2JLBA 2I29A 5JD6A 3U1VA 2P41A 3FNEA 2ZJ6A 5EYPA 1X25A 4ZMRA 5EJMA 1F4MA 2EKZA 1MQ9A 2NPFA 3PJGA 2C4HA 2QL5A 4B08A 5KNBA 2PO7A 1COWD 1RKVA 2C8VA 1AKVA 2NQTA 1D3AA 1QLHA 1ABEA 1LD3A 4ARZB 4BASA 4JYCA 2IEZA 4QDUA 4JITA 1NE2A 4I50F 4P34A 2XOKA 1RP1A 1TZMA 4B3CA 3E4DA 2W8BC 3LUPA 1EWRA 4DTIA 4QREA 3HKDA 3W04A 4ZHYB 4O4LF 1OWPA 4YDHB 1TEVA 4ZI7F 2XKJE 3WJPA 2CHGA 2HA5A 1WUTA 3R8CA 1TVEA 2OT5A 3FJYA 2FSIA 4CM9A 1N1MA 1W5BA 4URWR 3FGZA 5KYWB 4OHFA 3EVDA 3VAYA 4YXWG 4Q3KA 1E99A 1GU1A 2ZPTX 1QO7A 4QFCA 1M0EA 3EFOA 4JLVA 4MVJH 3DULA 1ORTA 1DJMA 1YQGA 4P4LA 4E13A 3OR6C 1AILA 3MJFA 3OX3A 1F0KA 1QAQA 2OAEA 2OHXA 5EQJB 3CEHA 2C88A 3SQMA 4XZ3A 2FB9A 5JCOC 4EB3A 2R9IA 3S5JA 1UZNA 4MKXA 2K4MA 2QRHA 4M7OA 3S70A 1WHSB 4OGLA 2X0KA 2CZCA 4KCGA 1H69A 2XYVA 3DDUA 5I7SA 4UNRA 3DYBA 4FPPA 4RY9A 1GTG1 2BOCC 1O5OA 4BVJA 3BULA 1V37A 5CD9A 2B2XA 3PVCA 4A6DA 4QGAA 3NTUA 2RMKA 2V7XA 3OOYA 4PQYA 4ROSA 4ZT4A 4X3OA 3SE7A 3DFFA 3PLNA 4Y2YA 3IA7A 5L7WA 3BXEA 4A16A 4UNNA 3HL0A 1DRJA 2UYJA 1GG5A 3NWEA 3RGBA 3PFKA 2A33A 3LX4A 1SQGA 2IODA 3HBJA 4ME6A 3GLHE 4KBYA 2DUNA 1CV2A 5JFTA 1FLVA 5CXQA 3N8DA 1C9EA 2X42A 3SJAC 3IAUA 2AGVA 1PR5A 3TLGB 1MG5A 1YI1A 2Q27A 3KE8A 2H57A 2LW7A 2XEXA 4FLMA 1ZDMA 2R8RA 2LE0A 1IWPB 4OGGA 2DQ4A 1CYDA 2PZGA 3FYHA 4MPRA 1PT5A 2NVOA 4AF6A 2VQ3A 4PPNA 5I5EA 1NFQA 1J1UA 5HKOA 3AG6A 3AVOA 3K8ZA 4IYJA 4P7FA 3IMEA 1GL6A 1UFKA 1HBJA 4NNJA 4V0QA 3TOSA 1DCFA 2BGUA 1DMRA 3STWA 5I01A 4I9NA 1B43A 3B85A 4JEIA 4EHDA 2O54A 1VHLA 3DCYA 4F38A 2OTJV 5DTRA 5AJYA 1PFKA 3BQMB 3H04A 2R85A 1NF2A 5CP8A 1UXIA 4EGCB 1WSWA 2V7BA 5C4IA 1T3TA 2RJOA 1BTOA 1QHTA 1O5IA 4XVRA 4DV1O 4QDKA 3IFSA 2JJ2D 3LUCA 3DJFA 4UUNA 3ICXA 3EEBA 4TT8A 1ZOLA 4R3WA 4DANA 4H31A 3UWSA 2P6YA 1TL7C 4M2LA 5IFKA 2HTEA 3ENKA 3GNSA 3IJPA 3WG7B 2GD0A 4ITRC 2ZUBA 3EVGA 1M90W 1XTJA 1AR5A 1H4SA 2PQ0A 4ZYLA 3VV3A 4NTZA 4K3UA 4ZQHA 4ZOQI 2I80A 2QP9X 1NLFA 3GT7A 4DG9A 3RG2A 1X7XB 4KQ2A 3V4LA 1T2UA 1A8UA 3HEMA 4PS0A 4IV8A 2ZUSA 1LBEA 3PQ4A 3EVFA 1L9KA 3N4ZA 2OO5C 2CW4A 5CHEA 3UUGA 1JHOA 3CPWF 1DTWA 4ZV7A 1BQ4A 4V0KA 4LRXA 4DDKA 2G9QA 5CLIA 3UANA 1ATIA 3OQOA 2HX0A 1RYNA 1PR6A 3HNOA 2CCGA 3KYDB 4XEUA 4JI5B 3I0NA 1XBIA 4P9PA 2YINC 2Z8YM 1IBLO 2GUZA 4RF4A 4RFVA 4WFFA 1LNQA 1A95A 3G13A 3DJYA 3VRHA 3B8EA 1EDZA 5JJLA 4FFRA 3Q5EA 4RVNA 5BV8A 3OQIA 3FDJA 3OBIA 1NF3A 1JA1A 1PSDA 5AOCA 1LJLA 1J06A 3AHIA 4WZBA 1HYEA 1IEXA 1KYXA 2GAAA 3C3PA 2EDCA 1T8SA 3UH1A 4P3YA 3TW8B 1OFHA 2C4UA 2C4WA 1L7NA 2BR5A 4JK3A 3A0HZ 4D43A 1ES9A 1YQEA 1KAGA 4PQFA 4X6YA 1Y4UA 4Y1RA 2BO1A 3KNZA 2PUJA 3F3YA 1EEXB 2EVWX 1DAHA 2VJOA 4D25A 4UDYX 2CFRA 4W1RA 3GXOA 1BJKA 3LQRA 5ENDA 3ABKB 5DN6A 1KYZA 4I3GA 2OYSA 1LC0A 5J1SB 2CT8A 4IXTA 2JC3A 1GZ7A 2G9UA 3OTQA 2QRVA 1T5IA 1XX6A 1KGDA 2PGOA 2CV0A 2FMXA 4CQJA 3FR8A 3A9TA 2FFHA 2WSSD 4IOKA 3THYB 3AEIA 4OHZA 2CWDA 4Y6RA 2G6BA 4DHWA 3CVWA 3RRYA 2PS9A 3NHSA 1QCDA 3VR3A 2YNMC 4ZAWA 4W1PA 2DFTA 3QO7A 2R6DA 1AUOA 2PSFA 4B45A 4HLUC 1WJGA 3P3NA 1WB4A 1ZMRA 1GNQA 3SVTA 2EW1A 1HV8A 3CD6V 5AT1A 5I3CA 2RGNA 5L7YA 2PZ8A 4DV5O 4ZEVA 3UYLA 3PT5A 5LIRA 2YJGA 4MJ3A 2QX9A 3IHLA 1OFIA 4H3KB 1JMVA 3T99A 3HA5A 5KHKA 1KC3A 2HA7A 4A2PA 1Y5MA 1G17A 3FYIB 3ILVA 2HRDA 1U7TA 3CYFA 3Q9SA 4R71A 2WMDA 4B3BA 2YZ2A 3G2JA 1DDIA 3DOFA 3IQFA 1II8A 3QFRA 4D8UA 3S1LA 5P21A 1GTVA 3LECA 4EEQA 3IAFA 3FRJA 5K7SA 3SQWA 2W71A 2JRCA 4HVCA 2FCAA 3BAZA 4Q3LA 4TWJA 5U1PA 1DO2A 3RTGA 3UW3A 3TFOA 4KXLA 5HS6A 3DYIA 3Q2KA 4J0CA 5JS1A 3U49A 4V39A 4BAYA 3I1YA 3G5TA 4EF6A 1IV2A 4F5DA 1EFVB 1RYZA 2PE5A 1B23P 1KZ6A 4KDEA 4PYOA 2QQ5A 2LCQA 3OGIB 3A27A 2AXQA 1YK0A 1WE2A 2O2DA 3TZKA 4IUDS 1DXHA 1WZ2A 1LBQA 4YQZA 2OFPA 2RK4A 4OK3A 2C04A 2WMYA 1GGVA 2Z5FA 3BL8A 4RM3A 4OATA 1EP3B 5EC8A 2WNSA 1ZVVA 3OY2A 3T95A 4LHEA 4PHGA 4NE2A 4I66A 3T0FA 1Z6ZA 1JDBC 2Y1XA 4Q1EA 4Z7JA 2WIFA 3EMDA 3P0ZA 2AR0A 3GNQA 4TKUA 1NMXA 4OQ4A 4FMDB 3T3PB 1P7PA 2C00A 3DR3A 4HWKA 4GOMD 3WK5A 1PZFA 1M8GA 4HF7A 1INLA 4ZDIA 2MSWA 3AEZA 3M8AA 1V54C 1D9ZA 3N3BC 4AJPA 2VUSA 4XWYA 1BXGA 3G5MA 3S55A 4PSUA 3T35A 1QVAA 1QCCA 4QYXA 3CWCA 1ZD4A 2EFHB 2Z5VA 3I62A 3U2QA 1Q6YA 5U4XA 1KEPA 3CPSA 3ZNQA 5KNDH 1ISFA 6REQA 4LVOA 3WIOA 1SC1A 4Y2XA 5LZ2A 4JVOA 4NUTA 1IBSA 2VNKA 3NEJA 3D3WB 3NWOA 3IALA 2O0JA 3QGMA 2C7PA 1UBSB 2GRJA 3I45A 3RYIB 5F3RA 1FX0A 3EZGA 4TV9A 4ZK2A 5KYTA 5AK3A 1OZHA 5IAOA 5GINE 2REBA 2PBRA 1J99A 2QW1A 1X2EA 4NCHA 2P4SA 3DHNA 4BB0A 4WE3A 5FPQA 1VKRA 5FUVA 5TDHA 4QL3A 2DRIA 4HJXA 3AR9A 1XNRO 2M1ZA 3IC7A 3PP8A 4B3TB 3O4FA 1GK9A 3ZYZA 1BHJA 1BE0A 1CY6A 1ZM4A 5JADA 5H70A 1ODTC 1TM2A 1Y6ZA 1T0KB 1GGNA 4DM4A 2IHUA 2A8YA 4JVNA 3CLVA 1RWOA 3QV2A 3T9CA 1JL3A 2QE6A 5GAJA 4RETA 4IJUA 5IBPA 5TQ0A 1YS7A 2N47A 3PRKE 2XMSA 4LQDA 2ZIMA 1AZLA 2YJTD 5BSKA 2V7GA 2P4UA 1U94A 1H0SA 2QXUA 2PMKA 1ODIA 2P5OA 1W0KA 3DSRA 2NUPB 4O4HB 3N2NA 5TF0A 2VQSA 1UBJS 1CW2B 2C9ZA 4E33A 3L79A 3OIUA 5DM0A 1MO2A 4KIWA 2X1LA 3V42A 1Z0JA 4M0EA 1CLEA 2P4VA 1IZZA 3K0KA 1PLLA 4JWTA 4QTXA 1OVMA 3ZWNA 1ZK1A 2P2GA 5BT8A 2L18A 3DEAA 3ZN0A 1Q0UA 1IQPA 4OREX 4D44A 4DYLA 1DAFA 4UMVA 5A5DA 4WESA 1ODEA 2C07A 4C3VA 1QF7A 3L77A 2FG5A 5A3RA 2CH7B 1OCRC 2FWAA 2WFLA 4UOEA 1X7ZB 4FCWA 1NQTA 5TS2A 2H6LA 3BSFA 4CUJA 3ITDA 1OI4A 5EC2C 4BTEA 2XYHA 3TQQA 5BN1A 2Q29A 5EZYA 2A78A 4DV2B 4PTYA 2EBFX 3I9KA 1QPGA 2P0YA 1C3VA 3GJ0A 4DLWA 2QUHA 1TEXA 1F12A 2QTVA 3FPFA 4IGFA 2Q7OE 5CB6A 2N04A 1Q44A 2BVNA 4JV5B 3VJLA 2ZBFA 3FB4A 1LPAB 1EFTA 4TS1A 1UJWB 1AJEA 4JDUA 3DBLA 5KNBD 3VTAA 2Z3VA 3VR5A 1XRSB 4YDSA 1HUQA 3FYUA 4CH4A 3VA7A 1GSAA 3R4VA 5CA0B 1FB5A 4OLBA 3EAFA 5JY1A 2XOKD 3ZE8A 1TLLA 1L7MA 1UBFA 4CUKA 2XBUA 2I2BA 2D1SA 3P9ZA 3KZNA 1Z47A 1RAGA 2X9LA 4XGQA 1DIHA 1GAEO 621PA 2G9RA 2RH4A 1V6SA 1V2GA 2R8XA 2J5BA 1GNRA 3NS7A 2P6PA 1OC2A 1UJ6A 3KVOA 1U0OC 1VSQA 2ZJYA 2XECA 2AQ8A 4UPVA 2XXAB 1B3BA 4K7JA 2Z5LA 2J46A 5KA6A 1KUQA 4DLVA 5E2IA 2GPSA 5BVHB 2NOAA 1N0VC 2OHGA 4CI0B 1XHFA 5FPRA 5GOTA 3EEYA 1V11B 2DAPA 3SS7X 2VCEA 1LZKA 5B7PA 2H7XA 5LBQA 1ZOPA 1C3OA 3STTA 1WKVA 4JYPA 3BERA 4YLGA 4H7EA 1NH2D 3HY6A 4F8JA 3B3JA 1KSFX 3EXHB 1TCVA 2VAMA 1KDVA 1X1TA 4CKBB 4QGPA 4J0IA 3G9QA 1XVAA 4IMIB 5JWRA 1SETA 5C34B 2Q9LA 4QASA 3TG2A 1M34A 1T9GR 3R2JA 1NYLA 1DG1G 3K6KA 2IHJA 4BMYA 4HGZA 3KUDA 4CG2A 3ZXYA 2UVPA 4DCJA 3G1UA 1DOHA 4TZKA 2HS3A 2B78A 4HWGA 4FONA 1TT5A 1IVNA 5CJ2A 1AMOA 3JAWA 5EMHA 5KVVA 1ZPDA 2B8JA 1Y4SA 3OKFA 4INAA 4EATA 1J5EB 3GXBA 1ZRHA 3UTCA 2CVPA 2ADQB 4MLZA 3MXTA 2Y2UA 2O6LA 1TZJA 1IQRA 4Q7EA 3FH0A 4G5GA 4HBZA 5H81A 1N9ZA 2I34A 2ZQZA 5EKSA 2Z43A 3CH6A 5BSEA 2JHCA 5CIYA 5EQTA 5FI0B 1F4VA 1TQ8A 2XGGA 4UCRA 1E6MA 1CEYA 2DMRA 5FO0A 3HN6A 5DULA 1J09A 4H3HB 3NH6A 3TD4A 2JIZA 4M0DA 5E1AC 4ZFNA 3ZDDA 2J0VA 2C3MA 2AZ0A 4NCNA 1E9CA 3Q4HA 1K34A 4KWIA 2ZRFA 4OJQA 3A0UA 3EXEB 3QITA 1ZWIC 3AP2A 3SBXA 3L2OB 3ZWKA 3R1IA 4WXYB 1T6YA 4C7UA 4CN9A 5HJ5A 4IT5A 3HGQA 1GA4A 2PV7A 1XD9A 4RK4A 3F9CA 5K4AA 1VI6A 4B3HA 5L3BA 1G8FA 2BE3A 5FJJA 1L7XA 4TRRA 5FA8A 3FBAA 2ZUWA 3FPSA 4QVIA 3CIOA 4A5SA 1M2OB 2O48X 3L7KA 4YQFA 2QN9A 2ZBRA 4GRAA 1Q7YW 3QZUA 3PITA 3RKSA 4QELA 3E5RA 5JANA 1PV0A 2C1EA 2H2HA 2QA4F 4DV6B 1LUVA 4JGGA 5TXGA 2JKZA 2HJDA 5E6SB 2PK3A 2BOBC 4TZZA 3KXLA 3C8UA 3AHDA 1KXZA 4C0AC 4RDHA 3K8YA 3O8QB 2QQEA 4I4TA 3E0QA 4S1PA 4BC0A 2IC5A 2QPLA 2IH5A 3O91A 5B1NA 4BLRA 1WXWA 4TLEA 4LZZA 3RFFA 3A9RA 4A8JC 4ETNA 3IAHA 5ILQA 4BMCA 5IUJC 4MQBA 3EGXB 1DF4A 1R6TA 1W4CA 1ZUWA 2VSOA 4ZHWA 3IDOA 3L4KA 2NW6A 1XEWY 1MENA 2PBFA 4QTZA 2WYHA 2HJRA 2O59A 4MR8A 5FPYA 3OE4A 1XLTC 2WF5A 4GAEA 5JD4A 3QX7A 1QU9A 3UFXB 3F47A 4WN3A 1OA1A 2I71A 4XSVA 3U0BA 4WK2B 1NZJA 1Z3IX 4QWWA 3AF6A 4BQNA 3QYPA 3N53A 5JCZA 1BOFA 3HLKA 2W6CX 2ATKC 2Z1NA 5B3KA 4JQYA 3JQFA 2RK6A 1S8NA 1ZBQA 3IT0A 4FGKA 2B0JA 5K6RA 1U7UA 2JFWA 1IDOA 4N82A 1U98A 1LFDB 3HYSA 4L4SA 1SPBS 3FAVA 2O3JA 2HA3A 2UDPA 3ZMVA 2Q4TA 2XAFA 1W41A 4NYIQ 1WCXA 2Q0XA 1EHCA 2RB9A 3B6JA 2O2HA 2X0FA 4OI2A 2XTJA 5INTA 4B32A 3VR6A 2PXCA 3ESZA 4AQDA 2UUCO 2E55A 3WO1A 2JJ1A 3Q2OA 4CQNA 2XF8A 3BVOA 2J9ZB 1W581 2Q4RA 1C0PA 2PU7A 2VPIA 1TAUA 5CFRA 2P0AA 2OCLA 5DN6D 4LE2A 4JI6O 1NLYA 3Q3CA 3OEEA 2CMFA 1JDZA 3ER6A 4ONEA 3ZDEA 4KTVE 3EW7A 1W47A 3DBRA 3QG1A 1PL4A 5EGSA 4RQOA 4XBFA 2CMHA 4YGYA 2W0SA 5CCBA 2M32A 1NWCA 3QNMA 1R6DA 4YJGA 4CEIB 4Q05A 2F64A 2GD1O 1OFUA 3E3NA 3RASA 1KFEB 4BB6A 3ZOKA 4B6OA 5ALYA 2B8WA 3VR3D 1A9PA 4GL2A 1VQ9V 1WKBA 4KH0A 4CBVA 4UFNA 4C04A 2I4LA 4A4DA 3ER8A 1UQTA 2GA9A 1NKTA 3HK2A 2IS2A 5CBKA 4X20B 2ZR8A 4ARVA 1VQNV 4ABTA 4HNSA 1OI3A 2BDTA 4I4IA 3KL4A 3A1NA 2P4HX 4MUGA 2ZYHA 4CQLA 1NOIA 1XEXA 2EERA 3IAAA 3DZJA 1V16A 3BOSA 3QYJA 4BNMA 4IWYA 2APJA 3ILHA 2CXRA 2ZI4A 2PJUA 2EIJC 1P3DA 1R0WA 4TWIA 2E6UX 1H7MA 1GTMA 1RM0A 2C4MA 3T7DA 5SV2A 1RJWA 4QJFB 4JODA 1XALA 3WFZA 1AIPA 2YDXA 2QBYB 4BVLA 2FPLA 1O1YA 4RLFA 1N8SA 5ED0A 2IOHA 1W1UA 1DUIA 3K9BA 2BFPA 2B0CA 4B5LA 4PAQA 4GMKA 3UJCA 4GCZA 5HZGA 2Q5QA 3AERA 1D5WA 4OJMX 4IG9A 2OFOA 2WDPA 1YJXA 1DE0A 4HNAB 2ZSAA 3DLAA 4LQCA 3R9WA 2P2ZA 1Y1KE 4L7QA 1KSGA 5IUKC 5K99A 5DO9A 1XRNA 4PCVA 1W94A 3I8SA 4GGPA 2H1WA 1EFRG 1QE5A 4U2FA 3FA2A 1KFBB 3D8BA 1PUJA 3ISJA 3VR2D 4CODB 2VWKA 4A5OA 1GL3A 4XQGA 1UK9A 3B2NA 4U7GA 4JC4A 3HWUA 3O38A 2GZLA 5JS2A 5E6RA 4OFZA 3Q3JB 4PA4A 4K6MA 1QYVA 2P67A 5CDHA 3JVVA 1GUDA 1Q0RA 2DFPA 2EKPA 1VARA 2KLHA 4NESA 2XJ4A 1D4AA 3K9HA 3QE3A 1R16A 4CH3A 2FQXA 1EN6A 3RU7A 3R5JA 4DE5A 2AC2A 4HTFB 2V4DA 3KTDA 3DAOA 1XTUA 2IH4A 1VE6A 3NPMA 1UZAA 2OTCA 5J9PC 2YASA 3ADKA 4B6FA 3S81A 2EIMC 1LDNA 4ARZA 3SSMA 1EDEA 1XAGA 2VLBA 4G01B 4EWLA 5AM4A 4URVR 2WOOA 5GIOC 3IEWA 4KR7A 1V4BA 1RC0A 4FHEA 1D5CA 2I8AA 1IAVA 2C20A 2OUIA 2P4QA 5IC4A 3O8NA 3OD5A 4QUEA 3IR9A 2NXNA 1VQ4V 1U5CA 1RABA 3F5TA 4RVSA 4R2MA 3VKHA 1NMEA 5ISMA 4BGIA 3VVCA 4YY3O 3SE0A 3C87A 2Q4OA 1ODLA 2EX4A 1U2SA 5KYWA 1ZVKA 5BY2A 4UNPA 3JTMA 4RHXA 3CVUA 2FEAA 1AJNA 1W35A 1VQ7F 2TMDA 3TE7A 1JY8A 4QFMA 2ZAGA 3RAEC 3J7AR 1VIDA 3CBQA 1A50B 2W2OA 3MJSA 2CUGA 4H0CA 5HZKA 3OX2A 2ZUFA 3B5IA 4UQOA 4X3MA 3DGEA 4FOLA 4BNGA 4P93A 3DDZX 1KYIA 2NV0A 3GLGB 3I3FA 2FEWB 2HYDA 3GVMA 1RJFA 1GQ2A 1M5IA 4DOMA 4CTOA 4GI3A 4EPVA 1W4AA 1SUAA 4FZJA 2IE0A 4GUDA 4FT4A 1TYEB 1N3BA 5J5CA 2Y1OA 4JUAA 4LR3A 3DP9A 5E7IA 2MCFA 1SU8A 1EVJA 3GVHA 4FYIA 1SXJC 4MTLA 2NVBA 4Z0PA 5LCXA 1DV2A 1GFWA 5FOQA 3F3MA 4O4JB 1LPSA 1JIXA 2DKNA 4BX0A 2OORA 5J4KA 2BM0A 1OYWA 5DXFA 1BH2A 4OI1A 4UOQA 4UUOA 3OJWA 2WZDA 5JVDF 3M1YA 3PENA 1FUYB 3T9AA 2YFKA 1S7GA 4B4OA 3VAAA 1CY2A 2UXDO 4G0QA 4U0JA 2QQGA 4BCCA 2YWJA 3FG9A 1G6OA 1OPXA 5DNUA 5JLAA 2G4LA 3VNBA 1IBMB 1MGOA 5C35A 3ZD7A 2PRSA 1XZGA 4D82A 1IY0A 2Z09A 5EXDA 3V34A 1YL5A 4NYMR 4NYJR 4TRJA 1GRCA 3T7SA 4XDHA 4YCNA 2F8SA 1AHIA 2EZ4A 2W4IA 2AG1A 1AI6A 3VISA 2BBOA 4FZ5A 1VJ1A 2VQDA 5K0CA 2FPRA 1EYZA 4Q16A 2C8LA 4JQCA 1QB7A 5L6MB 1VBMA 3FHLA 3CEJA 4R5MA 2MSLA 4EY5A 2PM8A 3JVUA 2H4XA 3EWNA 3RO7A 1NSTA 4DKJA 4P36A 4IM7A 1XNQO 3N7AA 1A9SA 1I7SB 2GM3A 3BIWA 5JQWA 3W79A 5LNK1 4U00A 3EUAA 3FZYA 4LV8B 3B6MA 3IEIA 3ZHOA 1SESA 1OWLA 3VR5D 3KQWA 5JAPA 1UJBA 1PIWA 1E1QG 2ZDIA 1DDOA 2IP1A 3G6KA 1Z2GA 4J0DA 2NU7B 1H2YA 3CE6A 5C1IA 3WDMA 3PSHA 3IELA 1Z35A 2Z08A 2XDYA 3VU8A 1XU4A 1UPTA 2CK3A 5MFZA 4LE1A 2G6TA 3C74A 1SC5B 2ZXWC 2EKQA 3FMVA 2UZ3A 1MFZA 2PAAA 2WMNB 3I09A 2GDSA 3J81k 3V9AA 3A36A 4GPEA 3EHDA 4OSOA 4U39A 4YP7A 1FYXA 2HY7A 4QM7A 2BE9A 1PJTA 3Q2IA 1FOEB 5A6VA 4LRYA 1L9XA 4FUTA 1SQSA 1YBHA 2FNAA 2MYNA 3DLHA 2BJVA 2ZI5A 1XPUA 1DC7A 1JQ5A 3DXXA 3KYDA 3FPLA 4OFBA 2PGIA 2D1YA 4V38A 1E2NA 5IZCA 5BWOA 3B89A 2DBZA 1EH5A 2AHZA 5G53C 4RTNA 1JKFA 1U2GA 4AC9A 3DTTA 3OQVA 2DWPA 4D9FA 2VEOA 4U4AA 3MJRA 4LCBA 3K6RA 1MG0A 2WYIA 4M8IA 4Q7QA 1F4LA 4RCYA 2HWWA 4XD2A 3JATB 1QU3A 3A4TA 3ICWA 4P32A 4RPCA 4P86A 1FLDA 1AVMA 4BUJA 3B7WA 5C1OA 2CYCA 4KR2A 3TW8A 3DDNA 5KQMA 3OZWA 1JGTA 3QKSB 5HE8A 4RJIA 4D3ZA 1Z5ZA 1QVGU 3I5DA 1OUMA 3RIMA 1OCEA 1E4EB 1GGEA 3PLRA 3CFYA 5KQLA 2BCGY 3QLTA 1CWUA 3ZV6A 4DXWA 3PXCX 1NJ2A 3P2YA 3V4RA 3STUA 2E85A 1A5AB 1CUHA 5IP5A 1WQ1R 3O8OB 3UC5A 1U9ZA 1EESA 1JH8A 2UYQA 5H02A 3D36C 2WWFA 5KYNA 3THYA 2R3SA 5BUZA 3C8MA 3RC3A 2G9NA 4DA6A 5AQEA 2G1PA 3JQRA 3OT1B 3SBOA 3IKMB 3QLJA 1ZR2A 5ULLA 4CF6A 3LFOA 1YBVA 4MVJP 1U3PA 2JIZD 4X45A 5BQPA 4R7CA 4JYZA 2YL2A 3THWA 4C2TA 4AJ2A 2BKAA 1GPKA 1USUA 3ONDA 1QTRA 3RE3A 2EX1A 2PUBA 1HLDA 1KKDA 1IOZA 1YR1A 1H2NA 1R3JC 3EHBB 1XL0A 3EYWA 2QSUA 1S6YA 3CNNA 1BHBA 2AW9A 2CLKB 3AX6A 5AVYA 4UTVA 4HN4B 2W2MA 3H6HA 2IOFA 4U8HA 5BNIA 4O4IB 1DAGA 4Q18A 1MCZA 3HCDA 4IDGA 5JJBA 1IFXA 1X1QA 1B8UA 5CGQB 4KACA 1Y9ZA 1DJNA 3OLQA 5A5VA 4OXXA 3IA2A 2X6AA 4MQMA 4GM1A 2OPHA 1KYQA 2V65A 3BAFA 3NGLA 5F4ZA 2D2EA 4W5OA 2A0FA 2C4NA 1OFVA 4DJDC 1O9HA 4GPTA 3C6BA 1OH5A 4EGFA 5DYTA 5H6RA 2HPVA 3IOEA 1ZJ4A 1P77A 4M37A 5IHPA 4EYQA 2AH5A 3D6VA 2X1HA 3TH5A 2X14A 4MWOA 2CJXA 1YJBA 2YR0A 4MYUA 2ZSBA 3C3EA 4PZCA 4CDRA 4UEKA 2MINB 4F4IA 5HIAA 2ID8A 3ACBA 3MN1A 4FLUA 2WUEA 3K7EA 2DKOA 4L5IA 3EC7A 4W5QA 1GNTA 4BGVA 4NSNA 4LZLA 5IYZB 1OLUB 3E7FA 2ZR9A 4Q4HB 4BATA 3UT6A 4HWOA 4H3SA 4WKPA 3NDBB 1Z0FA 2P22C 4AWXA 4D8WA 1Z83A 1QM5A 4ZQEA 5DYYA 1AA9A 1NMUB 4PRYA 2QKYA 4GM0A 4IMPA 1Q21A 1EFVA 4BE4A 1E61A 3HYCA 2WJAA 1K3UB 4YCBA 1XQXA 4BE9A 3T0IA 3H9QA 4LBWA 4PR0A 1XQ6A 1EDOA 1WF3A 1X38A 1F3LA 3G71F 1JU3A 3HYTA 2M6YA 3IPAA 3K0HA 2PT9A 2F43G 2QD4A 4QT0A 1V1RB 4FM9A 4MMZB 4NU8X 4IWXA 1BL8A 3HHPA 4P3KA 3NTXA 3VDRA 3FWKA 1H2WA 3ZBQA 3FLMA 4MB2A 4K05A 1YHYA 3F2IA 3IHWA 3IOBA 3MWYW 3SFTA 3UXHA 3JWIA 1CEXA 2GXSA 2QRKA 3RPEA 3F98A 2R6GA 4US0R 4YAWA 2B1JA 3FCYA 1ZL0A 4JI0B 3CH4B 4DUZB 1YIJF 1BMDA 2R6AA 4D02A 1T5EA 5EO3A 3AONB 1F9AA 4AZ0B 1W19A 3K96A 2GN4A 1N2JA 3IEQA 3DGFC 3VR6D 2YFQA 4HQLA 2FFAA 2JJ1D 3LQFA 4LNUB 4OBEA 2QLJA 1ICIA 3I7TA 3GJ7A 4AQYB 2HYIC 5KNCD 1IZ0A 2DPLA 3H1EA 2FPPA 2O8EB 5TC4A 1O95C 1LI4A 2PS3A 5JECA 4ZI7B 2AEFA 3L8EA 2GAOA 2VK4A 1GCUA 2FUEA 4BT3A 3SJ7A 2IHTA 1NTKH 4LDRA 5K3BA 5KSZA 4UM9B 4IY1A 4IDOA 2GPJA 2IYEA 3HDQA 4EBBA 5CH3A 3DZIA 3KAPA 2OSVA 3WKBA 3D3WA 3G9TA 1F17A 5HUHA 2WR8A 3MW8A 4QYSA 4DCNA 2A3NA 2LBTA 5CTJA 3ZU4A 1JHPA 4CF5A 1CZRA 4MWTA 3GPDG 4UBLA 4O1MA 2W22A 3ADPA 4AN0A 3E1GA 3TLYA 1KDTA 2G06A 2A9PA 1YBFA 4LWPA 1AKQA 3GZNA 3SYOA 3RANA 5B58C 4LDNA 1MZPA