4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
4X1YA 3C8LA 4EB6B 1W59A 1W5EA 3JALA 3JATB 4I50B 4WBNB 5JCOA 3RYFA 5MN5A 4O4HB 4O4IB 5JVDB 2RHJA 2RHHA 3HKCA 4FFBB 4TV8A 5CA1B 3RYCA 3M8KA 2GVIA 3ZBQA 4I55B 3VPAA 4O2BB 3N2KB 5J2TA 5LXTA 4LNUA 5KMGA 4ZOLA 4I4TB 4HNAB 5ITZA 1SA0B 4IIJB 5LA6B 2BTQA 2Q1YA 3M89A 5JCOC 5KX5A 4B45A 5FNVB 3HKEB 5M7EA 1W581 3WGMA 4O4JB 3HKDB 5BMVA 5LP6A 2BTOA 3JARA 5IJ9B 5CA1A 1TVKB 5J2UB 4I55A 4X1IA 5EYPB 4O2BA 3N2KA 3HKBA 5LYJB 1W5AA 3WGKA 2RHLA 4O4LA 5GONB 4KWEA 4U39A 4YJ2B 4O2AB 3RYIB 1JFFA 3JAKA 5IJ0A 3WGJA 4X20B 3RYHA 4ZI7A 5EZYB 3JAWA 3E22A 5FNVA 5LP6C 5C8YA 4X1KB 1TUBA 5CA0B 5EIBC 1W5FA 4TUYB 3VOAA 1Z5WA 5CB4A 5J2UA 1RLUA 3ZBPA 3UT5B 4F6RB 5JH7B 2VAWA 4TV9B 4EB6A 3JATA 2Q1XA 4I50A 4WBNA 4DRXB 3R4VA 4O4IA 4O4HA 5JQGB 5JVDA 3VOBA 5MN6A 4FFBA 2XKBA 3JASB 4YJ3B 2VXYA 4U3JB 1FFXB 4X1KA 4I4TA 4HNAA 2VAMA 2XKAA 4IHJB 5LOVB 1SA0A 1Z5VA 4IIJA 5LA6A 1W5BA 4TUYA 3JALB 3VO9A 3RYFB 1RQ2A 5MN4A 3HKEA 3HKCB 4TV8B 3RYCB 3V3TA 1OFUA 5J2TB 3ZIDA 5LXTB 4LNUB 4O4JA 4ZOLB 5KMGB 3HKDA 4DXDA 3CB2A 5ITZB 2RHOA 5IJ9A 2BTQB 1TVKA 5LYJA 4ZHQB 4E6EA 5EYPA 5KX5B 5GONA 3RYIA 4O2AA 4YJ2A 5IYZB 2R751 5BMVB 4X20A 5EZYA 5LP6B 3JARB 3N2GB 4X1IB 4B46A 3HKBB 1RQ7A 4X1YB 5CA0A 4O4LB 4ZHQA 5IJ0B 2VAPA 1JFFB 3JAKB 3UT5A 4F6RA 5JH7A 2R6R1 4TV9A 3RYHB 4ZI7B 3WGNA 3JAWB 3E22B 5C8YB 3WGLA 4DRXA 5JQGA 4EI8A 1FSZA 4EI9A 3JASA 5IYZA 1TUBB 4YJ3A 4XCQA 4M8IA 5EIBD 4U3JA 3VO8A 1FFXA 5CB4B 3RB8A 4EI7A 3N2GA 4IHJA 5LOVA
chains in the Genus database with same CATH superfamily
5AD1A 4LQLA 4H3VA 1ZOPA 1YHNA 4DF3A 3KJJA 2Y4NA 3JQDA 4UAGA 2YDXA 2OV8A 3KXDA 1OLOA 3T34A 2DYSB 2YYYA 2Y05A 1QU2A 5WRFA 4LVNA 4BX3A 3ETJA 4MTGA 4JNCA 4YRLA 4ENQA 1EN5A 3E7DA 2CHTA 4HN2A 3O9MA 1U5CA 2I33A 4A1OA 1QG0A 4JAVC 2WV7A 2WU3A 1IPFA 3JR7A 2FMKA 4Z1OA 4BECA 2VPWA 3ILHA 3OI7A 3H75A 3E1SA 3L72H 2XXBA 3G6WA 1ODJA 1G5HA 2BKLA 5C4GB 4I9NA 3I3FA 4MUHA 3LBNA 1Z8NA 3DDCA 3OECA 1DTOA 3AY3A 1QQTA 4KFCA 5JMPA 2YHIA 2REQB 3WG9A 3BD9A 2QXTA 3I32A 1XZKA 5FPKA 1LLUA 2ZRLA 1R6UA 4N8EA 3BX1A 5C34B 2IYTA 4GMFA 4KP4A 1EM8B 2SBTA 1DHRA 4DA7A 1UK9A 4ISCA 3TXYA 2W42A 1ACJA 3CA8A 5G2OA 1KPHA 2E0IA 4YXWG 4A16A 5BSVA 5KMGA 2YMLA 4RLQA 3SQWA 4F93B 1FYDA 3I64A 3ICQB 4UXJA 1ZN7A 1IPAA 2DBYA 4ZQBA 1OASA 1ND6A 3HG7A 4ZXFA 3BAZA 1ZGCA 1EUYA 1GAQA 1O9HA 4A0SA 4LHSA 5B66Z 5FNZA 3TD4A 1PFGA 1HTWA 2IX3A 4Q16A 2D74A 1JBEA 3CNHA 2CVQA 3H87A 1X3SA 4IMJB 1KP3A 4HH4A 5CT6A 4MW3A 2CVPA 4UUQA 2PEZA 4RSGA 2R5FA 3T5MA 3ZYZA 3KJIA 4R1SA 5C1BA 1DTSA 2G0NA 4JEIA 5JWPA 1KI3A 3SZUA 2WB4A 1XKLA 3WA7A 3HU5A 4NR0A 1XOIA 3R6WA 2EFCB 2OCLA 3G9XA 1E1CA 2HVYD 4RE5A 3KHNA 1U11A 2W2MA 4XGRA 3GRUA 3EGDB 2E9SA 3L4KA 3OQBA 4B32A 1T9CA 3B1ZA 1FTYA 4CEIA 3QLUA 1R74A 4ICIA 4RD0A 4W5RA 3HSKA 3L8HA 2JIOA 1X1EA 3P71T 1Y1SA 4HXGA 3N39C 2CFRA 5H70A 5AO9A 4XFJA 4QU9A 3Q1KA 3SBEA 1VQPF 4FLTA 3CNNA 4NV3A 4B7EA 2HAEA 4C1BA 3GFOA 4NECA 2X19A 2A67A 2JGIA 4LV8B 5AXCA 3O3MB 4ZQHA 5EFZA 3MHSC 1G5RA 4CM5A 5ALTA 2FWRA 1SKYB 3HJUA 5CFQA 1D6MA 3FHLA 1NDUA 3JPYA 4Q1FA 2ZJAA 4AIIA 4ZJYA 3WWEA 3ASNB 5AIAA 2FX3A 2HA0A 3IPXA 1VBMA 3MB5A 3RANA 5LMZA 1PJAA 2XUPA 5SY9A 2DPMA 1E62A 5KHGA 1TM3E 1IEWA 4L78A 4GBED 1XA3A 4E2XA 1UFVA 3RS3A 4G9BA 2QP3A 2XJ4A 4UUJC 1C9NA 4GOND 4DV4B 2GKGA 3NK6A 1XJCA 4NE9A 4LPKA 3V97A 2VPPA 1H3FA 1ZN9A 2P8JA 3RA5A 2FPPA 4IIUA 1SD5A 5PNTA 3NFRA 3PJRA 2I4TA 1PR9A 3I6YA 2FKNA 2YUTA 3E3LA 2N48A 1WMDA 4PSAA 2VH1A 2WVAA 3AG6A 4HS4A 4YAIA 2H4JA 3L04A 3MWKA 5BSUA 1RVDA 2PT6A 3ICXA 1ZWKA 2EL7A 3EZ7A 3OJ0A 4WY2A 1CFJA 1Q3EA 1QGYA 5EHGA 4RY9A 3GRZA 2AV6A 3AUKA 2NU8B 4CLOA 1C3EA 1NP7A 3MNFA 4J0JA 1U4NA 4HWKA 5DI3B 2HC9A 2QUBA 3ZU6A 1E6MA 4Z9XA 3IHLA 4EVQA 3X44A 3O94A 4PPFA 2QLBA 2XAAA 4C7BA 4JB8A 2COEA 2WA2A 5SZKB 1T8UA 1TKBA 2QTMA 4UOQA 4NK4A 1IHXA 1D2NA 3CLRD 4J4BA 4BNZA 3HBLA 2QX9A 4YFYA 1H4SA 4U5QA 1NVGA 4K6OA 5I9BA 4TMXA 3MCQA 2PHNA 1Y42X 1EK6A 3AHJA 3KKOA 1YS7A 4JDUA 3R7AA 1XU7A 3JQRA 2PTMA 1LZKA 2OGUA 1P3DA 4F9GA 3G85A 2AZ2A 3V7YA 2ZI7A 2E55A 2D0DA 3T1YO 4MR8B 1Z2GA 2RARA 3AL2A 4A8TA 5EIWA 3N5CA 1T26A 1MB9A 2VWQA 4O2AA 4HDKB 2OTLV 4R7CA 1KR5A 2D1YA 3ZCVA 1C0IA 2ZJ1A 3IYLW 1S6YA 2O2SA 13PKA 4PYRA 3BJMA 4R5HA 3HUTA 3LDEA 4RXUA 3UV7A 4D9GA 5IT4A 4UCOA 4LJRA 2KPOA 2UUAO 3V46A 2OVBA 1P81A 2W2PA 5CLIA 1IHUA 1T1SA 5HXUA 1CY1A 3U7EB 2O7NA 1XVLA 2QPTA 2IGTA 3DL4A 2JBHA 5L3RA 1FZQA 1USGA 4KPUA 3VC3A 3ENZA 2ZIXA 5D1NA 3V1NA 2OBNA 4CKBA 1HURA 2R62A 4Q05A 1M73E 3NQ41 2J7KA 1LSUA 3GROA 4QJ4A 1X94A 5IAOA 3U9LA 5AI4A 1YAHA 4AN1A 3D6NB 5B2FA 1JDUA 1AQ6A 3H5TA 4D25A 4EUKA 5JSKA 3FCOA 4DARA 3AP2A 1XPOA 5C80A 3VNUA 2F3UA 5A3VA 3FYUC 3T3GA 2FRDA 5IKOA 2ZDQA 4WKNA 5CD9A 5TGTA 4EKEA 2OBFA 3HJCA 1KARA 4CKEB 4R8CA 2ZS9A 3PA8A 1DBQA 3PDIA 1C4XA 3EXG1 3DV0A 1WUYA 3WSTA 3EBPA 2IEAA 1RWVA 3T4UA 3FXAA 3P2JA 1CWUA 1U97A 3Q7RA 4MV0A 2OBXA 1J8YF 4OFZA 2IYZA 3K9WA 3HN6A 5L3EA 1AB5A 1CIJA 4UNPA 3HXOA 4OAOA 4DIUA 4HGPA 3WVNA 3EWSA 1TQ2A 4LJ7A 3QPDA 1C1DB 1KKCA 1IVNA 3ONDA 3PC7A 1Q19A 1WD7A 4ZD6A 2VOJA 4P81A 4OSPA 4NATA 4L7VA 2ZD9A 4MVZA 5JJNB 5BSFA 2OXRA 1YK0A 1CF4A 4ZO4A 1UDAA 5KUTA 3ZZNA 4JI1B 3FZQA 4D6TH 2XH8A 4J0GA 4D98A 1E6CA 3BMXA 3DNPA 1MUUA 5IDJA 1XMXA 2X8JB 1P0MA 2JI6A 4J1TC 4KKVA 5REQB 2ZEJA 2GV9A 1E6LA 2C4UA 2VUTA 2GF9A 2XQVA 1L7PA 1ICEA 5KAPA 3Q4HB 1FXUA 1S4QA 3KSZO 4NJEA 3VKUA 3PQ3A 3N8KA 4QJIA 1O6FA 4C4PA 4QSHA 3TDKA 1K06A 1Q7EA 2W9XA 4GC5A 3SP1A 1SOMA 1YU6A 1UXHA 2HP0B 2FXIA 2C7QA 5ITZA 1XKQA 5JPDA 1A9ZA 3L8ZA 5TDHA 3KLNA 4FFPA 5JCOC 3M6UA 2PRYA 3E5NA 4KQXA 1FFYA 4V2UA 3QEMB 1T6XA 1ID1A 5IC4A 3W5IA 4WSOA 2JJ1A 4L08A 1DVRA 3PNOA 4J9VA 3IJRA 2H17A 2ZWMA 3GRKA 1ISRA 4RA9B 3T12A 5IYZF 2YH2A 1T4DA 3F7OA 2QI9C 3K1TA 1PXWA 3L8GA 5A2GA 4FJCC 5AM0A 5JHGB 3RTBA 4JLVA 1VHLA 1J00A 3BCSA 2VLBA 4JD5A 3K71B 2QUHA 4EBBA 4D3SA 1DQRA 4I55F 4ZCTA 1ZNZA 4EECA 3I61A 1OYVA 4QUIA 4YDRA 4TQGA 3EUWA 4GC9A 1OKKA 5LOVA 3LWQC 3R0XA 9MHTA 3VU3A 3SKYA 2GH1A 1WIWA 5DU2A 3I2JA 3CCRV 4INOA 2LBWA 4DV1O 1Q12A 2GMWA 3BDVA 4AZ3A 2PXHA 3CMAV 2IBSA 2PWBA 4TTAA 4CM7A 2QTNA 3FNHA 2PGOA 4IJQA 1ZBDA 4ER3A 4RU1A 4BGVA 3U3RA 1YNOA 3L41A 4YPOA 1ABBA 2OHOA 3ELUA 2E76B 2XGMA 2HNAA 1SCUB 1RCTE 2WFLB 1Z2AA 1YR2A 3GT3A 3ZW9A 4J9YB 5EMKA 3G5MA 1W44A 4OX9B 2DR3A 1UT5A 1JNYA 1MX3A 1R73A 3Q12A 4GAEA 5FBWB 2WVHA 4O3MA 3DONA 5K6AA 2Q99A 1EQAA 3H3FA 3B8EA 4HBZA 4NMMA 1Z6QA 2JGMA 3Q3IA 2CBXA 4EG6A 5AVUA 5FXMA 1USUA 5K0EA 5CRIA 2VF8A 2IVZA 3RKSA 1W4AA 4PS0A 2YWGA 1CIVA 3NKFA 4NZYA 2UUOA 2P22C 1R4NA 1RSOA 5THKA 4L0CA 2GD2A 4K8ZA 1MW9X 4C8IA 4GWLA 2C29D 1SCJA 2WQ6A 1K6MA 4X7MA 3UFXA 3WRYC 4BKQA 4Z0NA 1AE1A 2VWJA 3GCGA 4KPFC 1QQCA 4BUZA 2LCIA 2VDUE 2AYXA 3SZLA 3VOTA 3H4IA 1N2ZA 2Y76A 5H82A 1M7HA 3AG1B 1R6NA 2ZQMA 3UK7A 1JG3A 4A0HA 3E7WA 2AKEA 1S5LZ 2VAMA 5GTDA 1EFDN 2BM9A 1GGFA 1GA1A 1ZGZA 1ZP6A 2DU8A 1RHJA 3FFQA 1PEDA 2AI1A 3K0FA 1R2QA 3A9RA 3DMRA 4M7PA 2O5CA 2ZJ8A 3OD1A 4WNIA 4R8SA 4QTYA 1ODTC 4ZIRB 3MJFA 4B3TO 2W37A 2WYOA 2XBUA 1EWRA 2VTBA 1L0BA 4RPCA 2IU6A 1A8QA 1QFZA 3AF3A 3OZVA 2FCRA 4ESOA 2YXNA 2QRMA 3CKYA 3O8QA 1QVFF 5JEDA 2QZZA 4D9JA 2C95A 1EJ2A 1J07A 1ZZEA 1FBTA 3I01M 2XUMA 3IAM1 2WB2A 1US8B 3H84A 4JFRA 3AERB 2KKWA 5EJFA 1VLJA 3E3OA 3TZ6A 1WHSB 1WB6A 2BFNA 2CZCA 3KZVA 4OBXA 1VIDA 4MKGA 3PS9A 5AIBA 1F3LA 1UZAA 3Q3CA 2BFBA 1ND5A 1OCZC 3RC1A 4QNHB 1R3LC 2P6PA 2YWHA 3BMNA 3UV3A 1BQEA 3EQ8A 3CZAA 2F55A 1I30A 2XWQA 2QSZA 4Q1DA 1SZJG 3TTWA 1LSOA 1QFYA 1GEGA 3CTPA 1DK1A 4MW1A 1DARA 5TEWA 1TJNA 1YZHA 3MT9A 5DHPA 1F4NA 3M81A 1UIMA 2TSYB 3WGYA 5HCIA 3ZKWA 2IBZH 4O4JB 3T7RA 3HKDB 2FN3A 1T9GS 4QWWA 2JS7A 1SBCA 3EWAA 1XDGA 4LHZA 3LLSA 5ALDA 2JLAA 1X1SA 4WOBA 2WABA 1Q0UA 4MA5A 3K31A 1XA4A 1GN9A 5F3RA 1J20A 4BY9D 4EWLA 5MFPA 1KQSF 1SPBS 3EMVA 1G16A 1R4ZA 1NS1A 1S2NA 3MPOA 1TCUA 2JVKA 2NU6A 2OVFA 4PSUA 3I9NA 1N8RH 2PYDA 2AMYA 2WTXA 3FDIA 3OEED 1LY1A 5CBGA 4HQNA 1J0CA 3WRXC 2RIRA 4PPQA 3CCLF 2WNIA 4Q48A 3PFIA 5KS2A 3P4YA 3QUCA 3RW0A 2CD9A 3D4PA 2BDTA 1O8CA 5BRJA 1UDCA 4B09A 2L0XA 2YJ6A 2OCCC 4GG1A 2EZ8A 3V1LA 1P7CA 2Y92A 5BQXA 4JB2A 4N3CA 5JD6A 1O3YA 2REBA 3DWGA 1XMVA 3FNFA 3TVTA 4E94A 3IMEA 1GUYA 4TPKA 3ASOB 1Q5OA 3NHRA 5AKIA 3OP4A 4WNCA 5EJMA 3C90A 3H6HA 4AJOA 5K8IA 5CVVA 3W7VA 2V0NA 5AH0A 3RSOA 2BMAA 3FH0A 1AV7A 2PL3A 3S3XA 3A1CA 2XKBA 4WXHA 1RKBA 2Q4EA 4UU1A 1I14A 3AY7A 3QTYA 2I76A 1DIAA 3IAUA 5E7JA 1GN2A 3AUTA 1ZMTA 2WU4A 4U2KA 4AIRA 1P2TA 1PRYA 2EC5A 5ESXA 5IC5A 1M83A 1GKIA 3I0NA 2QP9X 4PN7A 3IKFA 4LS3A 3ZDYB 2JRIA 3SR3A 1K73W 2NNWB 1UEXC 4C07A 4TTRA 4RV9A 5JJLA 3ZWKA 2QVZX 3LLCA 2R3SA 4BEWA 1ESNA 3IDOA 2IJKA 2A9KA 1YZNA 3R3WA 4ARIA 3ZTTA 4RY0A 4P84A 4ZYYA 3NC4A 1NMQA 4MQLA 4BQPA 1W57A 5AW2A 2YFQA 1DAIA 2R6HA 2A9RA 5B1DA 4IFTA 3BF7A 1NVAA 4TQAA 4M1YA 4LF9O 4CLEA 3F78A 1J6UA 1UBUS 2DHCA 8ABPA 3O4HA 1V1JA 5C35A 1IFXA 1NJSA 4V1CI 4E5SA 4YO8A 1SWVA 5DGHA 4TX1A 3LT0A 3IDZA 2QTWB 1EHIA 5C51B 4JGIA 4JF3A 4REOA 3ABIA 3AMVA 3NKVA 3MEQA 1CUEA 4DV6B 3BQMB 1YKGA 4DA8A 3D36C 1G98A 2CHUA 1PJCA 5JS7A 2H63A 4MX8A 1CQIA 3HBFA 3P9NA 3QJYA 2DZDA 2ORWA 1XDWA 2XNDG 1BN6A 1Q81W 4DQUA 2R2AA 5KIAA 3N5KA 3GUZA 3IP7A 4BBPA 3F8WA 1FSZA 2PY5A 3ETQA 3ZS9A 3G0DA 1Q3HA 3PKJA 2GN8A 1E79G 3DDNA 1U3TA 3QF4B 3VSDA 2ZB4A 1Y74B 3QI7A 3EPHA 4JLNA 1BDMA 2ZTVA 2QVLA 4AJ2A 4FLEA 4WGFA 3U37A 1BE0A 1N6HA 1FDUA 3HJNA 2Z5GA 4XVQA 1Q77A 3NWPA 3W78A 4QFCA 4BATA 2EBUA 2KWIA 2OENG 4ZZ0A 1NDHA 4E5MA 4OHXA 4DWVA 3TD6A 1F1BA 1E1RG 1HYQA 3FLMA 5KEIA 2B9ZA 4UDNA 4JT2A 2IAFA 1QC5B 1IU9A 3J7TA 3QUQA 2YC4C 3CCSV 4O1HA 1X7WB 2AHZA 1NRWA 3S1AA 4OPMA 4JGSA 3KJKA 3COJA 1G3MA 2PLNA 2I6RA 5ECGC 1DL5A 2CCGA 3ZGOA 2I8AA 3G79A 3Q5EA 1E7QA 4RK4A 1VPEA 2BFCB 4KNYA 2ZSKA 1PNRA 2UUPA 3WBFA 3G4SF 4DZRA 4UU7A 3SYPA 1YJ8A 5JZ9A 2B36A 3LVRE 1JYSA 4HQOA 5EMHA 2O8CA 4R05A 3ZEDA 3FKSA 1KJ8A 2VK2A 1H22A 4KITB 4NEGA 2RD2A 2JIQA 4WXMA 4TUYB 4L4ZA 5K3FA 2GJKA 1QVRA 3W6ZA 4DV3O 1JBKA 1VL1A 2PSDA 1KWGA 1BA2A 2VL7A 4LNHA 2G76A 2O57A 2FZ4A 1JVSA 3ZWYA 4JQCA 3LUDA 4M22A 5C4MA 3IO5A 3TXSA 3LMEA 1A27A 3IEIA 1NU1H 2XNCA 1KYTA 1CSEE 1U9JA 2QJFA 3HRHA 3RS4A 4WKCA 3AX6A 4P2ZA 2W6ID 4PA6A 1IXYA 2XT6A 1RKXA 1JPJA 1BMTA 4WN9A 3NNDA 3PRYA 1U40A 2ZATA 1N2JA 2D1FA 3B3JA 4BTVA 3H1GA 3RTAA 1KP2A 5DP1A 5EAIA 5IARA 5F2NA 5JWOA 3WGTA 4X5OA 1EH5A 3ZTWA 1H65A 5I8PA 5H80A 5EE1A 1M0SA 5JH7F 3NDBB 2R6DA 4Z4IA 4DR3O 1SBHA 2RGCA 5JZOA 2ZT9B 3LZ6A 3K6RA 5C8YA 2JLVA 3O83A 1T13A 1N7HA 1QX3A 1XD9A 1JPXA 2OM2A 2XKJE 3ZGNA 1KUQA 4ZDWA 4CG2A 5FOVA 4G9GA 1NLZA 3A6FA 5A4DA 4Q7JB 4ER0A 3IAHA 2E4ZA 2EULA 1ODKA 3R20A 4QT4A 3BXZA 3PICA 2E5WA 3HKCB 4CF7A 5TARA 2I91A 5JC1A 1R3DA 1YDMA 1GPNA 3ZRXA 1G20E 1IN5A 1K5HA 1AMUA 1RHKA 2PX5A 3FOFC 5BWBA 3RRJA 1HYBA 1DKRA 4H1UA 3A05A 2JHFA 3KR0A 4K5QA 2O1EA 4M99A 1K3UB 1TKRA 1XMQO 4ND2A 2W98A 2LWIA 4BLOA 2JGLA 3N7TA 4TTJA 2CKDA 1NBOA 1N2CE 1N33O 3PJSK 3EPLA 2JLBA 1GWNA 2QB5A 3FA2A 3JAMA 5NULA 2GK6A 4WOPA 4IUBS 3S0YA 5E1OA 3HR8A 4N6OA 1E3IA 1FY2A 5KNCD 4E4YA 3X2QB 2WIKA 4MUAA 2PKCA 4NE7A 3T9BA 4X65B 3WQHA 5E1MA 2QQEA 4LY3A 2HWKA 2NUBA 5A0VA 5BN5A 5FQNA 4RABA 1X7ZB 2ALJA 2YI9A 1X59A 1HG0A 3CBQA 4DCGA 1J33A 1H9CA 3H0CA 3FB4A 3UN1A 1H0HA 4FUQA 4Z7NB 3VAZA 3OVMA 1X52A 4C9BA 1IMOA 4D81A 1UFIA 4ZYLA 1H6BA 2ACVA 1CCWA 3CLSD 5A7FA 4RGVA 5DYYA 3LD9A 5IAAA 4YUXA 2CTRA 5F1YA 1SVKA 2GYWA 2P6YA 2IPLA 3I1YA 1ORRA 1N6PA 3BMQA 4QHTA 3KD3A 1HR0B 4NBTA 2ZSEA 1JWLA 1H2XA 1PLLA 4RFLA 2R11A 5FWXB 1DCFA 1AT1A 2JFHA 1CDDA 3WYCA 2ZE6A 3W04A 4QDZA 1W7AA 1W41A 2FR8C 1JJAA 1NQAO 2TMGA 3L2OB 2UU9B 4LISA 2KW5A 4TS3A 1V48A 4MUBA 2K7ZA 3M5DA 1AKMA 3KBBA 3RFRA 5L3QB 3CLRC 3NORA 3R24A 4IQFA 3E05A 1W87A 1J7JA 4TT8A 5BYJA 4AK9A 5KYXB 1IE3A 3SYTA 1CY2A 5AW8A 1GUZA 4RSRA 3RE1A 3C3WA 2EERA 5E4JA 2WALA 1VQ6V 1L3IA 1QO7A 2P6MA 2GF0A 4U6QA 4HLDA 1F8YA 2EWVA 3EA5A 3I5MA 4LFBO 3SZRA 1IK4A 1NTRA 3RWBA 2PJDA 4F5WA 5EIOA 2FWPA 5LU8A 3T52A 3CCQF 5IZCC 3QKSB 4ZHSA 1VG9B 2XIJA 3OESA 3RK4A 2RGNC 4IH4A 3TI7A 2AFHE 1VKNA 3SJCC 1ORIA 2HK8A 1CUDA 1AI4A 3FHJA 4C6SA 2Q2WA 2VRZA 1L4YA 4AP9A 5I7WA 2Q1XA 4TWJA 4YUZA 1NL3A 1PGPA 3C3KA 2BMJA 5A5FA 2QAGC 4AZSA 4PQEA 2Z01A 5E6UA 2WUDA 3VQVA 1YEWA 4L16A 3W9BA 1XTRA 2VHXA 4XW2A 3K2EA 3KPYA 2JNWA 3TWOA 4ZHQA 1A9RA 3SF8A 1MC4A 2GAAA 5DPMA 5GY7A 4KDRA 2RI6A 5HMMA 1A8IA 1LRJA 3WGOA 1U2QA 1I7LA 4RJTA 1KQFA 3FYIB 2BJHA 3D6UA 4QPDA 4O4HB 3F2VA 1NT2B 2C99A 3OURA 2CGEA 3Q2KA 3ZHRA 4I9GA 2A79B 4IIJB 2NZXA 2VFAA 4L1KA 1H2EA 4YUWA 2BEKA 2J3QA 1S02A 1W30A 1HM5A 5B3LA 2VJMA 1J8MF 2ESRA 2ONKA 1NR7A 2PY6A 2AOTA 5B3SB 3T1TA 3GGGA 4HN4B 1CEEA 3KELA 3DOHA 1W4CA 4CHGA 4DIOA 3T3IA 2CFIA 1IBMO 2NNLD 1TTTA 1NT4A 1AN9A 5KTRA 4DCVA 2IH2A 2H5LA 5B6JA 1T9GR 2VIIA 5G0WA 1UAGA 1NPTO 1F4MA 1C7IA 2PMFA 3LT2A 4NSNA 5I8ZA 2GO7A 3LX5A 1J5EB 1Q0TA 2A5LA 2J07A 5BVGA 5JJ5A 1ATIA 3KVRA 1JA0A 4HNTA 1T6ZA 4CE6A 4J2TA 5FORA 4AJ4A 2I8LA 3CCJV 2BTEA 1JBQA 4PO8A 4Y6OA 3JQ6A 2GCIA 1A4IA 3BHNA 4RC9A 3UOGA 5EQJB 4X84A 3C6KA 1M10A 2N04A 3E15A 1NWHA 4G63A 3VDRA 4G4SP 1P3Y1 2AG6A 4M7OA 3K9NA 2BHLA 2Y4OA 3AUJB 4H1HA 3GLUA 4PGHA 1N4CA 4RK0A 3GB7C 1TO6A 5GZ3A 3N2NA 3BIFA 3STLC 2NSHA 2NO6A 4OGFA 4K9KA 1YE3A 1JA1A 2X7JA 3KVVA 3QVGB 1A7JA 4ID9A 4ZJUA 1ENVA 3W8FA 1QR2A 2LKDA 1L5YA 4NDAA 3TIVA 1Y1PA 1L7RA 4FX2A 5KX5B 1U3PA 1J99A 4MA4A 4FLMA 1URPA 4MYSA 2NSJA 1AVMA 4ZQIA 3PXGA 4R1OA 1CJVC 5TMPA 1VDMA 5D5PA 2JFNA 2IJHA 5FBQB 2AN9A 6REQB 4B4DA 2G4VA 3NR7A 3L6DA 4IEIA 2XZLA 4IIXA 3TO5A 1KIFA 2EW1A 2XUDA 1DFGA 3RS8A 3KJXA 4JT9A 1Z4LA 5FUVA 2YHSA 4OB7A 2WDPA 5ICEA 2Q4BA 4OXQA 4RTOA 2REQA 2ZR9A 5H81A 3SFVA 2Z8ZA 1EN4A 5K99A 2XE4A 1E2JA 3ES9A 4NH4A 3SNKA 3E8BA 1EM8A 4CCSA 3HVJA 1WPGA 3S5UA 2DBZA 2Q4DA 2O3QA 4CM8B 4PXSA 4O3FA 1ODFA 3SF0A 3GZJA 3T1CA 1WQ3A 2JATA 4KN8A 1ZW6A 4FYWA 1NUHA 4B3BA 2VDWB 5JRJA 3CLTC 2QP4A 3LO5A 2ZB7A 1L7OA 3ZOZA 3PCXA 1E5DA 1NV9A 2P27A 3NWOA 1JG2A 1RHRA 2MSKA 2GHTA 1OHHA 4EI9A 2QR2A 2XZDA 4PNHA 2FUKA 4DZZA 4UBJA 3MJ4A 4ADSG 2QBYB 1QX4A 3VV2A 4Z2YA 4X0EA 8ADHA 5ALPA 3QIVA 3VPDA 2C5FA 4IDQA 5B6PA 4YHBA 3WLIA 1UODA 7REQB 2OP0A 4C2TA 4MHOA 1VQOV 3OP1A 2BGUA 3CYOA 3O8OB 1LLDA 1C4KA 3KIPA 4U7OA 2HYIC 3CYFA 1TOAA 3MS4A 4PONA 1RM0A 4UMDA 2AR0A 4XD2A 1L4EA 4AI8A 3QY9A 5KBYA 4F45A 3M5PA 3TQRA 5J47A 2EX0A 2ZIOA 3EGDA 3K58A 1HDIA 2JIZA 2Y1CA 1Y9DA 1W42A 2PMBA 2BTQB 4UCWA 2C3MA 3L4JA 3I34X 4LKRA 2PUCA 3P2IA 5DTQA 3AIIA 4B40A 4G37A 1IJFA 2FFQA 2P1ZA 2FC3A 5JADA 2F93B 2PAAA 1WMAA 2ADFA 3D3WB 1T10A 2Y1OA 5DZSA 5LDGA 3WOHA 2DBQA 5C7YA 3VR5D 1RQGA 3U3XA 4XVRA 1HL3A 3K96A 1V55C 5B2EA 1NM5C 2WSLA 4F5DA 1BSMA 1E99A 3F73A 1ODCA 1C0KA 1E92A 3OUZA 2Z5VA 1M0TA 3CD6F 2ZPTX 2W7TA 1SQPH 4BIMA 3RFTA 1P18A 5DYTA 4PGMA 2W4MA 1Z63A 2HG5C 4YCNA 3MDSA 4DY4A 1G63A 4KXQA 4IGAA 3O73A 2O7RA 4ISBA 4RTPA 2O3JA 2DYRB 1PJQA 2V7BA 4MUMA 2EILB 3UBMA 3TDNA 3P9SA 4W6QA 1DO2A 1MA3A 1JU3A 3DMFA 3QTCA 1N4DA 2H1IA 3GLFB 5FLEX 2DGDA 1SCAA 3V4OA 2YRWA 3H9BA 3STWA 2CNNA 4CL2A 4MSUA 4M88A 4B6PA 1XEAA 1A8SA 1OXSC 4XYBA 2AT1A 3GDOA 1ISJA 2QAIA 3MWGA 1KRXA 4FPPA 4LCUC 4MVMA 2NU8A 3KNZA 1Y80A 5DI3A 2EZUA 1FUYB 4HWTA 4Q9IA 3Q5GA 4HB0A 1L8AA 2CDAA 4HVLA 5K4GA 1Z34A 2R7NA 1ZVKA 3LSSA 1WCYA 4FLUA 4IL6Z 1VTKA 1Q7GA 2JJYA 4A5SA 4F2GA 4TSFG 1OD6A 5IU6A 4UD6A 1DCKA 3VU1A 1EZZA 2DQ0A 2ZIFA 4P3NA 3GWGA 4JLJA 1AUQA 3IXQA 3R6TA 3PEEA 4M0KA 3ODPA 4GNKA 2BD0A 2O0JA 2O2ZA 3BE8A 3ICVA 3OGCC 3IQEA 2GYVA 3HTXA 2YTZA 5GAJA 5MGBA 3RG2A 4LF5O 1PK8A 4HZUB 3D6HA 1TJ3A 2XUGA 3PEFA 3EFEA 4MR8A 4EITA 1HKUA 2D8MA 2B4TO 3HWX1 1QNMA 1QVVA 2QYOA 4V1CA 1QR9A 4TKUB 1U0HC 3MJEA 2DPLA 3AG4C 3FCSB 2QPLA 3L5KA 2SKDA 3DOEA 1WMEA 3OTWA 3DDHA 1ZK2A 2I29A 4J1NA 4Q1BA 4PQRA 3IXLA 4XR9A 4HFJA 5EUBA 2ZUVA 2QGZA 5TT1A 3BL5A 3BS4A 2YCBA 3UIEA 4GL2A 2L69A 1ZUD1 2COUA 1YQXA 2Y48A 2COKA 3EGWA 5L7YA 1QF9A 4BUJA 3IUPA 4QXMA 1XHEA 3BZWA 4LF6O 3FZEA 4FOOA 3DO6A 4JR0A 1ZG3A 2PVSA 4LV5B 3JQ7B 4D0LB 1VQ4F 3ZJ4A 1IY1A 1KZ4A 1DTEA 1ONOA 5EBLC 1UM9A 4Z1VA 4KQKA 3GEHA 5JDCC 3ZD9A 1E3WB 4OEHA 1SUAA 4MRRA 3NIGB 1J1IA 3ZHCA 4LHXA 5EIEA 1WSAA 4HGYA 5F3DA 2PL1A 2ZS8A 4MR7B 3QFHA 4NFHA 1CTQA 2PH1A 4J3JA 2WPDA 3W1WA 1UOPA 1ECGA 3ZE1B 1X7GA 2Y71A 1QS0B 3DKVA 4ZOAA 4WZBE 2C82A 4CKEA 4PGAA 4RH1A 1CLUA 4NLLA 1CEXA 3IKTA 1Q16A 3EAQA 1DRVA 2AH5A 4ZJPA 4LOHA 1QRSA 3CMEF 5JTUA 1SXIA 1UPXA 2LP4Y 3K70B 4QZVA 4M8KA 5CK4A 4BO7A 3RVJA 4PLTA 4Q3EA 2SHKA 3UB4A 3PC6A 3LWNA 5ISMA 3KOUA 1C1DA 5IEBA 3KDAA 1UJ5A 2PXCA 2PT5A 4UOEA 1DELA 3G67A 3U17A 1HZZA 1T1JA 1HUQA 3M3DA 4H1WA 1T6YA 3QWAA 4KCGA 2FTKE 3CF4G 1L5ZA 4IMPA 4LGYA 4A5UB 1V8BA 5FBVB 2IJIA 3WADA 3K0DA 1U3LA 1V8DA 2X8JA 2VHJA 3IX7A 4XB1A 2G9QA 5REQA 5J3JA 5FR1A 3ICWA 4DAEA 1OXXK 3Q4HA 2ZJFA 4IJUA 4DCSA 4Q82A 1F48A 1JT9A 4QFBA 1E9BA 2PS3A 3KBOA 1T35A 5B4VA 1BU8A 5IT0A 1Z0ZA 3WISA 2HP0A 5HP4A 2I3GA 4YMHA 3JD0A 4MCAA 4O4LF 3WNZA 1ZPDA 1UJNA 3ZK9A 3TYXA 4B7AA 5FL7D 3QEMA 5IFKA 3AM3A 3C3JA 4Q5IA 2LBPA 4MW8A 5AVOA 3L1IA 5DBEX 1U0GA 1PS0A 1GGVA 1G3UA 3K05A 2Q5ZA 3U1TA 1NXWA 4TLAA 2J3IA 4J9UE 3NR2A 4ZA2A 3JAMM 2ZKOA 2IG8A 3UPTA 4MW2A 1Q86W 5K3DA 4E32A 3OEWA 3NHZA 1DAEA 3GCDA 3HYNA 1YD7A 1RXUA 1PSWA 1Y3DE 3IIEA 5KNBA 2Q50A 2IBMA 3A6LA 1QOPB 5K8LA 2JEXA 3LQ1A 4K9NA 1MW8X 4NZOA 2P3LA 2ZUFA 3FHOA 4IGGA 4HR7A 4XARA 3Q0EA 1ZK4A 3UPDA 3SJZA 5DGXA 3KK0A 1E2EA 3M4ZA 3KVNA 1C4OA 3JQBA 4PYOA 3P26A 4IF6A 3OA2A 5TEVA 2VXBA 3Q3JB 3LSTA 3QLTA 1HNWB 1FSSA 2FCAA 1Q0HA 5AR1A 3RSLA 4MPJA 4X94A 3L93A 1RPZA 4C08A 2PSHA 2P4QA 2WFLA 3O5AA 3L7AA 3T2MA 4RVNA 4PA9A 2EJRA 4E03A 3DTNA 1NIJA 1WLYA 5DX0A 4CHTA 4Z9YA 1MTZA 1K3TA 5E3JA 4HAWA 4ZYTA 1RTTA 1M5UA 4ENSA 3V4VB 4NKGB 3HHPA 3OTOB 4B5LA 2HX0A 2FYTA 5JUWA 4C03A 4LJ5A 4EFMA 1UJ6A 4WNAB 3DSRA 2GN6A 1PVVA 4I1PA 3F2IA 4AQYB 5FLXN 3DEYX 1U9IC 1YIAA 1YWGO 3LUFA 3ESRA 3RVPA 2CL7X 1VJ5A 4I4IA 5EN4A 4Q7MB 1N32B 1YDHA 2WI8A 1XEQA 4Q21A 1LB1B 4C5AA 3J80N 3AG7A 8GPBA 3R3ZA 1E0AA 4EHAA 1JIKA 1SQXH 4N5NA 1JXOA 4ZKIA 4K6MA 2ZAOA 4DUGA 4HG2A 3QPVA 4E21A 3RAEC 1KNXA 3E23A 2HMSA 3FOZA 3SIXA 1KI6B 3ZMUA 3M2PA 1GDDA 2C7VA 1VJDA 4PDVA 2QMHA 2OT3B 4QL3A 4DT1B 5FULA 1NLMA 4AX4A 4D4JA 4UFNA 2R65A 2ZKLA 3D4NA 5DM6V 4ZOLF 4ZIRA 4JV5B 1I6KA 1SBTA 3QA9A 1DKUA 1LLCA 5FOSA 1GVHA 5FBZA 3HMKA 2OXFA 5DXFA 4OH7A 2Z58A 2IEZA 2QTAA 4KBYA 3P2MA 4H9GA 4JJKA 1TVCA 1I6LA 4JI5B 2KTUA 1HY3A 2HF9A 4ROSA 3OX3A 1SUPA 3RU7A 4D4LA 3H7AA 4BZZA 3TGPA 3LQRA 1US8A 1DAGA 1ODIA 2B4KA 1KVQA 2ZYGA 2C2OA 3AERA 2GR9A 5LQKA 1QQAA 1U2RA 4DSTA 3W4IA 3N76A 3G9ZA 3ANTA 3DMPA 5B12A 1V7CA 5LB4A 4CCWA 4E2FA 3EEOA 3LX8A 4H15A 4B0PA 2HIAA 3I56V 4NXMO 2XIQA 1MEEA 3BIJA 3WFVA 4FOSA 2GNOA 2JH3A 5K0BA 1OWLA 2CMHA 2P9HA 1V6CA 3IEKA 3CRAA 3ZX5A 3CLSC 2ZAUA 2G04A 5FA6A 3KUDA 2IH4A 3WLFA 3TIFA 3TRKA 1Z5NA 3KWMA 1FUIA 3UCSC 2DH6A 3OBWA 2YX1A 1S2MA 4WFFA 1VQMV 4O4JA 2QEXV 3HKDA 4G4WA 3AR9A 1GG5A 5L7TA 3P30A 3OLCX 3I5XA 3S99A 1E1KA 3PKIA 4D9EA 5DTIA 1G64A 1WA8B 1U3UA 1AQUA 3QVTA 5AM1A 4TZ6A 2DT4A 4BR6A 4CH3A 2V6JA 2PHZA 1YIJF 4R54A 2C07A 1FQOA 5T4FA 1NXVA 2EATA 3FTDA 1XVIA 1N0UA 1JCHA 4U6SA 3H9CA 2NZVG 2FOXA 1E3SA 3A4LA 5E7QA 5LUBA 3QV1A 4BVRA 5K3SA 2XAJA 3LCJA 1R5OA 3PFFA 2I4RA 1WDKA 3K15A 4DJFC 4BY9E 1MGPA 1D0VA 1RMQA 6PFKA 4BCCA 3OF5A 3JRNA 4ZCMA 5BQ5A 4LJYA 4Z2AA 3OO0A 2FK7A 4PGFA 1XO1A 3OIUA 2KJQA 2VQ3A 5IDVA 1ULAA 3WB9A 4NWOB 1ISIA 1PIWA 4F2DA 1E3QA 5EIFA 1YTUA 4WERA 5IFLA 4LTMA 1NR5A 1XKTA 3W3AH 2J0UA 4CMJA 2ZPAA 1N34B 2GSDA 2VYNA 2BLNA 2PYZA 2IHKA 4RANA 1U9CA 4YQEA 4PU0A 5K3EA 1JRLA 4XFDA 3WO1A 4QGHA 5DNDA 3KQHA 2HN9A 5LNK1 4PA4A 4DQDA 5CNMA 1I1QB 4OQ4A 3V2UA 4OJNA 4DDVA 4X66B 4RCZA 1EE2A 2G8NA 4CQMB 4F2HA 2JFUA 1WTAA 1LVHA 3M89A 5KSZA 2YZ2A 2BGRA 3QEJA 5CIWA 4LOIA 3O82A 1NBAA 3WLRA 1GVNB 3BABA 1QQ5A 1S8OA 5JZBA 3DTVD 4F4LA 4AKIA 3HBNA 3K14A 4Z5XA 2I54A 4HKTA 2KG4A 2H2DA 3TDMA 4KMRA 1R9NA 4FYJA 4EF6A 4A27A 1ZM2A 4ENTA 1NAIA 2WW8A 2H1VA 4DCTA 3D5EA 3UKJA 1LEHA 4CEJB 1FF9A 1TO2E 2EWCA 3PXXA 3WKBA 1UJCA 1PHPA 3CX6A 1B0UA 2IP1A 3P4EA 1V8ZA 2QE7G 1CHNA 1ZOSA 1CQZA 3OX1A 1WZCA 3OMXA 4WGGA 3PNMA 1ZI6A 1CZLA 1W5EA 6CHYA 4QNMA 4Q7LA 1YITF 4CFSA 5KQLA 4F72A 1B16A 5DM2A 3QE9Y 4RELA 4H4DA 3JYLA 4Z1MA 1V4NA 1K92A 3QPCA 3SPHA 2RAVA 5AUNB 1QFXA 4R0MA 5EJ4A 5AHOA 3L92A 1XCBA 1NYRA 4PS1A 1G5QA 3B6ZA 1MOZA 1FLNA 1C9KA 3QF4A 1O4VA 1R6XA 4FCVA 2PJRA 3LYHA 1Y74A 4IMRA 1GQQA 3ITEA 2XF2A 1XD8A 2C5HA 3AUXA 3JSAA 5IDQA 3CNOA 1SXJB 3DQPA 1TPYA 3FMOB 3BFJA 1T8SA 2IEBA 4WFGA 4OGLA 1BMDA 1T5TA 3W7SA 2CYAA 3AOGA 3P9IA 3SIUA 2M7WA 1WR8A 1KBOA 4RK6A 1YJWV 3BMCA 3B6EA 2B9VA 2FP3A 2GN1A 3AESA 4P1ZA 1QC5A 3FPLA 3BD7A 3H9VA 3VR4H 4KXRA 1JIVA 1X7WA 4F86A 4NAUA 1FS0G 1X74A 1BVYF 2Q9CA 2H2AA 2N47A 4LDPA 4JQYA 4MTFA 1FRFS 3OU7A 1FLVA 4ILEA 4OLJA 3HWUA 1IN7A 3FE2A 3MSXA 5CJ2A 1JDSA 2BFCA 1GUAA 4FPXA 3PV0A 1WCXA 4D8XA 2JJ2D 1W49A 1P61B 5J1SB 4Z4FA 1RMYA 1Z6XA 4Q0MA 3PUVA 1X9IA 1JZQA 4XFKA 5A02A 1K5PA 1XTKA 3R65A 3OZFA 3L1KA 3C3PA 3N2GB 1XZHA 1Y6XA 4R1LA 1T1EA 1C7ZA 3ROGA 1ULZA 1U94A 3P3NA 3OT7A 2H5JA 4AKEA 5DWQA 2HFKA 4BQEA 2LPMA 1OF1A 4TOIA 4MS3B 4LJ6A 4GOLD 4LI0A 1G7TA 3SYQA 1Q6YA 1N3BA 1GKFA 3PQ6A 3BXHA 2D7JA 5CFLA 3WKDA 1FTWA 4RVGA 2VTKA 4AKTA 2FPMA 3PF9A 4N5IX 4HV4A 1MX9A 1VBKA 4I36A 1GZ3A 1Z75A 2OO7A 3TD2A 2Z3ZA 2C0CA 3EFFK 4CUKA 2ECFA 3GLGE 3V3TA 4JR1A 1NQ5A 2HLDG 1ENOA 4H59A 2VRBA 3HV2A 1TTHA 1QYCA 1T5DX 3GV0A 5K0FA 4FMBB 1YHQV 5LP6B 1AHNA 1H66A 3T7EA 4CDNA 3CE6A 3THXB 1AGRA 3GMDA 1JALA 3VHQA 1KK0A 2QDKA 4FGJA 3FOBA 1M8KA 1Z5PA 1CZUA 1DE0A 3GDHA 3HKCA 2XQJA 3PIIA 1K5QA 1HNXO 3T5BA 4OYRA 3KT0A 5BRNA 1VE7A 4TZZA 3TR5A 1B7GO 1EDOA 2UXBO 2FXVA 2RKBA 1WMFA 3EW7A 1BEEA 3RHZA 3ABKC 1OZHA 4QE3A 2WINI 3QHQA 3L84A 1X13A 2AJDA 2XTJA 2XCOA 2FKXA 2A1UB 1W1UA 2DYKA 3OHMA 2C92A 2LXNA 1JHXA 1Z0UA 2Y0DA 3CBGA 3VPXA 3KAJA 3G71V 4DK1A 4V03A 2HGSA 4F3RA 3E86A 2E82A 3UW3A 1CJUC 1TJ4A 4PCUA 4QTZA 3ABOB 4RAIA 3ZD7A 4FNOA 3JTMA 2X7RB 3TNJA 1YZLA 4O2BF 4YWJA 5C37A 3GVHA 1X7ZA 3ELBA 4FYHA 3RJZA 3RK0A 1U6IA 2QN8A 4JQSA 1VIAA 4C04A 4DQ0A 3P5BA 1VMKA 4LBYA 3FSGA 5SV2A 1GN4A 5LQAA 2P9BA 3B3GA 3IVGA 4JA0A 4TSRA 2ZIUB 5LMNO 3HDTA 2CE4A 3EISA 3OFVA 3A6JA 1XMSA 2PMKA 2FGYA 1GL6A 2I71A 4MPDA 2PGJA 2GOYA 4V0SA 4BNXA 3QJ5A 3DW3X 5DVZA 4N23A 4HMPA 3IH5A 2W6JD 2OESA 1VP7A 1RZRD 3BKXA 1NIPA 3VZSA 2YWDA 5I8WA 3BGVA 4HS9A 3WK8A 3I83A 3VVCA 2KBEA 5FWXA 2ZSIA 5IVHA 4X3CA 3CB4A 3RR2A 2CKMA 3TTYA 4F7DA 4EAQA 2AVNA 1C0EA 4D8UA 4D0SA 2F4VO 3H1TA 4K9SA 5G1PA 5EXTA 1QHTA 5L3QA 4I50B 4OKSA 2FN9A 1NVUQ 4ZK7A 3FGOA 1CB0A 5KYXA 2OHWA 2OCBA 1U0JA 2UYNB 5DX8A 4TWKA 3QX3A 3N8GA 2ZOVA 2IPNA 1W5AA 3CZPA 4QJBA 3BSSA 5JSZB 4JLPA 4GGOA 1DX4A 2FX2A 1ROPA 3LA8A 3C16C 2IS4A 2HLPA 2QW8A 1NW5A 4LJKA 4X6XA 5JNSA 1KZYC 2B34A 1Y6ZA 4G56A 5HS6A 1SZQA 1KWKA 3QKSA 1X1AA 1P4RA 1ENZA 1A72A 4AL4A 1IK6A 2QZ9A 4AQDA 4AFNA 4YRBA 5JVDF 4EW6A 3HWSA 4MYCA 1T2CA 3LUAA 2ECPA 2YVLA 4LJSA 2MSLA 2C20A 1JPVA 4RAQA 1F5NA 2IZ1A 3PPXA 2H8PC 4P54A 2OFPA 1NYLA 1XNHA 5T41A 2YQ5A 2QXYA 5ALIA 4FILA 3ZD6A 1PYDA 2VJLA 3ETEA 3P0FA 3WAJA 4M0FA 2P6NA 3B1YA 2VOEA 4OHFA 1DO0A 2FUCA 3KPJA 1P2GA 4XDZA 4MVJG 3L7LA 4OXSA 1JHYA 3V3KA 1RWWA 5JY6A 3ETGA 2EYUA 4PA3A 2YDYA 1FNKA 3P9ZA 3C9RA 3A7DA 5BUSA 5BW5A 4OU5A 2VNJA 2ZCUA 4RZUA 4HP8A 2NTNA 5GOZA 4O4HA 1NT2A 4P7BA 4N47A 3VC1A 4GH5A 1U2PA 4LZAA 4IIJA 3ZDDA 4TYNA 1D8TA 3T1HO 4J0HA 1MAAA 5FTKA 2RAPA 4P7GA 5DYNA 3LWZA 4PSKA 4HZIA 4JASB 1K7YA 1GDHA 3DVSX 3KS9A 4JLSA 2HSEA 4L4UA 4R68A 4FMTA 2V9PA 4O4IF 1NH2D 4PLCA 1XLTA 4IO1A 3S8MA 4YCAA 3UG6A 1LBQA 2I55A 1VK3A 1P91A 1V5EA 3KEFA 2FMFA 2OB1A 2CGNA 3R5JA 5EK0A 1KYOF 4NZPA 3WL5A 2I1VB 3DG9A 3LECA 3DAOA 4UNIA 3G2OA 2P90A 2CXRA 3I2YX 4PEVA 5KTOA 3EQ7A 2ASEA 1R3UA 4EUEA 3L8CA 1WOYA 1OCCC 3UAWA 4YP0A 2W6NA 4UVDA 2GBOA 3RSGA 3TR6A 3UW1A 3R5XA 2B4QA 5CDFE 2V9CA 4P34A 4DSUA 4YP6A 1JHZA 1EB8A 2PRJA 3BCUA 3QOFA 1NXQA 4XDKA 3PUYA 3FZGA 2Y2UA 4UHFA 3R6GA 2OL4A 3FNBA 5D6NA 1PFKA 4IINA 4AAYA 4UTRA 5HKKD 2EG5A 2PBRA 4KAJA 4TTSA 2V7QA 1FQWA 4HQRA 4EO7A 1FDSA 1A4RA 3D31A 2C88A 4F4IA 3HBJA 4UBMA 5EPUA 5C81A 3QVGA 1O0SA 3ROQA 5G4KB 2IY7A 2OWEA 1E2IA 1YZBA 5KX5A 4R2KA 4P8RA 3GHYA 2OORA 4Y6LA 5KZMB 5EYPB 3DE1X 3PIRA 3BXXA 5IPFA 5EHXA 2R1TB 3PVCA 5EY5B 3VR1A 2VZEA 3IC9A 1V3QE 4Z49A 3NUGA 6REQA 2XVYA 5IM4A 4RKFA 3MBOA 4NOKA 2OQIA 2NOAA 1Q0SA 4ZVVA 1XTSA 1EA7A 3SZGA 1D4OA 4FXPA 1V26A 4ESEA 2VDPB 5DK4A 3NUZA 4KUGA 2QGFA 2W93A 3ZNNA 4F4JA 1Y4UA 5MGNA 1UKZA 1EFRG 3AF4A 3AVVA 5G3ZA 2EQBA 3IEWA 3TOSA 2VF2A 4IDGA 3T1YB 1T0PA 5IH3A 3EY4A 5F9MA 4PBSA 1GPYA 1M2WA 3R3JA 4CM8A 2XVMA 3D3EA 4HADA 4DK0A 1UBKS 1D2MA 5MN5A 3GJ6A 4NAHA 4FMCB 4IVPA 4R9VA 1FK8A 2VDWA 5JNVA 1KTVA 3G2IA 1R9MA 1RPNA 2RJNA 4WZAB 2Q6IA 4QGSA 5LPNA 2N0SA 3PGMA 2HRRA 1YVDA 4F9EA 5AICA 2UUAB 4YJ2B 3ORSA 5FPTA 5K3OA 2IHTA 1QIJA 1ML3A 2IQIA 2QBYA 1GFZA 4NOJA 4G2TA 3KCXA 1NN3A 3CC7F 2BBOA 3AOEA 1JLKA 2EP8A 2NGRA 3O9OA 4IL5A 5L4LA 3O74A 2FF5A 4R2LA 2INGX 2HV9A 7REQA 2RHOA 3AVPA 3ZI7A 2YY5A 4P7FA 2WA1A 4QYMA 3OE5A 4H33A 3ZG6A 1YE8A 3C6ZA 4EUHA 1SMKA 2GTPA 5EJ2A 5BUCA 1CBUA 1T8WA 1IPEA 1RYNA 5CA1F 1YHZA 2QN6A 4CTOA 3GHZA 3E18A 4W1SA 3Q8XB 3HYSA 1WKCA 4O02B 1XL0A 3FOWA 1FP1D 2P5TB 4IFBA 1MRSA 4F4UA 4R8VA 3BRSA 1NW3A 4L15A 3G2MA 3KXIA 3OIFA 2VTVA 1OB5A 3HDGA 4B3IA 2BTQA 3O92A 5EGSA 4NVRA 1T3TA 2ZTUA 4CNBA 3PJFA 2XYVA 1GM8A 1XB2A 1DJPA 2CTQA 3H4TA 1FDIA 4OMFG 3D3WA 5JHHB 3WWDA 1IY2A 1ZISA 3A4VA 4KODA 1MU0A 4EY5A 1BU5A 1UBFA 1QHIA 2REXB 4G5GA 3WTBA 2IUTA 3GX1A 4KGVA 4G0MA 1UDRA 3H8SA 3LBYA 2DECA 1FFDA 4NMXB 3RSQA 2C4NA 2C9YA 2A84A 4DMFA 4CZ2A 4GUNA 4WE3A 5EXPA 1N9GB 4HFRA 3BXOA 3LT5A 5BQFA 3W79A 2WRZA 1E69A 2EKBA 2EWWA 1PTKA 3H8JA 2G07A 1WW3A 2B4YA 3FAVB 3MJDA 2BM8A 2AJTA 4H37A 4CIBA 2X7HA 1VPLA 4LMRA 2JFQA 5AKZA 2HJSA 2UUCO 4ZDJA 4N6NA 1VPTA 1MV8A 2ID8A 2ITCC 3KSDO 5B3KA 4IEEA 4IJWA 3QTBA 3CY6A 1UFRA 3BTOA 1CVLA 2MYTA 2WA4A 3V33A 3IE0A 2WU1A 2ODNA 3WZLA 2HDHA 1FMFA 4GXTA 1GNTA 4M83A 4I1VA 3B9RA 4YH1A 4AKGA 3GLFA 3IIJA 1VJTA 1NLFA 5AJHA 2ZXUA 5ARBA 1NLYA 3D02A 3TECE 2C77A 4HVAA 2C8VA 1C3OB 1RQPA 5EXXA 2GCPA 3CR8A 2GLUA 1QVAA 3G2KA 2IYOA 4F6CA 1YR6A 2H1WA 3BK7A 4RYLA 1FVHA 3TXAA 5SICE 3MJSA 5KHJA 3LPNA 2H85A 1D4ZA 3UQ8A 4M8SA 1FFWA 1YUMA 4U9IS 3KKPA 3PDHA 5AKXA 5GM1A 5TPZD 3SEZA 3F5DA 2WR8A 4EW3A 2VDKB 1MO2A 4YP5A 1KZGB 4M9RA 4OGKA 3M6IA 2HXYA 3K5LA 3PYXA 1I3KA 5IXSA 3U2QA 1KZ7B 3K0TA 1O6CA 2UXDB 4BQRA 1EZ1A 4WFBV 2XAFA 1OIWA 1GGHA 1V1RB 3TTTA 4XUCA 4DV1B 2WMYA 4URWR 2DCUA 4HGOA 4NBUA 3HPQA 1MDBA 1E1DA 2KBFA 5F9HA 4HZUA 2WTEA 4WZ6A 3F9RA 4OATA 1GARA 4K0KO 4UVEA 5JQGB 2A0FA 1HDJA 4DY6A 3DT9A 1VYUA 4JOQA 3LX6A 3DMTA 4TT3G 1DBWA 3IJ4A 5TGZA 3F6MA 1YS1X 4LHEA 3UAOA 1ZL8B 1N5KA 3O65A 3AR8A 4IIFA 2X0LA 3DT8A 2HXGA 3JQAB 3PG5A 5KKAA 2FLVA 3M5WA 3VMFA 4PG4A 4L8VA 3R9IA 2VKTA 1ZEMA 1U3WA 3K0CA 2WA3A 3KEMA 1MJFA 4DXAA 1N77A 4RQEA 1DPGA 5JFGA 1EG2A 2V4DA 1SFRA 4UM5A 4JOSA 2PZMA 1BDBA 4A92A 3JQ7A 4X61A 2J4FA 4ITRC 2RDMA 4YMVA 4RTMA 5BQ3A 4JJIA 4JU8A 2JKVA 4FK5C 1E3WA 2MSDB 2HP8A 3R9XB 1GD1O 4YR7A 1U2GA 3OLXA 3DC7A 5DGTA 4AZWA 2QVXX 3GEBA 2SNIE 4MR7A 2ZRFA 1ZSNA 4ZEWA 1Y4MA 2AK2A 3FCEA 3NVKI 3IB3A 1HW7A 4CXMA 1TF7A 1B14A 4Y8VA 4XDLA 4ZRMA 1QS0A 3AJ9A 4XAQA 1D5AA 3VGPA 1H2FA 3WGIA 1VI6A 3T80A 1ZGAA 3FB5C 2ZVJA 2ROQA 1AO0A 4BZPA 3EUEA 2DQ4A 4HFMA 1VQKF 4H7DA 3ZWMA 3TLYA 4KE9A 1RHUA 4FFDA 1MZPA 3GFBA 1KE1A 1ABEA 4YASA 1O5IA 3U40A 1FB5A 3EW9A 4J7ZA 1WXWA 2G82A 4Q4HB 3F5TA 4B3TB 1RQXA 4X93A 1FZTA 2XZOA 5C8DA 1CUIA 3VR6H 4IXMA 4P3YA 5T3UA 4E3WA 1I7NA 3QVLA 4E2WA 1BL8A 2OEPA 5D3QA 4LZJA 1DINA 5GJCA 1NUAA 4UXHA 2BEVB 3KSMA 2I65A 3QMVA 1NOKA 2O1XA 1ETUA 4G85A 3H5AA 4FGSA 2ISSD 3D0OA 2XRFA 3DQZA 4EO9A 2WSSA 1W8IA 3GFSA 4FGUA 1KMQA 4TWAA 2GUZB 2VP3A 1G2IA 1XTVA 3R5FA 4WQMA 3PFNA 4XCQA 3RAGA 5FX2A 4B71A 4EQ6B 4PIPA 2MT9A 2IW1A 3G2NA 4DBLE 3SD7A 5D1HA 1P0PA 3EDQA 1NKDA 2YC2C 3MK31 5C8XA 1GNVA 1WXGA 3OLWA 4R7TA 3IGFA 2P62A 3FYEB 3KQYA 3EEBA 2FG7C 4FW9A 1PG2A 3K5PA 4P3KA 2JD1A 3ABQB 4M0DA 4IIGA 4XVUA 1Z2EA 4MMYB 4C4ZA 2GLZA 3AXSA 1XHFA 3CPJB 1T0AA 1W96A 1GMGA 4XJXA 3RTCA 2CL5A 2W2TA 3QFRA 4KRYA 4M76B 3GT7A 1YU9A 1NVMB 1PP4A 2EDCA 2HWUA 2F7SA 4NP6A 3UMCA 4DDKA 3PP8A 2JEUA 3K7EA 2DWPA 2X6TA 4GPBA 3Q88A 5A3RA 1KDZA 3RYCB 3F49S 1NNI1 5CYFA 2FW7A 1PT6A 1T6BY 1XEXB 4NBSA 1TVEA 1S2OA 4E5VA 4QM7A 4DHWA 1BO6A 1G1AA 2JL1A 5HQ3B 4LXUA 1JFTA 4JAAA 5HS4A 1SC3A 2CNBA 1ZYUA 2XNDA 3KKQA 1AKVA 3OJFA 4CNQA 1RI1A 1C7EA 1R8JA 4GZ5A 5C7LO 1QNFA 5FBKA 1O97D 1FW8A 3KYIB 4DS3A 4MGHA 4G2KA 4RVDA 2F67A 2D7CA 5E4TA 1BKSB 3L0ZA 3DPUA 1U3GA 3C87A 3F0EA 4COOA 3ZX4A 1FIUA 5TPWB 3PQ4A 3TRFA 3K30A 2M6SA 3GB9A 4CT0A 2PWYA 4TV8F 5HF8A 3LSYA 3BYQA 3IR9A 2VDVE 3O3OB 1NX6A 3AJAA 2F1KA 1G8SA 1MQAA 2GRJA 4ZT5A 3MERA 3JALB 4WLFA 1HK7A 4MRNA 3BQNB 5K6TA 3UGTA 2BMWA 3IULA 4LNUB 5JJJB 2VDLB 1MO4A 2O48X 2B4RO 1QZTA 4QPPA 3HP1A 2ZIVB 4BB0A 2P2NA 5K03A 4OHRA 3UMVA 3OJLA 3DD5A 4HGNA 2E4WA 5DI9A 2DHQA 5CYGA 2YY7A 4WNAA 4DLAA 2V3WA 5CITA 3BERA 2BR3A 5FNVF 2RIPA 3DEIA 5T8KA 2EKPA 2JCYA 3OZGA 1W25A 4UZSA 5B37A 1GP2A 4S1OA 2ZK7A 1BX0A 3ELYA 1K8QA 1SESA 4L8YA 1KNJA 4IDBA 5DHAA 3GVMA 4FC7A 3VDMA 2E4VA 1KJIA 1P62B 4J3FA 5ALJA 4F56A 2Q67A 3RM3A 4QG7A 4R9SA 3TINA 1UPTA 4G5QA 1VG1A 2QW0X 2WZQA 2CJWB 4XBFA 2WLHA 1E7WA 2X40A 1X7XB 4N40A 1TC2A 4LF9B 4B3CA 5IDYA 2FR0A 1V11B 3KCNA 3ZMVA 1A77A 1GN3A 2ZIEA 4ZQGA 4YUAA 1KI6A 1T3ZA 4X95A 3FJYA 4P32A 2F8LA 3VTZA 2O3RA 4DT1A 3G7UA 5HRAA 4MUGA 2IWRA 3X1YA 4YO7A 3LY5A 3OAAA 4KQFA 3DDZX 3PTZA 1XV5A 1Q57A 3R8FA 3OH8A 4YMGA 3L0BA 4HDKA 1YA6A 2OO3A 3WGVA 1BJKA 4ASUG 3LUGA 1J1UA 1T24A 1CERA 1JR3A 4JI7O 5DCVA 1KIAA 3G5AA 1Z8HA 1S2IA 3HL4A 2IU0A 1OSNA 2Z1MA 1W581 1DEAA 3VI3B 4NXNO 2XHEA 2XWPA 2PO5A 3FHTA 4DA9A 4QNNA 2HHLA 3AGPA 2ZWVA 3BG5A 3FI9A 3U5TA 1GAWA 2A1IA 2AX4A 2XUOA 4AWAA 1OFTA 5TQ2B 1PBTA 2MYPA 4TMKA 6AT1A 1VKHA 2QRHA 4DJEC 4A4DA 4JDPA 3OKCA 2I2WA 2R00C 3U48A 1F17A 3K20A 4YAWA 3D64A 1ESDA 2ZJ4A 1P8AA 2P5SA 5CB4F 1B6RA 2H1LA 5G0TA 2VZLA 3H2HA 3SPCA 5EBMC 2VP0A 2E4AA 4M1WA 5DWDA 3BRWA 2BGGA 1Q2UA 1S8NA 2CLDX 3DLHA 3HI4A 3KQPA 3U4GA 2HZ7A 4KNWA 3EZNA 2IWHA 3FF1A 1RWQA 4DNXA 4FI3F 4MVXA 2HA2A 3LCRA 2IXGA 1QCYA 2VYVA 1PL7A 2NP7A 1LSJA 2AXQA 1YDXA 3LI2A 1OYYA 5CPFA 2HEPA 4R2XA 1IRIA 5JROA 5IF9A 1G21E 2PSEA 3STUA 5I47A 1GU7A 3IO3A 5FLKA 1QYRA 1VE5A 1M56B 1B06A 4OH1A 4KYVA 2CJYA 2OFXA 5JXWA 2RDCA 4GLLA 2J3KA 5P21A 3G7NA 2PWZA 3I52A 3KWJA 2HHJA 1HLPA 2Q9UA 5C32A 3IPYA 1D6NA 4G0YA 4KIJA 1QM5A 1CRPA 4DXDA 4K6KA 1SJ9A 3FSRA 2DFPA 2PWAA 1LNSA 1YZVA 3HVHA 3RC2A 4DV3B 3PITA 4D6PA 4JWKA 5I9LA 1U0NA 4NYKA 4GLFA 2ZR3A 5HBRA 4DV0O 1KEEB 1W2BF 1H1DA 2WVJA 3IC7A 2V97A 1FFEA 3HC7A 1AZWA 1D2RA 5KJCA 2RHJA 3V4LA 2IW3A 1WUHS 1I2DA 3GNQA 4FJ1A 1Y6FA 1ZSYA 2B7BA 3G2JA 4YRJA 3I92A 5LSAA 4I0XB 3IQHX 5AP9A 1QK4A 5B4UA 1FXKC 4K35A 1QYVA 3CO5A 2A0XA 1SZDA 2OILA 2GARA 2X0EA 3PEVA 3V8MA 2CVZA 2R96A 3EFHA 3X0DA 2ZROA 4J9ZB 5KHOC 3EGCA 1B74A 4JK3A 4DR3B 4C3UA 4WY8A 1NNSA 2GK3A 3RQSA 5KHKA 4NEHB 4I9HA 2Z98A 4CQMA 2EFGA 1C0LA 3ZV3A 3LYBA 3LF1A 1Z0SA 1E3LA 1Y7TA 1L5MA 1UBNA 3IIIA 4RHFA 4CH5A 4U7TB 4RA9A 1D1SA 1L6IA 1ACMA 3QYPA 2BP7B 1QDUA 3AEUB 3H5OA 4CM3A 4HQLA 4EGAA 4BN4A 3T9CA 2NPFA 1COWG 2AMVA 5BRAA 3G23A 1I33A 1XV2A 3BWXA 4FNGA 4XVHA 3QG5A 2GXQA 3REQB 1HP8A 3K04A 2NZWA 3JR3A 1A8HA 3HY6A 1NURA 1XMQB 3JCZA 3TZEA 1YI2F 3CP1A 3P0IA 3ZHYA 4DEVA 5FEUA 1ZBQA 2F1HA 4G07A 2QN9A 4URXR 1GK9A 2QYHA 3U3DA 4D6YA 2JVIA 2CAZC 1JFVA 5KNDH 4RUKA 3ZWBA 4C87A 3DB2A 5D8DA 1EPUA 2H29A 4I8DA 3PEYA 1QF7A 2IHBA 3FR7A 1FEZA 3VU8A 1EE1A 3OO1A 4NULA 4G8BA 1QVFU 3SYRA 3R5SA 3TCNA 3IEPA 2RGWA 2C9BA 3Q87B 2ZSUA 1KY5A 4RTKA 2VA9A 3LWOC 4WLUA 5L9AA 1SCUA 2ZUCA 3AETB 3RRFA 4Z9BA 2AUTA 4F4HA 3MOGA 1NF2A 4IVQA 2XCSB 1XILA 2GX6A 2XMZA 3LDFA 1S7GA 4GECA 3TIIA 4E1VA 3PUWA 2ZAYA 4DVGA 3MT8A 5DTEA 2P65A 4NYJQ 4AUNA 3WGHA 1Z17A 4W9MC 5IVKA 4J4HA 3JVUA 4CMEA 1OI7A 4GHWA 1EFAA 1QDLB 4LVUA 2HB6A 3EYWA 2I7CA 4UJ5A 3KKYA 1AMOA 3H11B 4JJ7A 1J21A 2R6FA 3WWPA 1M4UA 2AYYA 1O95A 2H16A 4FOPA 1YTFD 4D8WA 5F7JA 3PWTA 5IK2A 1KQSU 1EUQA 4BKOA 3KKKA 2X6RA 3N3AC 4DSOA 3ADCA 4MINA 3OZBA 1NMSA 1D5NA 5EPEA 1FFSA 4U7PB 3MCVA 3UUWA 2JDIA 1Z4KA 5B4TA 1B6SA 2JH9A 4JYYA 4KXLA 1IN4A 4N5DA 4LZNA 2ZM6B 3MT0A 1L7MA 3E2IA 1QCEA 1XF9A 1N36O 3ZVMA 4CTKA 1FQKA 1R6VA 1TA4A 3GEGA 4K0RA 4LFBB 2Q3HA 3N05A 1H05A 4J7XA 3H0EA 4A0QA 4I5FA 1NVFA 2P9FA 2H11A 2J0SA 4ZCRA 1OI3A 2C42A 1HDYA 5JS2A 1SOUA 4MS3A 2C8LA 3AJ8A 5KTMA 5TC4A 2CFSA 5CG1A 3OUUA 1CNFA 2YXDA 3PRKE 1WHSA 5EUQB 1KHHA 1OY1A 4ZCPA 1U81A 2P7HA 1M54A 5CBKA 1XL4A 2Y1EA 2C0PA 2L17A 3S2YA 4PNPA 4JKYA 1TE2A 2IS2A 3RB8A 2Q3DA 3PNLA 5AVZA 1Q0RA 3WB1A 4BNFA 3IT0A 1YAJA 3CWZA 1O6ZA 3V1KA 3CNBA 5HZKA 1R64A 1ST2A 1MABG 5LP6A 3CLKA 5DHTA 1Z5UA 3THXA 1QG2A 5KYGA 1E32A 2J3DA 4FC6A 5I01A 5EJGA 1QOZA 2DWEC 4NBNA 1AR5A 3HB4X 5GPBA 4B8YA 1UJ2A 1G59A 1GZDA 5F5XA 1YVUA 2XUIA 4S05A 2HQRA 4PQYA 4YJFB 3WV4A 1FAFA 2IOYA 3VOSA 4N54A 3WTCA 1DUVG 2QKYA 2TMKA 1H38A 4DCMA 3DWFA 1IBMB 3O2QB 3GVPA 4A2CA 2KS6A 1OCRC 3C6MA 1G4AE 1JILA 2JI8A 1XCJA 2R8BA 2A1UA 4WEOA 3QZUA 3UWMA 1AK1A 1RJFA 3OEYA 2VKQA 3GLHB 3GNTA 3NETA 2QRJA 3ABLB 2EF0A 4E4TA 3WSWA 1S5HC 1UBEA 3THWB 1JAIA 1QYXA 3QVOA 3OLVA 2RHWA 1LZLA 1QCCA 4LDNA 1ZFNA 4PHTA 2WNSA 3ZZUA 2ZTLA 1GTRA 2VGNA 5GJVC 2PLRA 4UB8Z 5L4NA 1YL5A 3Q3EA 2NAPA 4QVIA 4EG1A 1GFWA 1XAJA 4I5IA 3HSYA 2CLKB 2FSUA 1Z6TA 4YCJA 5HIJA 3EMBA 1ZJ4A 1L4UA 1LI5A 1KBZA 3OFND 5T3YA 1KAGA 4X8LA 3KFLA 3TKYA 1BGVA 3T5GA 2FVXA 5I4IA 5DOVA 2GESA 1RQRA 4AG3A 1QPGA 5IP5A 2OZLB 3UFBA 3REOA 1XXHB 3KOOA 2BOCC 2ZWPA 4JYBA 1RM4A 1JEOA 1KJYA 5KYUB 3CC4V 4ZVPA 1BXGB 1RM1C 3DHWC 4US1R 1GO2A 1B8UA 4MQ5A 4AXBA 3F4BA 3EGEA 3ZDEA 1JQBA 4HRAA 1KMMA 5IBRA 4MI1A 4MQ4A 3WV5A 3UICA 1NFFA 1CR2A 2B4AA 1Z38A 1DIGA 3HPLC 4FOLA 4D79A 3A14A 1J1ZA 5ALZA 2F3PA 1JDBC 2H07A 1OXTA 4AXXA 1H0SA 3SQOA 3ESJA 4BL5A 4J10A 5BZBA 3MJVA 1Q44A 3RUFA 2QA4V 4DW8A 1Z33A 3U80A 4PO9A 4I50A 5AKGA 4WASA 3EN0A 1JHQA 2VH5R 4WXEA 3ETNA 3E61A 4WDQA 5HG0A 2FK8A 4FZ1A 2WFMA 1UKYA 5HIAA 3P9YA 3G1TA 4OSEA 5EWJB 3PPIA 4QOJA 3MJCA 5CW1A 4LYGA 4PFSA 2EIMB 3NU1A 2YCLA 5HK9A 1HKHA 4Q9NA 4DR7O 3P27A 1G9XA 2NW6A 1MX5A 2BRUA 3EVDA 4NYIR 3K57A 3LFOA 4ARUA 1ZIYA 3QV2A 4JJZA 4UULA 5KOJB 2OUIA 4MTLA 1JVNA 3CXRA 2QN1A 4D46A 2OGTA 4Q4DA 1XZCA 1U80A 4ZU1X 2NUAB 1UBSB 2MDTA 4IGEA 2WNHA 3PEUA 1NULA 5JZMA 1LW6E 3P0ZA 2HU2A 1GTG1 5DK6A 4M0UA 3MJTA 3ZE2B 2Q7DA 1K4DC 4WVFA 3QU9A 1G4HA 3G6KA 4A8JB 4QLOA 4RJLA 3IOMA 2OAQ1 5BXQC 1NC1A 2AEFA 4LDRA 2KLHA 4LDQA 3QKRB 3IA7A 1LFAA 4LHYA 3JYOA 1Q1QA 3L8EA 2VF4X 4MUNA 3ZY4A 4O25A 1XL6A 1QLEB 1RBQA 3OW2U 1IQUA 5IYDO 2G4CA 1DCTA 2GJ4A 4NHEA 2Q4PA 2Z95A 3D01A 2DWDC 3HAXD 3Q7SA 2RHCA 1YC5A 4DA0A 2ZI6A 3P94A 3SN6A 3DE6X 4NBVA 3DF7A 3GJ7A 4NU8X 3FWZA 3IMGA 5JO9A 1N75A 3HJHA 2HADA 5E6RB 3KQKA 4KBGA 3CCBA 3AW9A 4BNIA 4NTXA 1EWVA 4GEGA 2IS6A 2R25B 1MC8A 3HCBA 3T0IA 4JASA 2OB2A 1YVRA 1XMOO 2QV0A 2CTPA 2GM5A 3GPDG 3PPWA 1FP4B 2H1HA 3FB6C 3NT4A 1ZUQA 1Q20A 5LUAA 3HXMA 3DEKA 2C2GA 4PD4F 3IQDB 4L0DA 2DQ3A 1YL6A 3UOWA 1IXMA 4MYTA 4UTXA 5IHPA 2RH9B 1RADA 4AG6A 4XWYA 1D2DA 1K5GA 1TGVA 3BAFA 4BNLA 3AUAA 2X1LA 3MOIA 4TUYA 3DWIA 2YXEA 4BMDA 1G1MA 2GHQA 2EQAA 3ZW8A 3DO5A 1ITZA 3B9QA 3D5TA 3GP5A 2I4NA 2NPOA 3I37X 1QO0D 1ZU5A 2HR3A 2PUAA 4X7RA 1WHTB 3BEHA 4FKZA 4P6VF 5DHFA 1NC3A 1T0KB 3KQOA 2VZ0A 3RIMA 5IN4A 4OLAA 4QDOA 3QUAA 1FMJA 2WYVA 1Y76B 2I7XA 2YYSA 1OOEA 5ALLA 1Y8AA 4JGBA 5BYKA 1Y8QB 1LH0A 2CSUA 5B8FA 1YE5A 3H42B 1BT8A 2ZYUX 5IUKC 4HLNA 1P1FA 4R40B 2K2QB 3A25A 2GEJA 1O94A 1H2LA 4EHLA 5HKOA 1STOA 5CT5A 3E2EA 3Q40A 1M6WA 2DULA 4FT4A 1FYEA 5JARA 2DPYA 3OZCA 2R47A 3GBSA 3JYCA 1QFSA 4PELA 3QVJA 1OIXA 2CSXA 3BTVA 4A73A 5G4KA 3O8LA 4LRQA 5ENDA 3TOXA 3OPYB 5LHGA 2FU5C 4KQJA 3O8NA 4EF5A 3ZIAG 4KEAA 3DVLA 5A4IS 5EYPA 1U7XA 4L3WA 3LDUA 1SD2A 2R1TA 1RI3A 3SMVA 1PUXA 3B13B 3UMMA 2XEXA 1T5OA 4HDSB 1X1BA 2W58A 3S0HA 5G4VC 4YXWA 1M76A 3RT3C 3L7NA 5B30A 3PGKA 1LS1A 4L02A 2XWSA 4V39A 3DEJA 3HR0A 1UXJA 1WUTA 4R7GA 1YQ9A 2BCJQ 1B1CA 1N2OA 4ETWA 4G01B 2Z0AA 3WLMA 1ZJ5A 3WHKA 1EB9A 4TXHA 4PSVA 2R7AA 1A88A 5JWHA 4G81A 4LF5B 1AI7A 1HEIA 1J42A 4JFAA 4DR2O 3MHPA 2PL9A 2YZKA 2XOKG 2AGVA 1QRUA 2QM8A 1U4SA 4KGZA 3FWHA 5CVUA 4RTJA 2YVUA 3RK1A 1O97C 3CT4A 1XYYA 1PL8A 3RGWS 4YQZA 1TAQA 1BGWA 2I1WA 3VSEA 1CULC 1TZBA 2FA9A 4BVAA 4RVSA 2GA9A 1MOFA 3CURA 4IR7A 4CIVA 2FDCA 5EKSA 5YASA 4N5LA 1IZYA 2D62A 2DQSA 4WZAA 1YQEA 1F7YA 2H18A 4B17A 2ZRGA 3ZWOA 2BONA 5BQPA 3CLVA 4AY2A 3CKMA 3QG1A 3RNOA 4YJ2A 3CKLA 2FQWA 1N1DA 4IJ6A 2VK4A 4EAAA 4RL4A 2CB9A 4MW6A 4Q7KA 3ZZTA 1KK1A 2ZB2A 4FMDF 4LGVA 4KWCA 4UCTA 1X8XA 5JI3E 1FNDA 2ACEA 4N0MA 1XBTA 3CXUA 2ZRAA 5KJFA 3I73A 1PZNA 3N0VA 4EG5A 1QZZA 1YZYA 4Q15A 3BIXA 5GIPE 1X19A 3CZMA 1LV8A 2IOQA 3HWRA 2I6QA 1ONSA 4LXIA 4TWRA 3QVXA 2A33A 4BLQA 4UVHA 3LXMA 5CVCA 2PBFA 3VOAA 3PB3A 1Z0FA 4FLWA 1CUAA 5AKKA 3UAZA 4R6ZA 3DEAA 2DT8A 2OIGA 1OREA 2OHIA 1V7QA 3EZXA 3MBKA 3ORHA 1JMKC 3UHAA 2FPWA 1GL3A 2NAFA 1NVPD 1T5IA 3DT6A 4RZSA 1WCIB 3G59A 4UHBA 5EP1A 2QLMA 3QU7A 2RGDA 1Q8IA 2MTBA 4R7ZA 3WBJA 4KVFA 3AK4A 1IV2A 2WLTA 1Q0QA 3I7TA 1QHNA 3EUFA 4ZRDA 2B8TA 3D4BA 4E22A 1NMZA 5KYWB 1N9GA 3QWHA 2QEQA 3OC0A 2YJ4A 2OOSA 1JDZA 4HC4A 3UJBA 4CIAA 2Q49A 3B9PA 1DCMA 5CB6A 3FAVA 3GVXA 2HKOA 3T4XA 2XXJA 4OQMA 4F6RB 2EGHA 4U2EA 3GZNB 1VZ3A 5A2QA 1OJLA 1W0KD 3B1FA 2L6LA 3LTNC 4JB3A 3NTRA 3K3PA 4GKBA 2V7PA 3UY4A 1E2PA 5LL6P 2QT9A 4AMYA 5KTPA 2ID9A 1NGSA 2AL7A 1V6AA 5G0SA 4BKRA 2ZSAA 1AXRA 1AA6A 3KT6A 4DGQA 4ZYUA 1C3OA 2GZ2A 2FPUA 4QPJC 5HFAA 4IIYA 1XZEA 2R9VA 1M1YE 4H3HB 1MT3A 4HAUA 4DJDC 4Q00A 2XXAB 1TYAE 2QM4A 1J8DA 4E70A 1P1CA 1NNUA 1FXWF 4ZFNA 2F9LA 3H5LA 3A1EA 3CVYA 4O63O 1KY4A 1VKZA 2WILA 3SHTA 3AG3B 3E53A 1IWPB 1YBMA 3VPFA 4FIPC 5K0TA 1WNSA 1Y6QA 5E8RA 1NA5A 1V1RA 3NEJA 1PNKA 1SBIA 3ZWWA 1SZCA 4D96A 1GPAA 4HH1A 2DM6A 2WAAA 1T0IA 4OP3A 3CCVV 2OXIA 2A7QA 3LK7A 5JQGA 4CYMA 2CUGA 1V54C 3F47A 1Z2PX 3E9DA 2L35A 4UTOA 2HLHA 1YL7A 1G2PA 4B6GA 4B6OA 1QHSA 1ZIDA 4P80A 3F0TA 4N9WA 3A10A 3KR2A 1HDXA 2EDAA 2PXAA 3ZN1A 1ZL8A 3PRJA 2CHEA 1AOXA 2JAUA 5ECDA 2W8ZA 1S2LA 3JQAA 4E3ZA 1LTHR 4DBLC 4ICGA 1T43A 2J7PD 3I1IA 4BT4A 2UZAA 4MQUA 2YI8A 1MZVA 3GWOA 3MIZA 4N7RA 3WLPA 3IHKA 2EJCA 5A5EA 1JFSA 1O87A 2XITA 2I4LA 3TK1A 5HOEA 1PG0A 2WEKA 1J8VA 2ZG6A 1CF9A 3NC1C 4PRZA 4M0LA 4EKYA 4HY3A 5CT8A 3KLPX 3R75A 4L5IA 3SDZA 1ZVMA 3R9XA 5FUYA 4BFVA 4LV6A 5LBQA 1VP3A 4M86A 3OIVA 1RTKA 4REQB 4DZTA 3DVRX 3GRAA 5DV9A 3GG9A 2DTEA 5AKEA 1YDEA 5B2ZA 2AW9A 3ZMZA 6NULA 2B1IA 1Q1EA 1S1MA 3G0IA 2D4HA 2I6XA 3CEIA 4IM7A 3CM0A 1GIAA 3ODGA 3I6MA 3WGMA 1RZ3A 4G2NA 3RVDA 4JROA 1KEPA 3HFRA 2W4IA 3DLCA 2Q8NA 4CU5A 2V7EA 1E1MA 2B94A 5IG2A 4Q6WA 3PD0A 4JP5A 1ZIPA 2G09A 5FO1A 3QVUA 2OD2A 5CFOA 1JQEA 1E3JA 1N0HA 3ZE0B 4GI1A 2VGMA 3NS7A 5CVTA 4Q4HA 2Z9DA 2NT3A 4ZP1A 5DB4A 2YFKA 1ID8A 2OHHA 2H31A 2F90A 3L1JA 1I2AA 1RWMA 2K6GA 4PCVA 4PHFA 3LQYA 1RLIA 2QL5A 2FF7A 1BXZA 4YUYA 3UJAA 2OSVA 3DZFA 1E1YA 3GH3A 3VR3D 4UVAA 3KOWA 4F8EA 2Y69C 4QE9A 2D5IA 1Q2XA 4DWOA 1OFVA 2BEVA 4LBEC 2XECA 3U0ZA 3CE9A 4LQ4A 1OX4B 1SAYA 1SQFA 5EEHA 4F5YA 2GYYA 2Z6AA 4PFQA 2WTNA 1VF7A 3I45A 4GI7A 5CW2A 3L73H 2R48A 4P7JA 3OTIA 2GUZA 1LBEA 3FOCA 3SEFA 2XWBF 4NXMB 5L95A 2JKYA 3JX9A 4KGXA 2GYUA 2WSYB 4V0OA 5KKNB 1EK1A 5DLQC 4EQ6A 2GBLC 3ZQJA 1D4AA 3TLKA 1UBTS 1GEEA 3O8OA 3EJ6A 1TLFA 5DGDA 5JLAA 1VG8A 4IDDA 4UB6Z 1NV8A 4EUFA 3H8WA 5DLYA 2W6QA 5JZSA 3L01A 1PK9A 3R7NA 4EX7A 3P20A 3LXRA 1IDN1 4MKIA 3EXIB 1F2TB 2M1ZA 1A2OA 1F51A 1G2QA 4WXYB 4B3SO 2R751 5FAKA 1T91A 4RHEA 4YDSA 1RXVA 1B6TA 5AVSA 1YJ9V 1Y1QA 3NG1A 4A6DA 3R5KA 3WC4A 4FYPA 2DUWA 2GCEA 2O5RA 4C4XA 5BR7A 5KWVA 2BUBA 4KQWA 1PGQA 4RS3A 3RYCA 3JWIA 5JNRA 5FF9A 3ZUPA 4R6XA 1SS3A 3CZ5A 5E1BA 1HMPA 1NXPA 1XEXA 1YZFA 1E1QD 2M2IA 5HQ3A 1VBNA 2AA3A 4PYQA 2BMDA 1E3TA 5L3FA 3CF6R 2Q0HA 1YRLA 2PX3A 5CPBA 3UYLA 4LNAA 1LPBB 1XAIA 5IH7A 1E9EA 4KQ1A 2VPTA 3TZLA 5TQ0B 1TI7A 3HB5X 3C6XA 1O6BA 1WWKA 2JHAA 1BQ4A 1VSVA 1D2HA 3EOZA 3SX2A 1XRRA 1K9MW 1C41A 3K2XA 2UZ4A 2E6KA 5A5VA 1JEAA 4OHPA 4KFTA 3UA4A 1U3FA 4L6IA 2H7CA 1ZJZA 3PTAA 2G06A 2V9YA 4L0MA 1Y3FE 1NFRA 4URFA 4JEHA 1YR8A 3TQOA 2XHZA 3VMMA 4JL5A 5L6MB 1W0JG 3JALA 1CS4C 3DBOB 4Q3LA 5F73A 2AEMA 3A2FA 3CIOA 4LNUA 5B36A 3CCFA 3CZCA 3IVXA 5BY1A 3KYJB 5H83A 1PF5A 4MQEB 4WFQA 5JEEA 2J3MA 1UL1X 1BHQ1 4YREA 3HCAA 1AR1B 2FRXA 5G0VA 3OPYI 3H1PA 3OQ6A 4WXRA 1KMHB 3KCQA 1XR3A 3IURA 4DLNA 2IY9A 5KAIZ 3IHWA 4AZVA 4B79A 4C0QC 4M53A 3UAVA 2PD4A 2VZ8A 1X1CA 4B4UA 2WM8A 2IRWA 2E37A 4OHKA 2NV2B 1UP7A 4HSGA 2CJWA 4RFVA 3T9AA 1KH2A 4HNRA 3OU6A 4FFWA 3HQ4O 5B3JC 1X7XA 3KC2A 2C5SA 5FA5A 1LWNA 3KVYA 1HBJA 2WKWA 4FE7A 4LWSB 1W3EX 2WQZA 2VDNB 4FQ7A 1V11A 2F8TA 3ZWNA