4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
2BTOA 3HKBA 5LP6B 3JAWB 3RYCA 5JH7B 4EI9A 4IHJA 4U3JA 3R4VA 1Z5WA 4DRXB 3HKCB 2VXYA 4KWEA 4X20B 4EB6B 5MN6A 2Q1XA 1RQ2A 1TUBB 3RB8A 3JAKA 3JALB 4O2AB 3UT5A 2RHJA 3RYIA 4HNAA 4HNAB 1SA0A 4O4IB 5C8YA 3CB2A 3JARB 1W581 4U39A 4B46A 2R6R1 1FFXB 4TV9B 1W5BA 5LA6A 4WBNA 5JVDA 3VOBA 3HKDB 5LOVB 1RQ7A 5KX5A 1TVKA 4FFBA 5EZYA 4F6RA 1W5FA 3HKBB 3RYCB 5IYZA 1FSZA 5CA1A 5EIBD 4O4JA 4IHJB 4U3JB 1OFUA 2XKBA 4I4TB 4I4TA 5FNVA 5J2UA 5LYJA 5LYJB 1W5AA 3V3TA 5MN5A 4X1YA 4ZHQA 3M8KA 3JAKB 3N2KA 3VOAA 3UT5B 4ZOLA 3WGJA 4X1IA 5CA0A 2RHHA 3WGKA 3RYIB 1SA0B 5C8YB 4X1KB 3JASA 4X1KA 1W59A 4TUYA 4TUYB 3RYHA 3JATA 4I55A 4I55B 4IIJA 5MN4A 5KMGA 4YJ2B 4YJ2A 1RLUA 5ITZA 4ZI7A 5LA6B 5JVDB 4WBNB 4ZI7B 3WGNA 1JFFA 2RHLA 5KX5B 4I50A 3RYFA 1TVKB 4FFBB 3RYFB 4B45A 4O4LA 5EZYB 4F6RB 5JCOC 3WGMA 4EI8A 5IYZB 5CA1B 4O4JB 5JQGA 2BTQA 5FNVB 2XKAA 5J2UB 5J2TB 5J2TA 3E22A 5BMVB 5BMVA 3VO8A 5EYPA 2VAWA 4O4HA 5GONB 4X1YB 5GONA 5LP6C 4ZHQB 4LNUA 4E6EA 2RHOA 3VPAA 5JCOA 3N2KB 1W5EA 4ZOLB 4X1IB 5CA0B 2VAMA 3HKEA 3HKEB 3N2GA 4TV8A 3JASB 3WGLA 4O2BA 3RYHB 4EI7A 3JATB 4IIJB 5LXTA 5KMGB 5LP6A 3JAWA 5ITZB 5JH7A 5IJ0B 5IJ0A 2R751 1JFFB 4DRXA 4I50B 3ZIDA 5IJ9A 5IJ9B 1Z5VA 3HKCA 4O4LB 4X20A 3VO9A 5JQGB 3ZBPA 4EB6A 2VAPA 4M8IA 2BTQB 4DXDA 1TUBA 2GVIA 4YJ3A 3JALA 3E22B 4O2AA 4YJ3B 5EIBC 3C8LA 5EYPB 4O4HB 4XCQA 4LNUB 4O4IA 5M7EA 3JARA 2Q1YA 3M89A 5CB4A 5CB4B 1FFXA 4TV9A 3N2GB 4TV8B 3ZBQA 3HKDA 5LOVA 4O2BB 5LXTB
chains in the Genus database with same CATH superfamily
3EPJA 1FP4A 2HQOA 2C42A 2CSXA 4CIVA 4G8BA 3ZU2A 2PGXA 2ID4A 3PUWA 3L43A 5JMWA 1YSCA 5HOEA 2PVCA 2BDUA 2C8JA 2JIZD 3VAAA 5L3RA 4WLUA 3IPRA 1RP3B 2VGMA 1Y3BE 1CVRA 5GAPK 3ROXA 4UTRA 1FB5A 2XMGA 5C5DA 2QF7A 4TXLA 4BVAA 2VHYA 3ADBA 4CQLA 1H4VB 4I55A 2BP7A 3FCYA 4A8TA 4Y3UA 5AKXA 1QZ3A 1LBIA 2EZUA 4L27A 5IC5A 3GRKA 1E1CB 2G6BA 3IVCA 3NC0C 2C9CA 1C0EA 1R6KA 3DYBA 3H99A 3PHBE 1ZLXA 3B5JA 3JWJA 5BVGA 1HFEL 5EWLB 4GOMD 1KIMA 3KRTA 3IIMA 4YUAA 4JFAA 4KQXA 3JQ7A 4LJ5A 4REOA 1PT8A 1M4UA 3L05A 4TTSA 2O2JA 3FNGA 3PGJA 1GPLA 4NC9A 5AOVA 3HZOA 2XWQA 4YXFA 2QJRA 3GEGA 1DFGA 3ULKA 5DYNA 1T9GS 3A6ZA 3A11A 3QX8A 3HVHA 4ZQHA 1L5HB 1ILWA 1XD9A 3VNQA 5A71A 1C50A 1A3CA 2X4IA 4GPEA 2D74A 4LXQA 4Z53A 2CZWA 3E70C 1FP6A 5FUQA 3DS8A 4B5CA 2H06A 2LXNA 1K06A 3DVLA 1WXDA 3HI6A 4DOMA 1JA8A 4TS3A 2CJYA 5KKCA 1TJ4A 1O6GA 4KXQA 3GYBA 4NEHB 5MN4A 3R1IA 4CH5A 1YFZA 2WKPA 5TS3A 4BRWA 1L1EA 2ZTVA 1PYOA 4EY6A 2QTOA 3SR3A 5AH0A 1LBEA 5EJ2A 3ANYB 4W5RA 1JFSA 3EVTA 1YKFA 4ETNA 4EUEA 2V7QA 2ZIWB 2O0JA 4DV7B 1RPNA 1FDRA 4HVTA 2HUPA 3E0QA 2PANA 2DUNA 4IKEA 3RUEA 4PNHA 3AF2A 1OI3A 4DMRA 4P0TA 1QVAA 4QJIA 1QO7A 4EKDA 4ITUA 4K0RA 1EUDB 4JLDA 2B2NA 3GFPA 3TVTA 1EZJA 1UINA 1K34A 3QHPA 4KXRA 1B8OA 3C0KA 4FFBA 5KHOC 2AN3A 3ANLA 1CJBA 1PS8A 4R2XA 5HP8A 1N6OA 3AOGA 1Y3CE 4RW0A 3NHUA 2ZYWX 3QPVA 3SPJA 2HT6A 4XYBA 1L6IA 1JD1A 5FRDA 3ZE0B 4Z4QA 1Z4MA 3OU7A 2OHVA 3PWSA 2V9CA 1JEEA 2AJCA 2F00A 2J46A 3SPIA 4P3XA 3R4CA 4GGPA 3IOMA 3OTWA 3MAQA 3CRW1 2XQKA 3FAVB 1CUUA 2CZGA 4OHFA 5K5EA 4BVJA 1TW3A 3EXEA 2J0UB 3OIGA 2AW3A 2LCAA 5EIXA 2N04A 1OROA 1DT3A 3SYRA 1R8SA 1ZR2A 1G20E 3LFUA 4BVHA 1XQXA 5AW3A 3DJYA 3GJ5A 4FFPA 4I55F 4QE7A 1LK0A 3H9QA 2E7ZA 4JBXA 5ITSA 1TYEB 4KLCA 1MEEA 3OZIA 2VZ8A 4CODB 1W5AA 3OIYA 3O9MA 3MCAA 5JY6A 3LGAA 3O91A 2V4ZA 3IC7A 1E0JA 4ZVPA 121PA 3PWTA 3IC5A 3WLOA 4IJ5A 4UMVA 4RENA 3NMUC 5KVSA 4JSRA 3OZCA 3CR3C 3U44B 4BVQA 3UXEA 5H9CA 3PQ8A 5HRAA 1CJKC 3C9TA 1US8B 3RV3A 3ZHUA 1UJWB 2PKEA 5ALJA 1B8PA 1LC0A 4N3AA 1VPEA 4ZQEA 3O8QB 3FTDA 1L5MA 3OQVA 4AN0A 3IAUA 2BTOA 4YQYA 3IKMB 3C45A 3H5IA 1K3UB 3QITA 4AZ3B 4X62O 1EG7A 2CB0A 3G2NA 2RK4A 4CLRA 1KZYC 4FE4A 1TT5A 3MZ0A 4OHKA 3PYMA 2NIPA 4K3AA 4BEWA 4BLOA 2GYUA 2XDWA 1YDHA 3VTAA 1ORVA 3U3RA 1BRMA 2DTXA 3B2EE 2BISA 2YIJA 2FN4A 4MIYA 2YV5A 2DQKA 3ROMA 4DLTA 3LO8A 5EB1B 4XD2A 1ORIA 4CM1A 3W5SA 1N3IA 4B7AA 3LPAA 1DCTA 3ESAA 2Y1FA 4WXMA 2QQFA 2BR3A 2BLNA 3OQOA 4Q4DA 3DUWA 4RF2A 1XYGA 1OJHA 5FIUA 1R6TA 3AF5A 3ZHQA 2RI1A 3D7LA 4IV0A 2NO1A 2GCOA 1ISMA 5HF9A 3PR1A 1BJTA 1I7FA 3KU1A 5DKFA 5A2QM 3M82A 3ANSA 1ODSA 3D8SA 5DTQA 2GKOA 4HS4A 4C6RA 2IAFA 4YREA 1AC5A 4XYMA 3GB9A 3E3NA 3JR3A 1XN1A 1AMUA 2R8PA 4IINA 3GELA 4GRIA 2ZI5A 3N0VA 2YEVB 2FSUA 4AKTA 3CD6F 2EQAA 4A27A 4YB8A 1NI8A 4EEKA 4PA9A 1S76D 4S1TA 4YACA 1ZH8A 2A0UA 2C2ZA 2X8JA 1TEHA 2C4WA 2AWNA 3PKZA 2VEOA 4EGAA 2O7NA 2CXRA 2VSNA 1D4FA 3UB4A 2F62A 3T3MB 3RSGA 4UZSA 3UUWA 2GXAA 2WT4A 3EGOA 3AM4A 4C4AA 4B62A 5ARDA 1XVLA 1VIYA 3JAMN 4NL4H 4EUHA 1H0KA 1SQSA 1NNSA 1QRAA 1RJFA 4G2NA 1H0SA 2QR5A 5ALMA 1LFDB 2CLHB 2NUBA 4BVBA 1H66A 2ZEJA 4D5EA 2W4QA 3O83A 3QFSA 2BZSA 2YN4A 3HKCB 2LWIA 1IUPA 4NXMB 1O58A 2G76A 4ZZ2A 1O94D 5BWLA 1WP9A 4R7ZA 1PQWA 1DFIA 3OT4A 1OHHD 1SM4A 3BJEA 3H8WA 3EZ2A 5EP1A 5JTTA 2HRBA 4RZUA 2P9EA 1A9SA 2C4VA 1PJLA 4G27B 2OGSA 4WW0A 2EBUA 1D6JA 2ITCC 2YUIA 1QIMA 2O2CA 3L6BA 3UKDA 3VISA 1MAHA 4UVIA 1L7NA 2PA3A 1M0WA 2W0FC 3A4IA 3CPSA 1PN3A 1G7CA 2I4OA 1Z5GA 3GVXA 9ATCA 2Y05A 3S68A 2XTJA 2V7WA 4E51A 3TUJC 2WUGA 5IJ0A 2ZBUA 4I50B 3BILA 5BUSA 4H3SA 3PXXA 5KUKA 2H52A 4RD4A 2AJ8A 3C1TA 1VL5A 2OQIA 4CMBA 1DINA 4XQEA 1R3IC 2ZRJA 1ZGCA 2BEJA 1X7GA 4N4AA 5LM3A 1THMA 2ZYDA 4ZQFA 2F3QA 3UG7A 4G4WA 4E4YA 2IY9A 5IANA 1SXJD 3PVSA 2Y99A 4I4NA 3HA2A 1H1LA 4KV9A 1ZW1A 4QOSA 2VYCA 2WQ7A 4OHWA 2P5OA 1WB6A 5EKTA 4IJ6A 1UPUA 3CGWA 2IS2A 1TQ8A 1V8BA 3DBLA 2K7FA 3S29A 3AU9A 4RQUA 4FJ0A 4DBVO 3NPAA 4LHXA 2ZZKA 1ZD9A 3DHEA 4OH7A 1ZVKA 4IZHA 4OG2A 1K9MW 1T3ZA 2JCGA 4BVTA 4C8GA 1NBWB 1HURA 1AUQA 1SBTA 3L7JA 3VSEA 1QPZA 4P3NA 4ZCSA 2DF8A 5H0IA 1Q82W 2X7JA 1A7UA 1E1RG 3K15A 4CM4B 4CDNA 4YJ3B 4QT4A 1U2GA 1FDWA 3VDNB 3ABQB 1Y67A 2QSAA 2WA1A 3ZW7A 4R7TA 3DWGA 5B3SB 5ARBA 3BWDD 3C3YA 5E6SB 3KQUA 1EHIA 2Q41A 1U98A 4PHCA 4GNRA 3TECE 4UHHA 5IWAB 3L1KA 3CB4A 4LPKA 3MD0A 2CHEA 3SAJA 1SCNE 4F4FA 3NNDA 1OXSC 1IBMB 3D6MA 2EZPA 4JYMA 3IJEB 1AB3A 2CVPA 1GTSA 1IY9A 2XZTA 4MDHA 1P7GA 5DCLA 4BFUA 2V4UA 1TYZA 4JP8A 1SVNA 2IH3C 2D59A 2WM9B 3CCQF 4D7TA 3DTYA 1Q0UA 1EA7A 5KREA 4NMMA 3MAJA 4OXSA 2A0YA 3HDHA 2VYVD 5AW9A 4LF5B 4QXAA 3U7JA 1Y7HA 3QXHA 3DXRB 1KSHA 3NM6B 1NVVQ 2X5XA 4YCCA 2W2KB 5BSFA 5JARA 2GPWA 4K6FA 3W7SA 3CH7A 1C41A 2I62A 2IUYA 2D2VA 4Q05A 1GZVA 4LQCA 3RF6A 4ENSA 2QDXA 3SI7A 5CVTA 1R64A 3CLKA 4RACA 2I7VA 3HHEA 3KQKA 1IATA 3KQVA 4UDXX 4GLXA 3Q9SA 2JATA 3OOJA 5ANRB 1RFYA 5D5HA 3IE0A 3VPFA 2RJOA 4D4MA 2ZYUX 1IBLB 1K3TA 3MWLA 4KMRA 2NYRA 5AICA 1G5FA 2LFSA 2OHWA 4YGYA 1OU4A 4XWYA 3FBGA 1MG5A 3HCAA 3W9UA 5ADWA 3CCBA 4UTXA 3JZAA 2H0AA 4WDQA 2IHUA 3D7KA 2QTMA 3THYB 5LHHA 3STHA 1PQUA 3TRHA 2V9ZA 4BO8A 4ZVOA 3S6JA 2WABA 1HE3A 2X76A 1NI4B 4IDOA 3NHZA 5K6AC 2QN2A 2PT7A 1H5NA 4LVNA 3O7WA 1R0SA 2EFGA 4NBVA 3PENA 2RJZA 1ZNQO 3L8ZA 2XNHA 4A5SA 2GZ3A 4P5DA 5ICMA 5TMEA 3MERA 2NSYA 1P7ZA 1SOWA 1GT91 4J4TA 1WNTA 2BUBA 4EEQA 1KZ6A 1KMCA 4O4IA 3OFKA 1SCUB 2FX5A 2G0TA 1R9NA 5BSTA 4XLTA 3GRAA 1JLLB 4Q4LA 3RPEA 3HO6A 5KVCA 1UMCA 1GX1A 2AE2A 2E5LO 1GCIA 4A36A 3PNPA 4X8OA 2NADA 3V33A 3SDSA 1KZ1A 1Z39A 2XCSB 2C4KA 3WWDA 1EM6A 3E5RA 3E48A 4H1TA 2W43A 1ZEJA 2X1VA 2PD6A 2UYOA 1R5BA 4Q6GA 5LA6B 4L6AA 4ZCMA 4FDTA 1SH7A 3MJ4A 2ZROA 2VZLA 3FX2A 3SPCA 4YCDA 2HYIC 1XL4A 4EKYA 2QE7G 1U0RA 3GUCA 2OGTA 2XXBA 4NCJA 3DDWA 1XEXA 1PTKA 4X3OA 5FOUA 1C30B 1ZJYA 2DPLA 2JI9A 4HPWA 1VC2A 3RUDA 4O4LB 4RNCA 3A06A 1E32A 2E49A 4OQNA 2VJQA 2I9PA 4HF7A 3IPCA 1XL0A 1FU4A 2Y27A 1KO1A 3JQEA 5JH7B 2G17A 4BFVA 3M84A 4DUZB 4F7DA 5HTOA 2GBOA 4JJ6A 5AKEA 2GXSA 5KBYA 4MGIR 3ZWOA 1WIWA 1WDKA 3NVMB 4ZA2A 1A9XB 1GCGA 4NICA 5AHWA 3O6VA 2PXHA 4WK0B 3F3SA 3F7YC 4A73A 4YK7A 2ZE8A 3FJYA 3MW8A 2WMYA 2DFTA 2J9XB 1J9GA 2X0FA 3C3MA 4I9GA 4LRUA 3V48A 4U6QA 4QJFB 2VHEA 1HNXO 3SSMA 3NOOA 1GGNA 3ZCTA 1M66A 5CCEA 3REQB 3GH3A 5KA6A 1QF9A 2ESRA 4HFJA 3WWYA 3QG5A 1TCBA 1QYIA 2PYDA 1W49A 2BBWA 1E64A 3EISA 2XUHA 3KP1A 1DAHA 1G4AE 2GEVA 4P2GA 1ROPA 4V2IA 4MV9A 1Z07A 2KBEA 4PZCA 1FE8A 4C0HA 2GZMA 1C3VA 2VSQA 3QNMA 4HQKA 1S1CA 1Y9DA 2O0HA 4EGJA 2WYOA 1IZ3A 1P4GA 4U9IS 2C84A 4A6XA 2VWHA 3CMEF 2P2ZA 5CFRA 5C8YA 2C2BA 2Q7XA 1NQUA 3D0KA 2IQQA 3VDXA 2VIIA 5JJLA 2C2KA 2GEDA 1GUBA 2HA2A 2JAWA 1MD9A 5JRDS 2OCDA 3IAM6 4MEJA 4YIHA 4BQOA 2QR3A 2UYNA 3LC2O 5IDWA 5E95A 1YC5A 3K0AA 2AHOA 4RHXA 5KX5B 3U4GA 2JHGA 4O4IF 5K4GA 2QVCA 4MSWC 1YZQA 2MINA 4Z7JA 1P8JA 4MWEA 3BFPA 4CKCA 3T52A 3RT7A 5ITWA 3L6UA 3KR2A 4JVLA 3FYHA 4E4TA 4AXXA 3C8LA 3Q7EA 2WVAA 3KCNA 1FLDA 5GM2A 2AFVA 4TT3A 2IC5A 4Y18A 2D3OW 1MMFB 2EIXA 1QS0A 4QTZA 2A7XA 2MMCA 5HXAA 4MV3A 4DR1B 1Z4LA 2J09A 4F12A 2DTEA 3UM9A 2B9ZA 1VGQA 4EA8A 2EJUA 4LTDA 2G1AA 4Y2UA 2FUG6 2D5IA 3PEVA 3CJRA 3HL0A 5SYNA 3P27A 1VBKA 3UV6A 4WFGA 1A9OA 3HKBB 3QEMA 3PFFA 4DIBA 3WDKA 3TLMA 1XD2A 4HAVA 2R8OA 3HP4A 1R5OA 4R0VA 3U1TA 1J7KA 1KXZA 2NN3C 3GLIA 1ZN2A 3TJRA 5I7EA 4MQEB 3WGNA 4ZI7A 4BP1A 3A26A 3CN7A 5CN0A 2ZWAA 5EE0A 5JO0A 3TW0A 3AC0A 4WVFA 4IMPA 2QRLA 1YMUA 5DN6G 3T34A 1DKNA 1FIUA 5LP6A 2IWRA 1GAWA 4PAMA 1E6LA 1Q3HA 1FP2A 4AN1A 2AFHA 4EMTA 4FYWA 3TZEA 2WSYB 5AO9A 2JGLA 2C3MA 1QH8B 4DS3A 3OURA 4EY8A 1KYZA 1JR9A 3NIDB 5B3LA 3ZU3A 4FN4A 3T7RA 2V3CC 1RYYA 2EX4A 4NCXA 4HNAA 2R5NA 3E82A 4ZEMA 1ZVQA 1RCFA 4B7EA 4LOKA 5LNK6 2PKQO 1T25A 3D7MA 4Q3CA 5GQSA 3OIDA 2B92A 2W98A 2X6CA 4HZUA 3RREA 3M70A 1RAEA 4F2DA 4LYFA 1ML3A 2VRBA 1L8LA 3GH1A 1S3GA 1WCXA 1H5UA 3CXHF 2FPPB 2Q5IA 5BRAA 4A1OA 1ZX1A 1B76A 2XXAB 3E22A 1L7VC 1DK1A 3OX4A 5C1DA 3MOIA 3S1AB 2YXYA 4QGAA 1G7TA 5IARA 4JGBA 5FH9A 5IY5B 4AF8A 3Q8WA 4MIKA 4JGIA 5BSWA 3AESB 3ABUA 5C8YF 1K8RA 1EVZA 3M1LA 3WFVA 1JNYA 1JX6A 4DPMA 3HCEA 3G0BA 4AUEA 3LCUA 2CAZC 4FFMA 4WOCA 4Y6PA 1WQ4A 3DFUA 4JLVA 1NXWA 1ELOA 5F7XA 2IXEA 3BAAA 1VMGA 1QM5A 1D2CA 3AR4A 2FSVC 3CW2A 3FZYA 4IOKA 3CC2V 1DL5A 2WJAA 1FYVA 2ISCA 3JSXA 3K2QA 1JCHA 5KYYB 1Z5ZA 1UK6A 1Q0HA 3OQIA 5FOSA 2NNWB 3NDPA 3OCWA 3QTCA 1JDZA 1X39A 2QAGA 3HP7A 2O06A 1H65A 4JR2A 1K4KA 3RS8A 1EWQA 1L5GB 4GKKO 2V0CA 3OGCC 4K1XA 1B2LA 1TA4A 2E6UX 1TUGA 2G38A 3CH4B 3RYTC 3E58A 5BQ3A 1TZMA 4XIFA 4J03A 4PN3A 4HCJA 5JIBA 3IBFA 2H5EA 1KMNA 2QD5A 4RZXA 4DT1B 5M29A 3VV2A 1NNLA 2FX2A 2OM2A 4CEJB 1DQYA 3RRNA 2AIZP 3LX6A 3CCLF 1T1EA 3HBMA 4ZI7F 2JBWA 2BFPA 3SHTA 1UBOS 5IAJA 4IEIA 1CUYA 5K3BA 3WX0A 5I7RA 1L4NA 5J47A 1GNVA 1G42A 3UG6A 5JJBA 5E7QA 4B3GA 5LP6F 5ALNA 4I1SA 1R0XA 3N5KA 4KODA 5IT5A 4JY7A 4RETA 2IBZH 2UUOA 2K1SA 1YHZA 3W1EA 2OTJF 5DW3A 5KCMA 1EK2A 1JSLA 3K06A 1YJBA 3GUVA 2QD4A 4YMTA 4CKWA 1ZGGA 3VZCA 5LVAA 1PNVA 4CTJA 1U5CA 5AKYA 4AWXA 4G4SP 2IEBA 5DYGA 1XDSA 3FYDA 2RHDA 2HF8A 3Q1KA 2AW9A 1J8VA 4KAAA 4BIMA 2PMFA 1JDNA 3O1HB 2F90A 2R3SA 4PLVA 4N7BA 1ZK1A 4M3NA 3FI0A 1GADO 4YAUA 1WP7A 4CMCA 1E3MA 1UOQA 3CLHA 1FFXB 2ZCJA 4KXLA 4K9RA 1RACA 2PTMA 1G8JA 2RC5A 3NBQA 4UEOA 1JAXA 2IBMA 3ZV4A 3MJSA 3R0PA 2HB6A 2R9IA 3LH5A 2N1MA 4MQ6A 1KPHA 1JJIA 2A0XA 3GOHA 3CIOA 3FBAA 1GKFA 4K9PA 3PIIA 3QU7A 4KBFA 3KDPA 3SC4A 1YI2F 1VJ5A 4YUZA 1I32A 4UV9A 4QVIA 1T2EA 2IWHA 4V02A 3RF7A 2ZSJA 2P1DA 1KH3A 5AJYA 2V03A 3F47A 2GYWA 2D00A 5LXTA 2Y9MB 4FXOA 5I7SA 3QYAA 4TWJA 4UHEA 1ID8A 1T2UA 1WCIA 4HDNA 3ASOB 5KTYA 3HR7A 2VPYA 4AW9A 1JXQA 4W9RA 4A2QA 5BSKA 4LHSA 1BQ4A 2ZJFA 1NKDA 1KP3A 4EHFA 2WT8A 5A4DA 3PLAE 4QFBA 2GARA 2DEUA 3GGPA 5FWYA 3EVBA 4QIWF 3E9RA 1JTFA 5C1PA 4QRHA 3EEBA 4H17A 1R0RE 3NASA 2OIEA 1NR5A 4R1QA 5FPOA 2CHSA 1F5NA 4F71A 3SFVA 1R27A 3AQ4A 3JR7A 1AP5A 4HBNA 1MDFA 4ZXPA 3TLCA 2V7TA 4RL4A 2B4AA 2ZUSA 2FUCA 5ALUA 1Q77A 1E60A 1OSNA 3MA0A 2I34A 4NV0A 2Q5JA 2GN4A 4PZLA 3NC4A 2Q5CA 3AERB 5I9MA 1TM2A 3FZEA 4IIYA 2MSEB 3H05A 4R8KA 4EHIA 1HDRA 2WWHA 3FVRA 1BD4A 1LZLA 4PNPA 3MLBA 2PZMA 5K6AA 5L7WA 1Q92A 1LFAA 3GEEA 4KWIA 3ML0A 3T4XA 1QC5A 5BN4B 3RSCA 1PKXA 3OJEA 5I4BA 2J7PD 4U39A 2WF6A 4IH1A 4FBMA 4Y7CA 3D6NB 4WADA 1PR0A 2SNIE 3FNEA 4PPGA 5C1BA 5HDQA 3WJRA 5ILGA 4D26A 3SNKA 5C46F 2IF0A 2VEDA 1DIBA 2DG2A 4DWVA 1GAXA 2DERA 4UQLA 3QEBZ 4IOJA 1W41A 2JVJA 2NYUA 4IIVA 4HUJA 4MQFA 4LYAA 3EGEA 3T1HO 1LSSA 1K5SA 2QI9C 2ACKA 3AB7A 4ZT2A 2QX6A 2HPVA 1ZWZA 1I5EA 5C81A 2QM3A 5DCWA 4U5XA 5FAKA 3O31A 3NBFA 4TRJA 4ZCLA 3BERA 3M1IA 2O0LA 3LFTA 1JAHA 1W7AA 2IX9A 2Q0OC 1V4VA 1OCEA 3IH5A 2H18A 3TDKA 4B44A 3W6ZA 4LWPA 1PSWA 2ZYHA 3RYIA 2LO1A 4RA9A 2R6R1 1CY1A 4NAUA 4BZWA 1FSZA 1IH8A 3T2MA 1YQXA 3BCHA 3PHGA 4NFLA 2QMHA 1T6NA 4UPDA 5HIKA 5LXTF 1XZAA 3S2EA 5LQCA 1HNZB 2DY1A 1OILA 5AXAA 2BKXA 4HFMA 1M7BA 4R2KA 3U4HA 3VR6H 1RP1A 3QJ5A 5C8ZA 1YBFA 3EZ6A 4F4UA 2A7QA 2WDPA 1U8EA 4QATA 1UPFA 4F8JA 5KMGB 2RHWA 1V7PC 2F4VO 5JJCA 2XMCA 1G19A 1H2XA 1O94A 2NAFA 1VLHA 2GCEA 1U5BB 3A4YA 4F60A 2FPKA 1CIJA 5AVSA 2HK8A 5HY2A 3L7YA 3RVPA 1N9ZA 3CC7V 1N5LA 1R6NA 1XREA 1ZOSA 5EMNA 3CCMF 3TEJA 4JB0A 3UPTA 2C78A 1Q2XA 1XL1A 1J5EB 3ZMUA 3L04A 2CTPA 1R4NA 5K0GA 5FOXA 1VQKV 2ZT8A 2CMHA 3K96A 1SERA 3FR7A 4QDUA 4ESEA 1CULC 1KECA 4ZREA 4B17A 1XMQB 2FMUA 3KKLA 1FYWA 1L1QA 3RIMA 4PRYA 5M2QA 1NAHA 4O4HA 2PDAA 1KNJA 4Q6BA 4LSZA 2TMDA 1JFTA 1OU0A 2X42A 4JLOA 3HHPA 3JAMA 4YYZA 1YB4A 4ZO9A 2E18A 2P4SA 5EQDA 1CUHA 1F0YA 4MTGA 5I47A 2VK8A 2HFEC 1PZEA 5ES3A 3AFNA 4FLWA 2C8LA 1UZUA 1X42A 2OV8A 3PRKE 1P9WA 1V1RA 3L7NA 3ZS8A 4J8PA 3BPSA 5K8IA 1M93A 2P79A 5L8VA 1NV9A 1CRLA 4CM9D 2FKNA 1KYVA 3GARA 3EVCA 1PL0A 3BA8A 1X80B 4AAYA 4MJLA 3I28A 3EFHA 2B5WA 3VPXA 4X3MA 4N76A 4J7XA 5FTMA 4GM1A 1FYDA 3ZDBA 3K0EA 2C3UA 1KEKA 1NUPA 3BFRA 4ARVA 5C1OA 5L4LA 3OKFA 4KFSA 3HY4A 1SU7A 5J23A 1TMGE 2WV9A 4ZZ0A 2KWIA 3TX6A 2HEGA 2P6PA 5EXPA 3WIBA 3DL4A 4DIDA 3QPAA 3M81A 4G36A 4D0RA 4NBRA 3B3AA 2OGUA 3ILSA 3FLEA 4DXHA 1XCMA 3KUCA 4ZKEA 3U3DA 2RIRA 4ABYA 2I8LA 4Y1GA 1A5AB 3HN7A 4J1SA 1MB0A 3TSOA 3L8FA 2D5LA 4NPHA 2VYVA 1NH2D 3FETA 4Q4JA 2XMPA 4H1WA 2FW9A 4K40A 2IUTA 2B36A 3C14C 2YFYA 3U48A 2HWKA 1JWBB 3VOAA 4M0MA 4RQAA 2GM5A 3GWZA 4Q82A 2F55A 1NBMG 1QGAA 2VQEB 4KUMA 3B13B 2OZPA 3UIEA 2I6RA 1YB1A 1DWOA 5DM70 3HFGA 5I45A 1ZAUA 4UUBA 1EQ2A 3AG4B 5HBRA 1O95A 3K8ZA 5IZCC 3E5NA 3H3JA 1KGSA 1XO1A 3IKJA 4EF4A 1NZJA 3NOXA 1ORHA 4F38A 4HEJA 3DCNA 4QM6A 2QG9A 4KWHA 3QYJA 1XRPA 1DRUA 3UA3A 1N8RH 4M0FA 4INOA 1MB2A 3C7DB 1H7MA 2Q5ZA 2XUZA 1Q7YH 3BHPA 3SFTA 3LBFA 2X14A 3ONFA 5CDFE 1QVWA 3WL5A 2C7OA 2JNWA 4TVKA 2ECFA 1BEEA 1AIPA 1HDYA 2AT1A 3WLIA 2W2LA 3OHMA 4Q66C 5FTKA 3K9NA 4DREA 2R1VB 4YFYA 4BMXA 1Z8HA 3OEWA 1NC3A 3W2EA 2YHIA 1YONA 4O4HF 1HKUA 3CRMA 5C53B 2I4NA 4Y2HA 3AHIA 2GDSA 2CMKA 4S04A 3SBXA 4DUYB 4DSUA 4XWAA 1PWXA 1SZCA 2X23A 3FB1A 1KDRA 1JFFA 3DT9A 4C4RA 4WY8A 2FSVA 3NV9A 4PZUA 2QMQA 3BB4A 5CJ2A 4I6EA 4G8DA 1H0RA 3QELA 5KNLA 1HETA 3BWYA 2AZ2A 4XRGA 1YTUA 2XMBA 4EGFA 5E4JA 3UMRA 4L8JA 3ZQUA 2IG8A 2NSLA 3EBLA 1KC8H 1UIRA 5DNCA 1ZK0A 2XAHA 4DYLA 4NEQA 3W9YA 5A4AA 2D1QA 1DAFA 1QZZA 1A95A 1V16A 4N12A 1F8YA 4FTWA 4ZV4A 4RGVA 2ZOVA 4CFYA 4WFHA 1E9VA 5CTAA 1KJJA 3H11B 1Z3CA 3A58B 4YV7A 1W94A 4MVJG 2OO5C 2B4QA 1WAMA 3TNLA 5IJXA 4QGPA 3H1BA 1WBJB 3JQGB 3K30A 3AP3A 5JMOA 1GTOA 2XZPA 1B0PA 4I3FA 3OLYA 4L9AA 2XAFA 4DV5O 4XX0B 1JHOA 3EXHA 2JBAA 9GPBA 3GY0A 3WLHA 2HADA 3FI9A 3S2UA 3X2FA 1DAOA 2QS9A 4Q4HB 4P6VF 1K5GA 4GF5A 4RZ2A 1PV0A 3BVPA 1D1TA 3ONEA 4CT4B 2HDNB 3PJSK 3JQCA 3VU9B 3UOGA 4BJ3A 1T9AA 4PAGA 1XRGA 2EW2A 1A2OA 4BX3A 3PC7A 4MS3A 1ZMOA 3A70A 3AY3A 1VQLF 1Z6GA 1GQOA 1SXPA 3VKUA 1W57A 2FCAA 2XAAA 1WUJS 3IOBA 2FMHA 1L7EA 3KQYA 1IZ9A 4Z1OA 5B58T 4MV0A 3V7NA 4D44A 1P2SA 2HMSA 3SFZA 1N6IA 1GILA 2GDZA 1O6ZA 4PG6A 4B45A 1C8BA 4PZ9A 1Z2PX 2WWTA 3V9PA 3M6IA 5PNTA 1ZJ5A 2OZLB 1FZTA 4AWBA 1E7KA 4BUCA 1VQ5V 3B1ZA 4NPAA 2B8JA 3KAQA 2CZQA 3P7MA 4JEIA 3QEAZ 4WECA 2XRYA 3AZOA 2BFOA 2QK4A 1JL3A 5I48A 1N2CB 4JDUA 1I14A 5DM2A 3JVHA 1Z26A 2BE9A 4D56A 2BYTA 4QNNA 5TGDA 3E84A 4IT5A 2KW5A 2QGNA 3HEMA 5GP1A 1KOGA 1BQZA 1XAJA 4WKNA 5K8JB 3T6KA 5HZHA 2M6YA 1XKTA 2JEZA 3IT0A 3OIVA 4F2HA 5EP3A 1DWQA 4TUYA 4RFSA 3VC3A 5K45A 1EA5A 2FEMA 3NUQA 4XWOA 5EZYB 2HP8A 3G2QA 1DOZA 4KL1A 1F4VA 1PGPA 2REOA 1V47A 3VR4D 3U7HB 4BP8A 1S72F 1M10A 4GPIB 4MWBA 5FPPA 3OMXA 3I76A 3WGLA 2Z5LA 4WCFB 5EJ7A 4LKOA 3KR1A 2DBVO 1BDHA 5ER9A 1R73A 1F23A 3DMRA 3FA2A 3NU1A 1Z2CA 3DO6A 1TKRA 4DV1B 1HNXB 1K75A 5BOSA 2WR8A 4CGYA 3ADPA 3DEFA 4QASA 4A9AA 3DBVO 4C1NA 2G1UA 1E98A 4RD2A 3EMDA 1FUUA 4M1EA 3WLQA 1T3HA 3MT9A 2W70A 1YJ9F 4D1YA 3OU6A 4DIEA 3EFOA 3H5AA 2F59A 3V4LA 1XTBA 1QP7A 4ARUA 4OKIA 3DLIA 3ZZ0A 2Q2QA 3PBKA 1P1IA 1BOFA 5CBPA 3FMVA 1IV1A 2XWJI 2IW1A 4M0UA 3R9WA 1UJ2A 3IV6A 3WAGA 5K2MA 1H0HA 1DSSG 3I4CA 3OQNA 1LJ8A 1UT8A 3OZTA 2ZBPA 5JT1A 4P33A 3NALA 3ABSB 1E61A 1U0GA 5HMMA 2C2AA 2ZB4A 3CPJB 1JIJA 3DXXA 3J7AR 5EERA 4LF8O 1S5HC 2XWBF 1TZJA 3UKMA 5IEJA 4FWTA 4PRLA 5GJCA 3WBBA 2YJTD 4HVCA 5AVUA 2EKQA 1L4UA 4TKVB 3O74A 3IX7A 2JD2A 5CVJA 4UPEA 4K03A 1NV8A 4CR7A 3TQSA 1VF7A 2ZE6A 4FNGA 4PLPA 1GDDA 4JX9A 3W5IA 1CVIA 4OK6A 1F7YA 4WBNB 2CXSA 4ZJPA 1W8DA 1S1MA 5J2UB 2O5EA 4J2HA 1ECGA 2QKYA 3QOYA 1Q7CA 2RK6A 4JT2A 1YNOA 1OF1A 1P80A 1SVOA 3AK4A 3QFFA 3DTNA 4FP9A 1H3FA 4WWHA 4F46A 2YDEA 2MDTA 4BZPA 2WILA 1XEWX 4WXEA 1JHPA 1HBJA 3RGGA 3FFWA 1YR8A 2J3LA 1JOYA 5BWCA 4D3DA 4TUYF 5K8LA 3KJFA 3IKVA 3PFHA 4GLLA 1H2BA 3NYIA 4UD2A 1HE4A 4DV3O 3EZ9A 4GMFA 3K1AA 3N8HA 4B3DA 3M49A 1I9CA 3H1AA 3WADA 3UPDA 3KTDA 1ARZA 5AKIA 2YH2A 1YUMA 4Q7JB 2IE0A 4QGFA 3KT6A 3LYUA 2EIKC 3VTFA 5TEWA 1VQ4V 4D8XA 2EV9A 5CB0A 1PL7A 4CU5A 4ND6A 4R4JA 5ALSA 5JJ5A 3EVDA 2Q99A 3GZJA 5AK5A 3COPA 2WWVD 3CZ5A 1WF6A 5CTJA 4NPCA 5C8DA 1PL6A 3ZCCA 2Q5FA 3AR9A 2OCGA 3WWZA 4KGXA 5IW8A 2O6LA 3CZQA 3JWEA 4MYDA 3FJ1A 2JLRA 1HEIA 1WPBA 5IVHA 3VHXB 3RRXA 3CV3A 1NVFA 1SXQA 3AUJB 2Z9DA 3P30A 1X9HA 5FQOA 4TTVA 1GUAA 3R74A 3UN1A 3U7IA 1GFZA 1THTA 2VVTA 3RS0A 3GRPA 5GZ3A 4QEKA 1E3EA 3LHKA 2NMUA 2ZKOA 1VL1A 3V1NA 5BNZA 3R6LA 2W4IA 1N2GA 3L7IA 2OCCC 3OUTA 4FNMA 3DDSA 3L5OA 1KDPA 4OHPA 1OB5A 1PFUA 3MTAA 4QWWA 3NWOA 2HA0A 1DOHA 4EL0A 1VDMA 2CH7B 2R65A 3U37A 1FJ2A 2HF2A 3NIWA 1N4DA 3TQCA 3QXGA 4HS9A 3MEQA 4OQPA 4PPFA 4LH7A 3RYFA 2PFGA 4LKRA 4UNNA 5B30A 4PVCA 2R9VA 3VO8A 3ZLUA 4C9BA 1UXKA 4FN5A 1L4YA 5DZSA 2PSDA 2W71A 4Q19A 3TD6A 4C2AA 1HFJA 1MU0A 5CGQB 1RVDA 3QTYA 3IPAA 4HAOA 4D7SA 2EFHB 3RVNA 3H2SA 3UYLA 1IEVA 4E2FA 1QF6A 2FI1A 2OL4A 3AUXA 1RRMA 4HDRB 1GTG1 4NMLA 1CYEA 4E14A 4H60A 1UOEA 4GKKB 1FJXA 4DV4O 3I9V6 3QLVA 1KFBB 5BYJA 2V7QG 1TT7A 2FPOA 2YVKA 1FNDA 3U40A 1PZXA 4YRJA 3ZY6A 4LJRA 3N0XA 1QFSA 3I6ZA 3N2KA 4KN6A 2OZBA 1IAVA 4ENQA 3TKLA 3JCUZ 4RJJA 1L5QA 3VH4A 3CIFA 4RK7A 3RUCA 4CKBA 1DTEA 1MHPA 3H2IA 3D8NA 4K3VA 5AD1A 3MUOA 5BPFA 4DYVA 3TRKA 3R9XA 3H42B 3K9FC 2YNMC 1EDOA 1NVPD 3GO4A 2HAEA 2ZATA 4JDPA 4EWLA 5CPBA 1Q3EA 1WULS 3KD2A 4PM4A 2E4AA 3AGKA 1HMPA 2HO4A 3ON1A 1WNFA 4OJMX 3L79A 4M8IA 4UEQA 2HPHA 4DMUB 1ZVJA 2DUJA 1VYTA 3GVIA 2EDAA 3A2FA 4EF5A 3BZWA 2N74A 2DOSA 3JCMM 4MVJP 4B34A 3WIDA 3IEIA 1MAVA 4LOLA 1HGXA 3BWVA 5CNIA 3BH6A 1GXSB 4Z3KA 2OBMA 1KQPA 4OH1A 1GFWA 1VQMF 1Y9AA 3EMBA 4NKGB 4UVBA 5TDHA 4WOKA 1Z45A 2VF5X 2WZDA 4B46A 2OMEA 4KI0A 3QYFA 4ND3A 5FTNA 2Z6QA 4MVUA 2MSWA 2F1KA 5BQOA 1VSVA 4AZVA 3SQXA 3A27A 3OCVA 4R8RA 1JIXA 3SSAA 2C5EA 4IDGA 2RB4A 1UP4A 1IUOA 4BNXA 5KNDH 4LF4O 1VQ6F 1T4CA 2VNSA 3OY7A 1CERA 3W78A 2NZ8A 1G3QA 5JNSA 1YS7A 4X6XA 5BSUA 4JOBA 5KNBD 1WW2A 4LC1A 5TSDA 4EJSB 4D8YA 2KJQA 4UNRA 4UNSA 1LR1A 3Q7TA 1PFKA 1KY4A 2HDOA 4WKOA 3DNPA 2J7PA 4JA0A 3KOYA 2BDTA 3E7XA 2W7TA 4AG6A 3H5TA 4C30A 4ZDJA 3NBYC 4HAWA 5AKJA 1IEXA 1EX9A 4HYEA 4OEHA 5B3KA 1DLBA 2JAQA 4CLHA 2QZPA 2XVAA 2NGRA 1EWTA 3V7QA 3DH0A 4ZQBA 2Y0EA 1MA0A 2UVPB 3WP1B 1RRGA 2VPXA 3KSUA 3P0HA 2PRZA 4BO2A 4KSCA 3SYOA 1TE2A 5CM2Z 3ZU5A 4AO8A 4R01A 3PDJA 1P19A 4JI2O 4DJAA 2FWJA 5JJKA 3DR3A 3BMQA 1G1MA 2IIPA 3L2OB 2BHTA 2HRZA 1F6BA 2BC9A 1P9NA 2H3EA 1S0VA 2Q8VA 4M89A 1JKIA 1XDUA 1CUEA 3TIGA 1E7SA 4CCYA 3LXRA 3OIFA 1T6ZA 1CHDA 3GRVA 1AXGA 2DYYA 4C6HA 1XILA 3M6UA 2P9QA 1NR7A 1ZM7A 2PRJA 3RADC 2IP4A 1R0CA 2PVSA 3LCVB 1PIWA 1NPDA 4NBNA 1ZUIA 2ZK7A 1L5FA 1Q16A 3QOXA 3QY9A 3LKDA 4NG4A 2ZRLA 2QUZA 4EPWA 1GA6A 1JA1A 2Z4TA 3T3OA 2XQIA 1JEQA 1SBHA 4BUZA 4RVHA 2CLLB 4RZ3A 5BRJA 1B16A 4RHFA 4R8VA 4BLRA 4C88A 3CKYA 1D6NA 4YJGA 1EM1A 2HRCA 2XMZA 1XPUA 2FMXA 1T2NA 4ZANA 4YRTA 1O95D 3KZIZ 2G1PA 2FETA 5DM1A 2QTPA 3LDDA 5A0FA 3WMEA 2HP0A 4EG5A 4K8ZA 3IUPA 4HSGA 3N4YA 1B14A 2V5VA 5JISA 1QVGF 4Q7MB 3BK2A 4P3OA 1F2TB 3UWOA 4Z9XA 3A9CA 3U13A 4LJ6A 3I45A 2R70A 3ZMSA 2WT9A 1BQEA 3LDHA 2B1JA 3O0DA 2WYVA 1XXLA 1DC7A 2W2LD 4O3MA 3E2EA 3I6BA 4JJAA 1RQGA 1EBBA 4PQFA 1NJ6A 3HVIA 5JD6A 1UQUA 3IDOA 5DIFA 4PHGA 2OR3A 1W6RA 1X38A 4EPVA 4MTFA 5FUWA 5H1YA 4LBWA 2A86A 3Q0IA 4JYBA 1SUFA 3OBIA 4TSFD 5LQAA 3GZNB 1E6MA 3MTJA 4RM2A 5LZ2A 1V45E 3KVNA 4RFVA 3DE7X 1Q81H 1JHMA 3EH1A 3RYHA 2FDRA 5K3CA 4XASA 4CR8A 3ER8A 2JK1A 5AK4A 2QEXF 1CQJA 2GUWA 2V96A 2DWUA 5ALQA 2GM4A 3CVOA 4UU0A 3ZEAA 3GQVA 1RJGA 1U3UA 5H3LA 2EF0A 4DAOA 1UMBB 1SKBA 2H7CA 3RKRA 1XTKA 2EERA 5DXFA 3PTAA 4PTZA 2RMKB 1C4WA 2ONKA 3RABA 2QTVB 2P7IA 4BXOA 4X90A 3W6UA 4J9ZB 3QF4A 4CM9A 5LIRA 4GKAA 4R3WA 3EULA 3B7PA 1KQOA 3UBMA 1UL1X 3CG6A 5IT9M 4FCTA 3TDMA 4RQOA 3A05A 3VHLB 4F84A 2YZ7A 4KIUA 3G0GA 4WF9V 2PSHA 4BJ1A 4R0NA 4NZOA 3WBKA 4N7MA 4L4YA 2DBYA 3T3NA 1PV1A 2XNSA 4G6ZA 4X95A 4L95C 1RKBA 4G1VA 2F4VB 4F2WA 4QL3A 1W85B 1UZLA 1UBHS 3CX8A 1CQXA 1A71A 4E11A 1UJ4A 1U3GA 5KAIZ 5HZKA 4QUAA 2HXYA 4BMCA 2ZCEA 1ONNA 3CEAA 1WAZA 1HA3A 1HO3A 4NABA 1U31A 3HPRA 2B34A 4M1KA 4C8EA 1MO4A 3J7TA 4DTIA 5JWHA 3ZBTA 4EGSA 2C9DA 2VSFA 1HFWA 1DIGA 4PCAA 2B5VA 5BN5B 2YFHA 1U6KA 3AW8A 5EB0A 1EGHA 3MWDB 1E1MA 5BV1A 2BFWA 3SXUA 2N47A 3BWCA 4P83A 3D8UA 1BS1A 1XZGA 1XROA 2O2HA 4DLBA 1Y8QA 4PIVA 4JI1O 2ZBVA 1C8KA 1SQ0A 3R09A 3O95A 3I3OA 2NM0A 3UQ8A 1H5QA 2EDCA 3Q3CA 3DOFA 4YJ2A 4FYHA 1SCAA 1DC3A 4YP0A 3FLBA 3INRA 5EJ9A 3FOBA 4HGRA 4OK5A 3N8DA 1NFQA 1UFQA 3D02A 1LDMA 1UJCA 3C41J 3WI7A 2W8BB 2NPOA 2H2FA 1VOTA 3OTOB 3INGA 3UT0A 2EJBA 1CK2A 3U3MA 3QFTA 3A4NA 3URMA 4LCBA 2E3JA 5DM6V 5EHQA 5IK2D 3M4XA 2DR3A 5BVHA 3IS3A 4X44A 2Q2VA 5BN3A 3MT7A 1XFDA 2OB2A 5HFNA 3IEPA 3WXMB 3QA9A 1N3YA 4QYMA 3FGZA 3SIRA 1A5ZA 4RSRA 2K9PA 1ZXLA 2QMZA 3ZCUA 2Z1NA 1KI3A 5EY5B 5LQDA 2VUHB 4OYLA 1YVWA 3KVVA 1G38A 2DWCA 3NGXA 1ISHA 4HN9A 4EFBA 4FYJA 2BSKB 5G3ZA 2QPLA 1NN3A 2ZIMA 1Y98A 1XGKA 4YDQA 3V00A 4MVCA 1ZISA 1B6GA 1W47A 2JI4A 1UWKA 4TGLA 3JQFC 3VPCA 2G9NA 3W9BA 3HJFA 4ZCPA 4Z1MG 3PR3A 4RYDA 1TUIA 2WA2A 1AKQA 4KYTA 4ON9A 4LF6B 4JVMA 1SVWA 3WMGA 3UW1A 5EWJB 5CEEA 2WD7A 3NAGA 2HM7A 1VLLA 3I9JA 4LYGA 1DS6A 1YCFA 4K9LA 1FFBA 1TUBB 3O9OA 4RK0A 1E4EA 3HCOA 4KIWA 2GVZC 3GGOA 4IJVA 3EY9A 4E5DA 4DBLE 1NUSA 2P2YA 5ISMA 3L02A 3HR4A 4PQYA 4RIFA 1S3SA 1SXGA 1YF2A 2KB0A 3QUTA 4MUXA 3ZWQA 1WABA 4J0FA 1XCLA 2OK8A 4Q7QA 4U00A 3TMKA 1MVLA 4HBZA 1MC1A 1DXOA 3UC5A 1EFRD 1N33O 2IOQA 1PKEA 3LY5A 3TLXA 4H59A 2C4MA 2FDCA 4HADA 2B0JA 3ILYA 1UFIA 4BBZA 1RQXA 2RH9B 1Y6FA 3WB1A 4NTZA 4ZVLA 2BF7A 1Z63A 3DPUA 3T1OA 1BG6A 4X7MA 3PNKA 2XTZA 2NTYC 1YTFB 2PUSA 2ZQMA 2IP2A 2O8BA 1OV4A 5JFTA 1WG8A 2WUWE 2IX3A 2EQBA 1U8UA 2NO7A 1LD3A 1QV6A 2Q5LA 3O3OB 2YZNA 3VR1A 4YJ2F 4GYWA 5EMKA 1JTVA 3IHWA 1DUSA 3EEQA 1OCOB 4WI1A 4OUKX 4NATA 4EO7A 4YT8A 1GKLA 2ZBRA 3R0XA 4WZAE 3ELBA 2XGJA 1RQNA 2I80A 4URHA 3A8TA 3F67A 1DBFA 4BMYA 5HUHA 4LPSA 4FSXA 1Y6XA 4HH0A 1E2NA 3AG6A 5K3AA 4FR5A 1VSUA 2CBXA 2R96A 4LOIA 3P2MA 3HSSA 3I73A 3IVXA 3A3YA 1RCUA 3VPDA 3ROQA 3HXMA 2C5LA 1H1TA 1RU3A 1LPNA 4DV5B 3H87A 2VK1A 4EO9A 2RHGB 5F5NA 1GQSA 1FKAO 4KDFA 2TRSB 4XBFA 3D8TA 2V54A 1Z4KA 4NYIR 4JKIA 1KK2A 3K2BA 4YCLA 1CHNA 3LRXA 4TV9B 4BAUA 4H6WA 4J1NA 4H3HB 2JLQA 1QGUA 3U17A 3VR4A 1UXGA 3BA1A 3KX2A 4FS3A 3WPWA 3NMUF 4ASUA 2FUEA 4IGGA 2B5OA 4R2IA 2O0MA 3Q3EA 3GGDA 3EVNA 4GNKA 2UZIR 1IQ0A 5EE1A 5C7OO 4AMBA 1S4QA 1FQKA 3H0KA 2OXCA 1N7IA 1S9HA 3CS3A 2O3JA 4D45A 4JQSA 4O8ZA 2ARHA 2RJ3A 3HAXD 4C14A 1FVFA 1VG1A 3TSYA 1E59A 3R3JA 1KQSU 1BRTA 5T64A 4C03A 3KB2A 4XARA 3JQAB 3H2YA 2RCYA 2RE8A 2H4XA 1TKBA 3RQIA 2HX0A 3B3JA 3PNQA 1WXHA 2DWDC 3AGPA 2TMYA 2WSBA 4XB2A 4TLAA 2CGNA 5EIWA 3KWFA 2D6FA 3SYCA 2YOHA 2WZQA 2DETA 3KQLA 1KRXA 3UJAA 4IV5A 4BLVA 2C2WA 1QK4A 3QHQA 2YYZA 2J9ZB 2C0QA 3N6RA 4Y6LA 3E9EA 1P0IA 1TU0A 5ALHA 2YZKA 1IX9A 1NXPA 1XA4A 1PQYA 2P2LA 4GG1A 1SQ6A 3JWIA 3ZRSA 2AF4C 5BSMA 4W4KA 3P0FA 1E1QD 4TT3G 1AKTA 1GR1A 1HNWO 4ID9A 1SESA 5FFMA 4J3JA 3G6BA 2GZSA 3RS7A 5LU9A 1OWNA 5KYTA 3ORSA 1IONA 1ISRA 1TECE 1XLVA 3WJAA 4EHAA 2WPDD 2L17A 2HIGA 2Z2XA 1EE2A 2AG6A 4HTAA 4GMGA 2HHHO 3O4RA 3N5CA 3O47A 1X7XB 3NWJA 4Q1EA 2IVZA 4I36A 2NUAB 4JP2A 1TGOA 4YRRA 4FMCB 5A9TA 3O03A 1JWAB 4C4PA 1M1NA 4MVJH 3F5DA 1WLYA 1W0KD 5M7EA 3I2KA 1CUSA 4O3FA 1L7PA 1KI6A 3LUCA 3ZJ4A 4TKUA 5F12A 5DNAA 3W9SA 3KT0A 3J7AU 3K4QA 1XRJA 3QHDA 1UWVA 2HMTA 4I5FA 4OHRA 1ADBA 1JSCA 4DANA 3ET5A 5H70A 3GLHA 3MINB 1A7AA 3LNMB 4O25A 4TLBA 2LW1A 2AOUB 1KYIA 1J97A 4ZYZA 3REFA 4BT4A 4UPVA 4BW9A 2FP3A 3ZVKA 3OKCA 2A5YB 4QULA 5DX8A 1ZM2A 4Q1VA 4TL9A 4CETA 4FZJA 1T0UA 3WAKA 3WGOA 4YASA 2GK7A 5C18A 2ZUCA 3KL4A 4XOUA 1YDXA 1AHHA 1AK2A 1VFNA 2GEUA 3CCSV 3D81A 1HDJA 5ALOA 1YZ3A 2Q3CA 1BKSB 4C3VA 4YRAA 4AMGA 2FPIA 3WQHA 4GDFA 5D3MA 3F6SA 3E5HA 1OY1A 2Z8ZA 3ZZTA 1Z8FA 2E3CA 1RLIA 1O9HA 3ROEA 1Z83A 1Q3TA 1Y6QA 3HVRA 2ONZA 4G9EA 3JQ8B 3V8BA 5TX7A 1JR4A 3C4JA 1Z4NA 2GUGA 3ZHSA 1M5UA 2G09A 3MJTA 4M83A 2I3ZA 3B1YA 4Y6GB 4FOLA 3HJWC 1ZZEA 1O9GA 3T1TA 2JIZG 4GP7A 3TCNA 4QAQA 3SM9A 4D9MA 2GV9A 4F06A 2I22A 5ABPA 2VSYA 5CA0A 1OX4A 3ZRWA 2J6HA 2QM7A 2WE8A 4S0XA 1C1XA 2R97A 3VZPA 2CVQA 3HJGA 5IXSA 4P54A 4PA4A 2G88A 5EXEA 4BNGA 4JR0A 3O38A 3KBBA 4RKYA 3LDAA 2QTGA 2G1JA 2Q6VA 2FN7A 4TYMA 1OFUX 4GM4A 4G09A 4G0XA 3F4KA 3N3BC 1NFRA 2R8BA 4DRXA 5K0BA 1BXRB 1PF7E 4TWZA 2Z01A 3ITDA 1NXXA 2Q3EA 4KNVA 4Y9SA 5HWSA 3CNNA 3GPIA 2XUMA 1T8YA 2I3BA 2Q6LA 4EK9A 5CW1A 4E22A 1X7YB 3H5OA 3AONB 2EBWA 2JEYA 3E9YA 4TVOA 2VYNA 2JZOA 4BTVA 1XWIA 4CDRA 4WH0A 2YJGA 5CBKA 1IXMA 4GR5A 1YK0A 1MABB 1CDOA 3QWBA 2BTEA 2Q4TA 5JDIC 4CR6A 5IJZA 1VRWA 3RDPA 3DC2A 3ZVLA 1RT9A 4DCCA 2XIJA 4BKOA 4QECA 2YS8A 4KKXB 1RJ9A 2O3UA 4HEQA 3WICA 1S8FA 2DQ3A 2B78A 4ZAVA 2X41A 3EGIA 4OMFG 3BN3A 2BTQA 3NJRA 3QA3E 1GZ3A 4QGSA 1N34O 3JXEA 3VAYA 1KEWA 2CLKB 4AJ1A 2D2CB 1MVOA 2F9LA 1JDJA 3Q0EA 1KEEB 3KSBC 4DV3B 1XZ8A 5ITZB 5DOZA 4EUSA 2HL6A 1FS5A 2V4DA 5FBWB 2DP4E 1I1NA 4B6EA 1QVFF 1SKMA 3Q10A 4BC1A 2FPXA 1U1CA 2IV3A 3F3MA 5B1HA 4DCPA 1NKSA 2GFIA 3JVEA 4FYXA 3V32A 3AVXA 3CNHA 1FJGO 1CXZA 2C1EA 3K9CA 3I5AA 4BLSA 1Q44A 1ZK3A 4LVCA 4AJHA 2LV8A 1GKUB 2ASVA 4XFKA 3BORA 1JIQA 4E1VA 2XBLA 1W4LA 4ZKDA 3E4CA 3L8YA 2BGUA 2WLMA 4K28A 1NBHA 4X62B 5JNLA 1MO3A 3PPVA 3BFJA 1M6HA 4W99A 1QDLB 3E6AA 1KI7A 2LIVA 2VDJA 4MKGA 5DSZA 4Q6WA 3DZHA 1ZNXA 1NE7A 4KP4A 5B3SC 2D2IA 1YC2A 3EBOA 1UBCA 2C97A 3AVVA 4J9YB 4BFXA 3HKEB 1SQ5A 3U10A 1JNXX 4ETMA 5EQFA 2XZLA 2IEDA 2ZTHA 3THWA 3EB9A 1MC5A 2E37A 1I1OA 3QPUA 2B4RO 3FWNA 5KHKA 4ZVRA 1NLMA 4KR9A 3DVAA 4W8OA 5CA0F 1GRCA 2A59A 2DHCA 1XMSA 1WZEA 3PQEA 3VX3A 3AEXA 1KOJA 4RVUA 3DP9A 2JKVA 4HDQB 4ZKIA 2WTEA 3LCCA 4N40A 3F5MA 2OYSA 1OBOA 4MS1B 1X19A 3RC7A 4UM8B 4EP1A 1DF5A 5CYPA 5E1BA 4L7VA 5EXXA 3LKBA 4KAJA 3KOMA 3WRVA 1KJZA 2V8OA 4NBLA 5KNBA 3Q9UA 3U3OA 2FE4A 3DTTA 3R7NA 5HIMA 4UNIA 3BYQA 4DCVA 4S3MA 4Q3EA 3WLNA 1XK6A 3VPAA 3ICOA 3ZK7A 2A5GA 5HE8A 4WZBB 5C93A 3IODA 2XGOA 2NU8B 3HZZA 1LZKA 4R3UC 1E9AA 1VYVA 1EVYA 1Z5VA 1K8AW 4LK2A 1XZFA 3CF6R 1L3CA 3CPHA 2C9OA 3QVSA 1MB9A 4QLOA 1D4ZA 4DDWA 1JZSA 3EQZA 3SHOA 4BWYA 1UQRA 1JVMA 2L18A 1ML4A 2NZWA 1K33A 1PR1A 3NWBA 3CKKA 3VSBA 3AFHA 1IV2A 4DA8A 1EXDA 1LVGA 1JEYA 3DKVA 3R7FA 2HJGA 1D0IA 3CLSC 3SX0A 2B1RA 3HKDB 5KOJA 3AG1B 2JZNA 5BW5A 1RQRA 1QP8A 3RS5A 1TUEA 1ZIDA 1I13A 3JV7A 2WZCA 2O2DA 1N5OX 1KO4A 3K5PA 5KTRA 2ZXEA 4TYNA 5FTWA 1S2DA 4ZVTA 4MYHA 1JMVA 2Z1EA 2PGAA 3OETA 1HFKA 4H4DA 1GY8A 1QPGA 3UUGA 5KHHA 2VWPA 3JYQA 5KTPA 5CH3A 1U11A 4P38A 1NMUB 4L5AA 1OC4A 3DBRB 4ZYLA 2UZ4A 3IRUA 4YC7A 1GCOA 5J5VA 2ABWA 3RIHA 1QH1B 1KYYA 3BXHA 3CNOA 4IIFA 5HFMA 1UZMA 5ICSA 1KP9A 2V7BA 3TMAA 4C1BA 3KIPA 2R4QA 3RYCA 3DW1X 1SETA 2DWQA 3WHIA 3Q12A 1XDDA 3R6WA 4B3RO 1DQSA 1F06A 3CSXA 1TVEA 4B75A 1VL6A 5KYXA 5IE9A 4HX5A 4HB2A 4HTFB 1EAYA 2Q6IA 3N87A 3CVWA 1WSBA 2H07A 4OFWA 2CSLA 2I55A 3W4JA 4WXHA 2QTFA 2EGUA 2PYJA 3SYQA 4EFLA 1PZNA 4FBGA 1W55A 2AUNA 4LWSA 4I2NA 5EUBA 3EPLA 1ZYUA 5JWPA 3GFBA 1I4OA 1YZKA 2BZ1A 1ZMBA 5KYVA 1SKAA 4EB0A 3JATB 1GTJ1 1C7RA 4OB6A 3KC2A 1S0UA 3GLGB 4BKRA 4XQGA 4DR7O 1VXRA 2KM1A 2VHQA 1W48A 3TB6A 2PXCA 1DMSA 1MJGM 2YMLA 1ADYA 1QB8A 1ZP6A 5CB8A 2CGEA 2QTNA 3F6RA 2ODMA 5EJ5A 3FY4A 1CUZA 3DV0A 4MV4A 2DULA 2TMKA 3TJMA 1WUHS 3M7MX 5FL7D 3HN6A 4TSFA 4ABMA 2K87A 3ZYCA 4TTTS 1PYDA 3M0EA 2Q1SA 1R16A 4A26A 5F2OA 1EK6A 1J2TA 4BYMA 4LF9O 2GF0A 3NTOA 1NF3A 3HBAA 1L5VA 3ER9A 4CMHA 5CLQA 1PR6A 4L6CA 5L7TA 4LSGA 5FWXA 2IXAA 3L74H 4DM4A 1OHHG 4FM1A 2Z1TA 5T6BA 3NFYA 1NSFA 2O48X 4R16A 2QLFA 3JQRA 4Q37A 3C6BA 4JBYA 3UAVA 4PONA 3SD7A 2YBDA 1P5JA 3D59A 2I8AA 4EY3A 4KO3S 2RNBA 2W6JA 3X1DA 5CFNA 4KRXA 4K88A 5FULA 3EW9A 2AB0A 1H22A 3NQ41 5T67A 4F2PA 2IU6A 4C6TA 4WNYA 1BHJA 2BFBA 4DMMA 3LSQA 1T6XA 4M98A 5DHUA 1O1YA 4URFA 4AYXA 5JPIA 3DO8A 3MUEA 3EIQA 2Q68A 4C7OB 4EG4A 4G8CA 4I0XB 3AM3A 5JS7A 4XJVA 1T8SA 3VQVA 2VZEA 1JSZA 4XGQA 1RQ2A 2WU3A 4PWYA 1J56A 4RAOA 4YMSA 4WN9B 1Z4QA 1CS0A 1I51A 1ZO8A 1DG1G 4F4HA 3A32A 2OBNA 3QI7A 4R2WA 4R2LA 4UCRA 2BDEA 3RFVA 1IHYA 3R75A 4B3TO 1P0PA 2QM0A 5JHGB 5GINC 3GDGA 1A8SA 3JWPA 3T12A 1YFKA 4M0PA 2EKBA 3WLLA 1D2HA 4KQ6A 2ZUWA 4RMHA 4A0HA 4DLYA 4P9OA 1TYDE 4ROTA 1R00A 4IIJB 5SZIA 3RE3A 2O9JA 5DHRA 3C9SA 4E15A 3ZI7A 2J30A 4YPFA 1XA0A 4OD0A 3A7DA 1ZH2A 4FMBB 2H8CA 1V5WA 3ABIA 2FSSA 5JJEB 1L1RA 1TKCA 3BHJA 1T0KB 4ZZ1A 5HFLA 5CEJA 1DPGA 3C6MA 4Q9AA 2H63A 4EW2A 1HWYA 3PNVA 4FPXA 3GLFB 5I5GA 4F72A 3THSA 1VQNV 3A1DA 3G3EA 3D64A 3HJCA 1MB4A 3V2UA 1SIWA 3VYSB 1B0ZA 3LCJA 2E5LB 1DDOA 3CNBA 5I7VA 1RYMA 1P9OA 3U4QB 3UQYS 1JAZA 2EW8A 1P6QA 1CDZA 1NXVA 3VTZA 4YX9A 5B1BC 5J2TB 2YZ2A 5IK2A 1JHXA 2SCUA 3TZCA 5AVVA 4EO4A 4WZ6A 3Q6IA 4QE3A 3BCSA 5GPBA 1SCKA 1TJ5A 3BB1A 1Y4MA 4IYRA 4PXAA 3CRAA 3TTSA 3EMVA 3DONA 4G24A 5SZHB 2NUTB 1A1VA 4HUTA 3D3EA 4DMLA 4D3YA 2BV3A 4B9AA 1PP4A 2QJ1A 1AF4A 4R41A 3ET4A 4HG2A 2YNMD 1YHYA 3ND6A 5CRIA 1GKKA 4G4ZA 1PUXA 4KO4S 2YWRA 2G4CA 1HRKA 4ZU1X 3TZQA 1XV5A 3HU3A 5ETJA 4P4LA 2X7XA 3HCBA 4Y2PA 1TAEA 2GN8A 4NEGA 1I2DA 1XJQA 4DA0A 2YMPA 3IDZA 4FGUA 4OQYA 1PSDA 5IY5C 2GD0A 3RFUA 4ASUD 5D51S 1W40A 1PQ4A 1ZAYA 1G55A 3LWVC 1PZFA 3K5HA 1KH2A 3T0FA 1T0HB 1ZSVA 5EG5A 2BSQA 4RDIA 4MCIA 5KWVA 4QPDA 3CJHB 5ES4B 2ATVA 3PYXA 1E7QA 4NP6A 3AINA 2ILTA 3ND9A 1R5JA 3PEWA 1S2IA 2IZ1A 1QRSA 1QHGA 1DCKA 4JC5A 3JU3A 1RRCA 3WG7C 3LG2A 3DDZX 4GKVA 1V3QE 4BBJA 3L7LA 3IHLA 3NTQA 4G0MA 4RPGA 4OX9Y 3MOGA 4H1HA 4J0CA 2W2NA 1EK0A 2PJRA 1BHSA 1XMXA 1BHAA 2CJPA 1V37A 1EFRA 1DEAA 3N3AC 1NBEA 1OCRB 2WSMA 4MR7A 4Q1BA 5CLIA 1YGYA 2FCRA 3OPYI 1VKNA 3PQDA 1D2EA 3OZFA 4JUBA 5JZOA 1NJSA 5I4KA 5FYDA 1KY5A 4QUBA 3FF1A 3TZHA 3G6EV 1KNXA 3VBEA 5ICGA 5T5QA 4OGQB 5A5EA 3EXFA 3NX4A 4FGWA 2Q6KA 4B4DA 4X0EA 4DPKA 3E83A 4OHZA 3AUFA 2YOFA 2BI7A 8AT1A 4UDOA 3SZMA 3DCIA 2V7UA 2H2DA 4GWGA 4TMKA 4XQCA 2PWZA 4UUMA 2ZRFA 1JYFA 2IHNA 3QSYA 1NT4A 1ULBA 4KRFA 5GY7A 4LMRA 3KYIB 3KYDA 4WVLA 2HR1A 4PC6A 3RIEA 3LQ2A 2IODA 4DRYA 2VS0A 1TKAA 2RHJA 4DQDA 4JBLA 3OCXA 1E2BA 1NVVR 2VF7A 2FTKA 2GN1A 3QEJA 4OSEA 1JQKA 1R74A 1HYBA 1OQAA 4RHUA 4BAYA 4Z4IA 4KFTA 1QG2A 5JSYA 3RSZA 3H1EA 4LG1A 4EB8A 1M76A 2BFNA 2NO5A 4U3FH 4N41A 2Z5GA 1W29A 4MVJM 5BWNA 4CHGA 1AK1A 5E4TA 4UAUA 3ITKA 5H4HA 4HATA 7REQB 3WTCA 3DQQA 1Q6IA 3F4BA 5B3JC 1OYVA 1SQBH 5BXQC 1EXNA 4P2BA 4YJ3A 3JALA 5KVAA 4GXRA 1RZRD 4EG7A 1K7XB 3RHSA 1T24A 1HOXA 1GNPA 1KOLA 5J3JA 4A91A 3N7AA 2OKGA 2Z2YA 721PA 1RXSA 2CLDX 3IKFA 1N33B 2IXDA 3AXTA 3PTZA 3P97A 4HDSB 1DVRA 1QTQA 1GN8A 4D9HA 4H2DA 3RSHA 5IULC 1UR5A 1BU8A 3IGAC 2WJIA 3GMDA 3T3HA 3PF8A 3K8YA 4K9SA 2I4LA 1TXGA 5IRCD 2YV1A 4NJMA 2TSYB 4EF6A 3ASOC 1VK3A 1B6SA 4OQDA 3ASNB 1W75A 4HAZA 2ECOA 1UFKA 3EPRA 4P7FA 1YS1X 1F3LA 5A05A 3RNOA 1G8MA 4GOXA 3ROFA 5ULLA 1U9IC 3T41A 3EEIA 3DC7A 2HEIA 4G88A 1LNZA 2ZVQX 5E38A 3FHJA 5ICCA 5EJAA 2QJFA 5B1OA 4U1RA 3HCFA 3AY7A 4S1OA 1E1QA 1V43A 2VHXA 2RHBA 1CF4A 2VYND 3LTEA 2FXVA 4AMZA 4NHOA 3VHQA 1NIJA 4GM0A 3NONA 4B83A 4CIXA 4K9OA 4BNIA 1BHQ1 1D09A 1UI9A 3GIWA 1XBLA 2WPDA 1Y82A 4YPVA 2Y1XA 4MW7A 2IK8A 3PAFA 4JAVC 4LAFA 1WCYA 2QQEA 3G9UA 3DEHA 1M1YE 1Y6JA 1XZCA 1K97A 5K01A 4MRMA 1RXIA 2QI9F 4I50F 5DHFA 4RD3A 4UE3S 4KQGA 3CZMA 1JFLA 2BMEA 4DJTA 1YWGO 1OJ7A 3ODPA 1KPIA 3S02A 4F5ZA 2A2ZA 3JTMA 4RWUA 4PX9A 1STOA 1W0KA 1DCMA 1LQTA 5DWDA 4REQB 1B3BA 1QHFA 3BC1A 4NZ9A 2J5QA 2C8KA 4TKLA 1XF9A 1E7RA 1S77D 1F5SA 2R751 3K0SA 3U5ZB 2Q7EA 1U3CA 3OLXA 4FFKA 3K08A 1FNMA 1USKA 3QE2A 3FKQA 1XALA 2PGNA 1M2JA 1KWKA 4A82A 1KR5A 2FNAA 5IBQA 4KR6A 4LGYA 4GMXA 4LMBA 2DCUA 1G21E 1N8SA 3IYLW 5J40A 3STXA 5IJWA 3UO3A 1XEFA 1NLZA 4N18A 1U8YA 2CVFA 3ODGA 2FSHA 1T29A 2EG9A 3AH8A 2PL5A 3ZWXA 1PJZA 1QOZA 1X7OA 4XXHA 3H13A 4OM8A 1PDWA 3KKEA 1JU4A 2WA3A 3NBMA 2FP4A 4KH0A 4CF5A 1X1RA 3IUYA 2PZEA 1R0YA 2X0EA 2X0NA 5EXTA 3H9BA 5DI9A 3MPOA 2W00A 2C4TA 4YJ3F 3EG9B 4YP1A 5ICFA 1P33A 2WOJA 4UW9A 1WRBA 2JIPA 3B51X 1K63A 2Y0PA 3B3FA 1Y48E 1QQBA 2K5UA 2Q4BA 1B0AA 4FQ8A 3TIFA 3TZBA 4LBVA 3QU2A 5KZMB 3L6EA 1WA8A 1BSVA 5IZCA 2Q67A 2CBGA 5LQRA 3MHSC 3NUZA 5BPHA 1BJRE 3PKIA 2R00C 2R1TB 2VJYA 3RS3A 1IRXA 2C7GA 4G4GA 1M72A 2WNSA 2L26A 4IVRA 1HT1E 4AD8A 2XYVA 1RWQA 2C2MA 3KJHA 2HHHB 4MVRA 3ZW8A 3CMCO 5AVRA 5EKSA 3PP8A 4IKPA 3BJRA 4OMCA 4I1RA 5FJIA 5LZ9A 3N6VA 1EGQA 5LMNO 2YXNA 1Q6YA 521PA 1EE1A 3OCYA 4X1KB 4O0MA 2P65A 1JFVA 3C6ZA 3U4DA 3LPLA 1GR0A 2PO5A 5JJIA 4BOYA 3OCUA 3P71T 1H8HD 4AJLA 4JLBA 1RP7A 3PQ5A 3WSVA 1BWQA 5HQ3B 3LIPA 3REQA 3TCKA 4GBGA 4CKZA 2R6HA 3PEFA 4JZKA 1RJDA 4YTEA 3C1OA 5ALFA 3ECCA 3VHRA 3VO2A 2XJ9A 1KJWA 3W5BA 4HAIA 1A77A 4ENUA 4JXJA 4IIBA 3TQRA 5HY1A 4PYOA 4ZU6X 2AMVA 4DEVA 1ISIA 2QRNA 4N3CA 1LBHA 2YMQA 3N2ZB 4H7FA 3QYPA 4DWOA 4DQXA 4GP9A 5IASA 4KV7A 1IEWA 4OGFA 4HNRA 1GSIA 2ZANA 4BWGA 5SV2A 2A33A 1Y4ZA 3BJMA 4E21A 1ZWLA 3OF3A 1GTRA 5TV2A 1ONPA 3VU1A 4G26A 4O5AA 1MIOA 4MYUA 2EW1A 2OO5A 3JZMA 1QMPA 1Z3IX 4JBHA 2ECQA 3DAPA 3LYHA 4TL6A 1KL7A 4J4BA 5DTMA 1I7PA 1QLJA 3K1JA 4ZHQB 1ULUA 2M1XA 3DEAA 1VCHA 5GIPE 3W7AA 1ZL8A 2AMFA 5C7IO 4N0MA 4PGAA 4AS1A 4TYQA 1RNLA 4BJHB 1CE8B 3MLAA 3MAAC 4MPRA 1MO2A 3LYBA 4QYWA 1JVBA 4TV8B 2X22A 5LUBA 1NHGA 4PXSA 3OZEA 4Q1AA 2KLBA 4I08A 5AM5A 4KN5A 1LV7A 4N0PA 2SKCA 2FOXA 3NTUA 1FYXA 5G3YA 4F3TA 4UOEA 1QAQA 1MEOA 1HF3A 1PM9A 3QMVA 3TL3A 1CUFA 4DEYA 2DUUA 2PUCA 1EDDA 2UYCA 3M33A 3TLGA 2FG6C 3TYXA 5EINA 3LX8A 4XFJA 3ZLTA 1M6WA 3D6AA 5JU6A 3LOUA 2YJ4A 4RESA 3QFHA 3OX3A 2XE4A 4YDHB 2NO0A 2ZUFA 4BLQA 1SOVA 2WHXA 4H27A 4EFMA 4IJUA 4KVGA 3T1HB 4M46A 1YBVA 5F1OA 2Z9BA 2JAOA 3CCRF 5HGXA 4W9NC 2EFCB 2IHKA 4LC0A 4WOPA 1A9RA 1W2HA 2GHIA 4C20A 4AIIA 3ZP7A 1HG1A 5BW8A 3UQZA 4LCEA 1ZN7A 2W6OA 4QKQA 2CFCA 3AG4C 4FZ1A 3CH5A 4MITA 4J4HA 2FZ5A 4C2BA 2H1WA 3U7QB 3VX4A 2DPMA 2AK2A 1J00A 3GN2A 1K0FA 1DJNA 3ASUA 4XVRA 4R69A 4L0MA 1XXHE 4DARA 1RWNA 1C2TA 1ZRHA 4J1QA 4K2AA 2XRMA 5GWXA 4JQZA 2RHOA 2ZBDA 2W6JD 1S02A 2M32A 2C5BA 2XH8A 4EKGA 5JYEA 2NVBA 2O5RA 4EB6A 4PC1A 3I3FA 5A9GA 4CEHB 1JAYA 3ROZA 1V9CA 2C59A 4DR3O 1D0SA 2G9RA 4HMOA 1F2DA 4XA8A 2OZEA 2QP3A 3RTDA 4HWOA 2IRWA 2WLKA 2C9BA 5A4MS 4BWFB 1ZK4A 4OA5A 2QYOA 4NTXA 1XZEA 6ABPA 4CTNA 4OI0A 4D81A 2I7XA 3I1YA 3T3IA 2HLPA 1Z6AA 1S9DA 1FSPA 4WA8A 2QDKA 3EOAI 3MHHC 4IP0A 1VJ0A 3Q8MA 4P4NA 1BCCH 1CIPA 2NXWA 5B7PA 1AD2A 1NYRA 5A04A 5JXGA 2MSLA 5ALWA 2XGSA 3NYRA 2AZMA 1T8RA 3G1TA 4C4OA 2IF2A 1WD7A 2J31A 3E89A 1QCZA 3CLRC 4GE3A 4C22A 4KR3A 5DBGA 3U19A 4O1HA 3F74A 4DT1A 1PJCA 2PX6A 4LHVA 3RT3C 1CUAA 2F1JA 1T8UA 2QTAA 3V3KA 3CPWF 2O8VA 5DJ5A 5IXYA 5B4TA 2GA9A 3L0BA 2XGGA 2CVHA 4NE7A 4R1TA 1JE1A 3J80N 1N2HA 1E8DA 5D6NA 3ZC3A 3KAPA 3A0BZ 3EORA 4V0LA 1X0XA 3F46A 3H9EO 5AKGA 3C1AA 1SG9A 3M2TA 3P5BA 2NZYA 3GEIA 1HEYA 3NOVA 3AY0A 3DHYA 1FRVA 3AR8A 2FQXA 2X6TA 5L3QA 3B6NA 2B7LA 3PUJA 3TL6A 4ZJUA 2IHBA 1OLUA 3NM4A 4NQ3A 3WU2Z 2ZYTX 1SD1A 1C7FA 1PNTA 1XV2A 2X6QA 5CBHA 3UWSA 4AJIA 5FL7A 3T3PB 1Z7WA 4FB4A 3DMNA 3UANA 1ZL2A 4YJFB 4FW9A 4HYOA 1RTKA 3RVJA 3QW2A 5LHIA 1HTTA 4CKEB 5FL3A 4L8VA 3K59A 1J95A 4PYQA 2RCVA 2Y4UA 1Z74A 1SB8A 1PT6A 3JD0A 1DQNA 4QXRA 2P4QA 5LZ8A 1XQ6A 1U7ZA 1EDEA 4ARAA 2PZFA 4ZT3A 2AN4A 4W63A 3EA0A 1ODJA 2AFIE 3I55F 1R3UA 2P8SA 1E62A 2HGZA 2ANCA 9ABPA 2RAUA 4D9CA 2QBYA 5FOWA 4G5QA 2F67A 2TECE 2JVIA 5TMBA 4K35A 5E9AA 1Z5UA 1EFUA 2HIAA 3WK5A 2AKEA 1WZ2A 1WZCA 3B52X 5BQ5A 4HR7A 1ODTC 4KU4A 5DK4A 1D7OA 3IO3A 1TF2A 1F14A 2XA2A 3FSEA 4J76A 3MGCA 1IDOA 4DABA 3PC8C 2O7QA 2G40A 1UJBA 4DA4A 4R7GA 5LOVB 3FHCB 4L3OA 1XCPA 2WHEA 2UKDA 4DR7B 4QDJA 3N27A 3LBHA 1QF7A 2B1QA 4WCFC 1KXJA 4DDUA 2FEAA 2OHJA 1XKLA 1E3SA 3TBHA 3SGIA 1ICEA 4OP3A 3GA5A 3IT3A 3DF7A 5AK3A 1ZXXA 2FPGA 3C6XA 3DW3X 1W87A 5P21A 3AERA 1NTRA 3PI7A 3O21A 5T3UA 1ODIA 1A82A 5CH8A 1Y3AA 3OICA 1DQRA 4DO2A 1G8GA 3GB7C 4HXGA 3GRYA 4L57A 1L7RA 1CZHA 3SJ7A 2Q3HA 3E9ZA 2WG1A 4C7MA 1H2EA 4D0SA 5JPCA 3AJ8A 4MUYA 2H4FA 3CO0S 5CAEA 3OPYB 4HMQA 5CX1B 1AGXA 3Q8KA 4RH1A 3LSSA 1COMA 1G5QA 5CVDA 4ONEA 4PTYA 2EYUA 2J3EA 3SK0A 2CL6X 1II0A 4X65O 2CHFA 4IXMA 3H2BA 3N8GA 4K8OA 3CEPB 2C2OA 2IEAA 5KTNA 4P30A 2PVPA 4CM7A 1A1SA 4BP9A 2OAGA 2CHTA 2DQ4A 1OIWA 3BSFA 3C7AA 5JXHA 1Z73A 4BO5A 4Z0NA 3O3MB 2YNMA 1FP1D 3H9JA 3R65A 5FPQA 3N2GA 3K70B 1MXFA 2C7PA 3RNLA 3VC7A 3ZE1B 4KMOA 4FHEA 3ZDDA 1IUNA 3TCXB 3EGDA 3G23A 1CP9A 4A5OA 3OGIB 1H9BA 4V03A 2ZIUB 2YHSA 5I7FA 3IILA 2G08A 1QHEA 4IRMA 5G4UC 2IUSA 4EX7A 4G0WA 3O1IC 3WKAA 1J0BA 2QWNB 2L35A 2HN9A 3AZPA 2Q7DA 3CVYA 2HZBA 5LPNA 2HI0A 3CWCA 1RZVA 2GF2A 1BS9A 3L1IA 3T3DA 4LBZA 1T8TA 2RB9A 2EKZA 2V0NA 4LRSB 1CUXA 2RHHA 3HDVA 5LGNA 2Y93A 1J1IA 3OPVA 1UM9A 3ZWAA 4K05A 1RRVA 2GYYA 4HDKB 4IX1A 1AQLA 2HSZA 1OASA 4S05A 4NQRA 2X0JA 3V9AA 5AI0A 3DKKA 4DWJA 3VDRA 4YAWA 2EKDA 1W76A 2DB3A 1AV6A 3PT5A 4K8RB 4D82A 3EHDA 4MI1A 1IBKO 1J4AA 3DTVB 2Y68A 1IAQA 5C9ZA 4RF4A 2HX1A 2E5WA 4NFSA 3UCXA 1R6BX 2HBZA 4AUNA 4MYSA 1HORA 1SURA 4AIRA 1W4AA 1FMTA 1JH9A 3IJ5A 4N1AA 1CQIA 2BH9A 2CGOA 2A94A 2E1RA 5K0CA 1R0ZA 2WJ4A 3FFAA 2BE7A 4NARA 3JARB 1RSOA 4HDCA 3GLQA 5C4MA 3RWBA 3I8SA 1KKUA 3G6KA 1Q6HA 2B1GA 1QO0A 2DKNA 4KUEA 2I6QA 1F8UA 2GJAA 2DCMA 3PLRA 2R8EA 1WMSA 1Q5PA 3I3SR 1KAHA 5ECDA 5K51A 5IFLA 2FLWA 3NYWA 1KR2A 2ATEA 3CLSD 3KXPA 1VI2A 2BVNA 3CNEA 1CRPA 4UOZA 4MQ4A 2Y1KA 4DM3A 5H9WA 3FDJA 4DB2A 1E99A 3LM8A 3ME5A 2V59A 2EWCA 1VQ8V 3W8DA 1EJBA 3ZQJA 1TTTA 4D4KA 4HVAA 3X43A 1VCNA 1EG2A 4Y9RA 1VHLA 3C8HA 1MF7A 4U3JA 2F7SA 4GQIA 1R0KA 3QVLA 1R6AA 4RPLA 4U7JA 1CQPA 1SQGA 5A03A 2P0AA 4RDHA 5EE9A 1ZLYA 4CMJA 5C5EA 1T36A 1YR3A 1Z28A 4CM3A 2VP9A 3FH0A 1KQGA 1VGVA 3E1KA 4W9MC 1XMIA 1YJ8A 1GZ5A 4UNQA 2CNLA 2WTNA 4F7WA 5EFOA 1Q86H 1SIUA 3KO8A 2GM3A 5G41A 2AQ8A 3QVMA 3GDFA 3C5CA 5B7GA 1RZRA 1O57A 3TUIC 2PN1A 1LPBB 5EE5B 2H2GA 1CQZA 3SXJA 3DE4X 1WB8A 2W90A 1MX5A 3PI6A 1DTWA 2X0IA 2IDKA 3CSSA 3EEOA 1VMIA 4JLKA 1G20B 1TFRA 3UAXA 3CFYA 5LIPA 4JUDX 3U0BA 3PGXA 1SKUA 3UJ3X 4CH3A 4XGIA 4B2YA 3T35A 3GVMA 1NNUA 2XE8A 4M1QA 4PG8A 5LP1A 1GO2A 2HU8A 3DC6A 3IMCA 5CYGA 5A3VA 5LGUA 2ZYIA 3GVPA 3R5JA 3KU4A 3DLPX 4ZHSA 2QLJA 3Q3VA 4OXQA 4BVLA 4LF8B 3IP5A 4LJ4A 1PG2A 2ST1A 3ADDA 4NVRA 2VTBB 1U96A 3Q88A 5CG2A 3GQBB 4HAXA 5HF5A 2GX6A 1MHTA 1KP2A 5F23A 2PS9A 4US1R 4JOSA 4UD6A 3I56V 2P30A 1KYOF 3FUTA 3M1XA 2H08A 3VZDA 2N3ZA 5C0OE 1AURA 4L5JA 1MQ8B 1P3Y1 1CY4A 2C2HA 5CM9C 4ND5A 4P3PA 5JDCC 3CJTA 3FVTA 4XYGA 4KDEA 1YB5A 2PT5A 2XUIA 4A0SA 3ZE9A 1IOWA 3A14A 1H2FA 5L4SA 1YAJA 2Q28A 4E7OA 3HWRA 2ZTMA 1JIIA 2G9VA 4GC9A 3HZHA 1I4DD 1TMKA 4J94A 3PXDA 4G0VA 1WVGA 2AIFA 2PBRA 5KOIA 3UK6A 5HUJA 2QRVA 2PGGA 1DX6A 1N36O 5CMLA 2H48A 3UAZA 4DF3A 3NDJA 4FDAA 4EJSC 4HC4A 3L0CA 2QN1A 4H13B 1EP1B 5HSGA 1WD5A 2X1MA 4KPUB 3E8XA 1ECJA 3IP1A 3UMFA 1Z2EA 1EVLA 5K3OA 4EHNA 3HMQA 2Z8YA 4DCTA 1PHRA 3VYTB 3ZJZA 1J42A 1PR3A 4PS1A 1XP8A 4AK9A 2BL4A 3Q6NA 2O19A 2GZDA 3DZIA 1IEQA 4KXNA 1OBFO 3TTVA 1NP3A 4Y2VA 4N3BA 3RC2A 3B12A 2OUKA 2ZINA 2ZI7A 3COSA 4P36A 1RC0A 2I87A 2QP9X 2B9EA 2C82A 2V58A 1RWKA 1J2UA 3QVKA 3QKRA 4QPPA 4LH6A 2V6JA 4IX9A 2BUCA 2L2QA 4R8MA 2CV0A 3HRIA 4MROA 4P35A 3F0TA 2AEEA 4MEBA 4QOEA 1WB5A 2BOVA 4N0QA 5KSOA 2ECKA 4MVWA 1B00A 2OOKA 3AW9A 3RUAA 3IAS6 2HV9A 1R8JA 1OLSB 5CLHA 2WLLB 4AX8A 1UC9A 2WE7A 5JASA 4G3XA 3MTIA 4IHAA 3ZBPA 2IZ7A 1UK9A 3U1VA 2GTAA 5FLXN 5AP9A 1QRDA 1A76A 1X52A 4HQLA 1TTHA 2VJDA 4BMNA 1KI2A 4B87A 1DIAA 4KFUA 2I8CA 4HGOA 1OZAA 3QNUA 4PG7A 4HX9A 3DDUA 3AHCA 2W58A 4C05A 1IVNA 3N9IA 1NTKH 4KTTE 4CN8A 2DBZA 4YMVA 4ND4A 2COUA 3L6OO 1H8HA