4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
1SA0B 4ZI7A 2RHJA 5EZYA 5J2UA 3VOBA 3RYHA 3N2KB 5FNVB 4U3JA 1TUBA 4EB6A 3HKDA 2VXYA 4TUYB 3M89A 4YJ2A 3RYCA 1FSZA 3RYIA 5LOVA 4O4LA 1W59A 2XKAA 2RHHA 3JAKB 4X20B 4TV9A 5J2TA 2RHOA 4HNAA 5JVDB 4X1YB 4DXDA 4X1KB 4O4JB 4X1IA 1W5BA 4I55B 4M8IA 3JARA 3JALA 3RYFA 1Z5VA 4ZOLA 1JFFA 5LA6A 5BMVB 4O2BA 4ZHQA 1OFUA 5GONB 1TVKA 5IJ9A 5IJ0A 5C8YB 4I50B 3WGKA 4B45A 5ITZB 3CB2A 5LP6C 2VAWA 1RQ2A 4IHJA 3HKEA 4WBNB 5LYJA 3JASA 5LP6B 3WGMA 2BTOA 5KX5B 4F6RA 4XCQA 5CB4A 5CA0A 2BTQA 3UT5A 5JCOC 5IYZB 4O2AA 5KMGB 5JH7B 4TV8B 3HKBB 5JQGA 3HKCA 5LXTB 1FFXB 1W5FA 4O2BB 4DRXB 3E22A 2R6R1 3JATB 1W581 3JAWA 4LNUA 4O4HA 4ZI7B 5CA1A 1W5AA 5EZYB 4IIJA 4O4IA 4FFBA 5J2UB 3VO8A 5EYPA 3RYHB 3N2GA 4U3JB 1TUBB 4EB6B 3HKDB 4YJ3A 1RQ7A 4U39A 1SA0A 4E6EA 4YJ2B 3RYCB 5MN6A 5EIBC 3WGJA 3RYIB 5LOVB 2Q1YA 4O4LB 1Z5WA 4TV9B 5J2TB 4HNAB 3N2KA 5FNVA 4X1IB 4TUYA 3ZIDA 2Q1XA 2VAMA 3JARB 3JALB 3RYFB 4ZOLB 3JAKA 4X20A 1JFFB 5LA6B 3ZBQA 4O4IB 4X1YA 4ZHQB 4EI8A 1TVKB 5IJ9B 4I4TA 5IJ0B 4X1KA 4B46A 4I55A 4IHJB 3HKEB 5BMVA 5MN4A 3VO9A 5LYJB 3JASB 5GONA 4EI7A 3ZBPA 5C8YA 4I50A 2GVIA 4KWEA 4F6RB 5ITZA 3C8LA 5CB4B 5CA0B 2BTQB 3VOAA 3UT5B 3V3TA 4O2AB 3R4VA 2VAPA 4WBNA 5JQGB 3HKCB 5M7EA 3RB8A 1W5EA 5LP6A 2RHLA 5KX5A 3E22B 4I4TB 2R751 3M8KA 3WGLA 3JAWB 4LNUB 4O4HB 5IYZA 5CA1B 5KMGA 5JH7A 4TV8A 1RLUA 3HKBA 5EIBD 4IIJB 5JVDA 5LXTA 1FFXA 4FFBB 3WGNA 4EI9A 5EYPB 5JCOA 4DRXA 4O4JA 3VPAA 3N2GB 5MN5A 3JATA 2XKBA 4YJ3B
chains in the Genus database with same CATH superfamily
1SA0B 1PUJA 4MQ6A 1D2MA 2BHNA 5CLGA 3KHUA 4DBLC 4EGCB 1Z26A 3UQYS 3PFCA 1Q86H 4EHDA 2DW4A 5LQMA 2ZRNA 4BMSA 2ADPA 2A30A 2MSDB 3I7TA 3ZHCA 3SPXA 1ZOSA 4EF6A 2H1VA 2RGEA 2YQZA 1C9NA 3PXDA 2OT3B 4BWYA 1XCMA 2BTOA 2P9EA 4CLXA 1OFHA 4NYJR 4GVLA 4XD7D 4ZT2A 3QENA 5GAPK 5C7IO 2DR0A 1Q7RA 4RORA 1M2OB 3EAQA 5IC6A 5A6SA 1QP8A 4G3XA 3HWWA 3UCEA 3QKTA 3Q8KA 4EATA 4QTYA 2YVQA 5AOAA 1XZDA 1K68A 4MYTA 2JCXA 4UHEA 5D87A 1ZN9A 3ENVA 3DGEC 4FBMA 4BNUA 1LBHA 2NSJA 3BC1A 3U6BA 1K88A 2ASEA 3E9EA 1CUGA 3DE5X 3PPIA 1LF5A 1RAEA 4ND6A 1W29A 5JVDA 4IIVA 1Q57A 1ULAA 1DCFA 2JGFA 4PBSA 3UEOA 3WFIA 1JVNA 2C9CA 1UBJS 5BWCA 4GD3Q 3ZEIA 4AROA 1EP9A 4L16A 2FW8A 4V0SA 2AE1A 3RRFA 4AP9A 1Z6GA 4Y6RA 3IUNA 2ZKLA 2NO6A 2ZUSA 3ZG6A 4G0XA 4DCSA 5E3HA 4Q3KA 4E22A 1MFZA 3HSYA 4DV7O 3E9DA 5HRAA 4Y1RA 2IEAA 4JNKA 3OM8A 5GONF 1A71A 2KTVA 1W7AA 1XNQB 5HMMA 3K9SA 2WJZB 1TUBB 3EGXA 3W3AA 2UXCB 3EY4A 4JIGA 1O1YA 3UH1A 1FXSA 1DRUA 3CVWA 1FYVA 3IKTA 2FMHA 1XTRA 4GECA 1K0FA 3K53A 1U1IA 5K2OA 2DTEA 3HB0A 3E03A 2WU0A 4NTZA 1C7QA 2J4FA 4IWNA 1T4CB 2GHQA 2PUEA 4YYEA 2DXIA 3CBGA 3UFBA 3QITA 4YIKA 1JIIA 5IYZA 1I9GA 2G28A 2EJRA 1S2GA 2BM8A 3V7NA 4Y8VA 3MHSC 4JK3A 5K0BA 4B6OA 2MSNA 4L6IA 4EZBA 1ZS9A 1ZMOA 1IXKA 2R8EA 4LF8B 2YW9A 2PKYX 1BMQA 1N33O 4JN6B 4MUAA 3WDSA 3SQOA 4BNDB 3L18A 5IDQA 3NPAA 3GTZA 1BSVA 2B36A 3FBWA 1AI6A 5K1XA 4D3FA 4BVSA 4KO8A 2G25A 1F2TA 4OI2A 2F8SA 2G72A 1ZVKA 3LWDA 1TXGA 5CH3A 2HLNA 3H11A 3RV4A 2F1RA 3AUYA 3VTAA 5HZGA 3T9BA 4LV8B 4WVLA 4XE5A 5LB2A 1J2UA 1XLUA 2DKFA 5ICMA 1BCRB 2CLKB 1F51E 1DX9A 4LIPD 3LD9A 3P19A 4ZO6A 1YDMA 3ILSA 3DE6X 4ZQBA 4W4KA 3M6LA 3A7DA 2Q5ZA 1MOQA 5H6RA 2BKAA 1CUXA 4B8YA 3E9ZA 5ICCA 1Z83A 3SE7A 2Z1UA 4HGQA 1FVFA 3A9WA 4V0NA 3FZYA 5FOUA 3UB3A 2G0NA 1A95A 3GAAA 2IPAB 2V5AA 4PFJA 1T9GS 3EYAA 4KNYA 5BO5A 4P4GA 2H5IA 3A1UA 1RMQA 3E4DA 1F23A 2DTDA 2D8MA 4Z2YA 1CUDA 3JYNA 3P0FA 2WB2A 2JGDA 4D6YA 2JHCA 4D57A 3C16C 2C58A 3CX6A 1VE5A 3UICA 1W581 4OP2A 4TKVB 2DFVA 1N25A 1BXZA 4KX3A 2CUGA 1TZMA 3WAKA 2Q4RA 5J5VA 2EATA 2O0KA 1Q7YH 3WYGA 2HCJB 4YAIA 1Q5OA 3PQ5A 4MWOA 2LGQA 1UJ6A 5DMHA 1PQUA 2NZJA 2QEQA 5G4KB 5EHQA 2OESA 4BB5A 3CPQA 3IUMA 4PA6A 3GYGA 3MSCA 4NZ9A 3ODGA 3TZBA 1B8UA 4YY3O 3BRWD 4LBWA 5CIQA 1L5WA 4DNOA 4QPZA 3ZHBA 4BQNA 2W00A 1GG9A 3HNPA 1CJSA 2XITA 5DWVA 4Q7QA 2LKDA 2WEKA 1NSFA 4D02A 2OO3A 1IY2A 4R8MA 3WAJA 4XTCS 2Z6AA 4MTXA 2OZEA 4OX9O 2IIQA 4FI3C 3S5UA 4D0SA 3EHEA 5JVDF 2DBYA 4DCOA 3TRJA 4F71A 1L7PA 3AG1C 4MWDA 3OZIA 5DB4A 3RS0A 3M6IA 3HN6A 1BZKA 1BFUA 2ZI4A 2KMLA 4H3KB 4CTMA 1YAJA 3L0CA 1RAIA 5TARA 4TZKA 2MK3A 4GZ6A 1WB4A 3FD8A 4QUHA 4BX2A 4RQBA 1YF2A 1PJTA 3VJMA 1BEUB 4EMUA 3S7TA 5A0VA 3N76A 3C7CB 3I4LA 2HDHA 1FFSA 3CCQF 3C5HA 4URYR 4R3WA 3OH8A 2QX6A 4D9JA 3BXEA 4V0OA 4BO0A 3Q85A 4Z7NB 3FYSA 4OXRA 3U4CA 1NAHA 4ARBA 3H13A 1T9HA 1WEHA 1F4MA 3LFUA 2NU6A 3APOA 2VEOA 1LNQA 2R5WA 1SUIA 4DMLA 5ITZB 1L6IA 2W6OA 3CLUD 3RRXA 1NMYA 3GGSA 1K3TA 1F12A 3EC2A 6Q21A 4PIMA 4TSRA 1TUEA 1Y5LA 2W4IA 4C6TB 4CCYB 1XT6A 4MKXA 4DCCA 1QWSA 4G24A 5AHKA 5ALGA 1EB9A 3QF4B 4OFWA 3JQ9A 4DLXA 1E4EA 1IZYA 4YXFA 1QIFA 2OFFA 3GFFA 3P2MA 1JQKA 3M1YA 3OETA 6PFKA 2P11A 2H1HA 1ZNXA 2A5JA 2X14A 4YDRA 3W7TA 1PLKA 1INLA 1K4DC 3UGKA 1TAHA 3G9XA 4GYCB 5AKKA 2I6FA 4FDTA 1RXYA 5J9FA 3DCNA 5HWEA 4PHFA 3JTMA 5GP1A 1F5SA 4YALA 2G1PA 2HIAA 3D5EA 2E9SA 2CCJA 1MNAA 5KNDH 3DEYX 1T4GA 4OHMA 1WTAA 5F2KA 1G2QA 4JJ8A 5FI5A 1QE3A 2VHCA 5KWSA 4KPYA 4ZIRB 1GTZA 2O8FB 4LSGA 2C5AA 5A4KA 3CZQA 5I4BA 3ST7A 5BSFA 1TPYA 3UN1A 3BAAA 3GO4A 2VTVA 1K3FA 2RARA 4PLTA 2V7UA 4IHAA 2P7IA 4M83A 2WMNB 2I1WA 2WPNA 3RVKA 4U3JB 1TF7A 2QN8A 1BHBA 3QNMA 4WEQA 3WR5A 1Z5ZA 4F92B 2Y9PB 1NW8A 1E6KA 3TZCA 2B99A 3OEYA 4C01A 2RHDA 3ZLJA 1HDJA 3OOSA 3NQ41 1GO0A 4HMQA 4HGYA 1PJAA 4CKCA 3ZRWB 1EA5A 2O5CA 1NOKA 3V8MA 3H1AA 1TRHA 3RUCA 3TINA 2EX1A 1PVOA 3LDEA 2K5UA 3RG8A 1JOYA 3F3SA 3E4CA 5KWEA 1CUIA 3N74A 5CNJA 2ZBGA 2LQTA 5DSZA 1KYQA 1D9XA 1RM1C 3GLVA 2KLHA 1QIMA 3JQFC 1Y34E 4FFNA 2Z2XA 1UBGA 1BE3H 5B5SA 4QG7A 2YFHA 3H01A 4CIXA 1M56C 4LGCA 4DR6O 2G07A 4WFHA 1E2LA 3SVZA 3U4DA 2PBZA 1G6OA 1GNLA 3ENZA 3FMOB 1XZGA 1H94A 1OH6A 1JJ2U 1RJDA 2P5YA 2PRIA 1ZNQO 3EF1A 2DQSA 1OVGA 2X22A 1P77A 1D4ZA 1E2IA 2GK6A 1C3LA 4TYNA 2YQ4A 3JX9A 3T5MA 1IEQA 5BURA 3TTWA 4FDLA 7AT1A 4ZU3A 3ZE8A 1ODLA 4LBZA 1ILWA 4B9EA 1Q92A 2J3EA 3BMCA 5EIBD 5JJEB 2JIQA 1C1XB 1IUNA 2GJ8A 4LF9B 2HA7A 6REQB 1A8UA 5CH5A 2GD0A 5CNIA 4PGAA 3TTUA 3LQ1A 3DBLA 4QQRA 4PXSA 4BWAA 3IJ4A 3KOZA 3NORA 2XOKA 3LKVA 3AW8A 2XGMA 4YGYA 4QDOA 3GLGB 3DJYA 3N0RA 1HT0A 1H93A 4WFJA 1S2LA 1JDNA 1VHLA 1YF3A 3LUFA 4BAGA 1OR8A 4ZOQI 5B3LA 5HP4A 4Q6WA 4LFCO 5EB0A 2BOVA 3FVTA 2X19A 1Z34A 1EDDA 3K5OA 1RYFA 4BO2A 3T99A 2QRHA 4GM0A 5JROA 1DELA 4I6EA 4IJ5A 4M1KA 3TZHA 2WJWA 4U2GA 5KVQA 4J29A 3BDIA 4QODA 4DILA 4W99A 2HGSA 5J40A 3REQA 1NUQA 1RD4A 2PX3A 3DL0A 2WWWA 3WISA 5DP2A 2SKEA 2WT9A 1VQKF 1WV0A 1KXZA 1X1SA 2LZ0A 1PQ4A 2VH1A 3ACDA 2K1SA 2QSJA 2EBWA 1UEJA 5FPKA 2RK3A 4PCVA 5HE9A 5LQKA 2DETA 1R5BA 2ISCA 2F67A 4RC9A 3HCWA 5DN6A 3PDIB 3FLMA 3UGJA 4DW0A 1GA4A 3WRWA 1SJ9A 2HS3A 3VSDA 2ZUEA 3OY2A 4DNXA 1H2BA 4FT2A 3F67A 4JQZA 3IRUA 2XWPA 4ZV9A 4QBIA 2QX9A 3C7AA 4LY9A 4PLGA 1AKTA 2AOTB 3RJMA 3B38A 1QK5A 3W4KA 1PT8A 5BR4A 2BJHA 1VCOA 4YB8A 1BYUA 4N6NA 3W5DA 3BAZA 3MMZA 1XMSA 1M1YB 5C4IA 3LC7O 4NI5A 4ACBA 4P86A 1A76A 1U0NA 3P9XA 4B3XA 2OV6A 4I4TB 2XOKD 4K1LA 4MAAA 3A2MA 2PTGA 2ZE5A 1KDRA 4M1QA 2FAXA 1V48A 3TQRA 3TOZA 3HN7A 1Q1EA 1MGPA 2WHPB 4WGFA 4EPXA 1P7GA 4Q19A 1QHXA 4EJ6A 1V11A 2D4HA 3NC4A 1TGYA 4V1CA 5EBMC 1EVKA 2PEZA 4O2LA 2E4AA 1OTHA 4M76B 4KIGA 3UATA 4QARA 2P41A 2AFHB 3NDIA 2ZNJA 4P9OA 4OHUA 4IJ6A 3Q10A 1DXQA 4XR9A 4QXRA 1RE1A 1V4VA 4UULA 3C3TA 3S27A 1P1FA 2YHAA 3D31A 1GSIA 3G8YA 4J16A 3LUBA 5E7IA 3FIJA 1QDEA 4W8HA 2XJ9A 4JA2A 3O2QB 3T7RA 5K0TA 4F8EA 2C2WA 4OGWA 4WTOA 1L5VA 5HY0A 1V1MB 1TO1E 4XGNA 4XIIA 1QVFF 3NP9A 4G0WA 1OPRA 1E1CA 4A16A 1PF7E 3QO8A 1F6BA 1PBNA 4P4LA 1FRZA 4FZ3A 3TNDA 1KKCA 2PHNA 2F1HA 1HE1C 3QE0A 1KZ9A 4KXWA 3UB2A 4D6PA 3Q8HA 2WLJA 2PMKA 1SQQH 3MS4A 2C98A 4RLSA 1E8DA 5KOHA 1E2KA 3JWHA 1GGJA 3H86A 1AMUA 1NWCA 4UNQA 2ZBDA 1Y7TA 1KZYC 2GPBA 3OFVA 4TTJA 3ASVA 2LP7A 1E3EA 3HWRA 4CVNA 4BIZA 4WRRA 1PEAA 1CR0A 4PCLA 5JDIA 1XDZA 1M76A 1GZUA 2B5WA 1WZNA 2EDCA 3PGJA 2DECA 2BFBB 3HSKA 4JI8B 1OH5A 3PJFA 1Q84A 1QHGA 1O54A 3OQHA 3SZRA 4WDRA 4YLEA 2ZB7A 5AI4A 3GT0A 5D3MA 2JW5A 4ZTBA 4DUPA 5F2NA 5SY6A 1JLMA 1UJ4A 2D5LA 5F3RA 1OH7A 4NYJQ 3L7KA 3MM4A 1YFJA 1NX6A 1IDOA 1M3SA 3IJEB 3D4PA 4KQIA 1HZZC 4NBRA 4HFNA 5BR1A 1XRNA 2R6JA 2QEXV 4ZTZB 3VYVA 1NLFA 4B3HA 5FQOA 3FYEB 5HCUA 2ZJ0A 1S9HA 1JEJA 2ZRJA 5AVOA 3A0HZ 3AIMA 2C0CA 5J4VA 1WDKA 5CFLA 2VBCA 3KKMA 4TQ9A 3M4ZA 1Z8HA 2PKCA 4DIDA 1L5FA 4KI7A 1NW9B 1X4TA 3IHLA 3U10A 4BAUA 3ESXA 3K30A 1FP7A 2CNWD 3F8SA 3L0IB 2PPLA 4TQDA 4ITUA 5DNWA 1ZPDA 1OASA 4N9WA 3IBFA 4XCXA 1TDJA 4I5GA 3HL4A 5IRCD 5B36A 2XTNA 3QMWA 4HDRA 1AUQA 2JJ2D 5D3KA 1EXNA 4E2YA 2GOYA 2PKRA 4M49A 1CLEA 1F8FA 1JDPA 1DPFA 3A1NA 5FBWB 1UANA 3EXHC 4R7CA 1ZD2P 2ZVQX 1VB5A 2OL4A 1V6CA 3CX3A 3BE5A 3GOQA 2VK1A 4MUIA 4TL8A 4LF4B 3I0NA 3BMXA 3W77A 1FX0A 2AR0A 1CULC 2JEYA 3TFQA 2SCUA 3UPTA 4BMVA 4AMVA 1H2YA 1U6IA 3A1FA 1RRPA 5L3VA 1YDFA 3TH5A 5FH9A 3RTCA 4INAA 2MDTA 4CKXA 3IUPA 3DKIA 3LPLA 2WY2D 4L5YA 2BD0A 3W8NA 5A03A 1ZGHA 5JS7A 2VJMA 2WUDA 5FTNA 1BZYA 4BJHB 2W90A 1E2HA 2O3RA 4IIJF 4DPLA 1BVHA 3ANNA 1OC2A 1TCBA 3AEQA 4KAXA 4F84A 1CP2A 5T64A 2NIPA 5REQA 1JUDA 2J08A 2WUFA 1L4GA 1FQJA 2SNIE 1QU3A 4RA9A 1CE8A 2JAWA 3GT3A 4MVJM 2FOIA 1RJEA 3EQ7A 1SCAA 4GBJA 3D6TB 4HYTA 4BGVA 4LY0A 5JLJA 2QUZA 3PGMA 5LYJB 4JTDB 1NQ3A 4FNOA 1BXKA 2ZJBA 2Y1GA 4IZ6A 2PGAA 2XNDA 3O4JA 3WGNA 1ZH4A 1GM5A 3QU2A 1KR5A 1DNPA 1Q21A 2EILB 3U6KA 4FYJA 1FUIA 2JAOA 1ECPA 1KBZA 1E5VA 1GCUA 3DE1X 4PWTA 3JQGB 2CUKA 1R6VA 3PTAA 1Z7YA 1AXRA 2XAHA 4FFVA 1YBVA 1ZGJA 2DPLA 1L3BA 1S2IA 3EXFB 5GIPE 4HNQA 3UJNA 1RQRA 5TSDA 2FR8A 1A5ZA 2VATA 5T6MA 1CJCA 5FPHA 1D2DA 1NY6A 3L1UA 1OCZC 3AI7A 2H7XA 2ZWOA 3GI1A 4GP7A 1GLGA 2E37A 2R9AA 3ZDXB 5T3UA 1B8VA 2JBHA 3KJGA 3JZIA 3RUDA 1ZL8A 1C3VA 1C5KA 3RT1A 2JG3A 2G9ZA 3E20B 1GZ4A 3ZK8A 5CRIA 3VR2A 2CLMB 4WH0A 4CU5A 2V8OA 4YQEA 1E9FA 3HXOA 1Q1ZA 5ECWA 3SPCA 2UYHA 3B6EA 4NPCA 4TMKA 4XPIB 1THGA 1RQLA 4KR7A 1TD9A 4ZO4A 5T41A 1DTSA 3IURA 1KC8H 2CGNA 5KYYB 3RG2A 3G0IA 4HC4A 4MQUA 2OBNA 4PG6A 4WOPA 1LUWA 3RSGA 4JI0B 4MGYR 3ZY3A 2I4NA 3DE2X 5CAEB 4I99A 2NUTB 4TYPA 2JS5A 4BY9D 2MSEB 2KKWA 4B3RB 1K7EB 4MIKA 4EG7A 1WR8A 4HXYA 2Z1NA 2W8BB 5KSOA 5F7JA 3EASA 4QULA 1UK8A 1N8TA 4BQRA 5ANRB 1QYXA 4WK6A 2PUSA 3ZHRA 1XEWY 3MBOA 4AMYA 3P96A 4C6RA 1P0MA 1OYYA 2GBPA 3N1UA 3A14A 4L1KA 5BORA 5IKEA 3QKSA 4UCUA 4EY5A 3WYEA 2YJZA 2LBXA 5CBPB 1VCHA 4J4TA 1DXYA 2R97A 1JG7A 2Q2NA 4GEGA 1P8JA 3BYQA 3R4VA 3IBGA 3BWXA 4CF5A 2BSAA 4JLJA 4I9FA 1T2UA 2Q3HA 2N0SA 5LVAA 1SRYA 1YI1A 3C3DA 2QJ1A 1W87A 3V4RA 1H6DA 3OFJA 3P7MA 3A32A 1S89A 3IE2A 3E53A 4C4AA 3I5XA 2Q50A 2A9PA 3IE0A 2M6RA 8LDHA 1ZJJA 4J2TA 2RG7A 4GF5A 4CG1A 3ELYA 4HB0A 4AC9A 2VDKB 1BN7A 2Q67A 3OM1A 3FRIA 3OZRA 3O4FA 2OAP1 4LJ8A 3PYMA 3DLCA 3ZCRA 1QH0A 2HD4A 3AM5A 1CRLA 1VPTA 5JTUA 9LDBA 3UKDA 3FYIB 1KMHA 2FR0A 4GDFA 1J7KA 1MX5A 2VXBA 2EX0A 2PYJA 5B1DA 5TV2A 4I5EA 3V4VB 3LY9A 1KYIA 5TQVA 4L78A 1IDSA 3NHWA 1V8FA 3IH5A 3OBWA 1MCZA 1N0IA 3R5SA 4Z1VA 2G70A 4BVJA 5IZCA 2X0KA 2ZG6A 4I1YA 1C7IA 5EZYA 1WZIA 3PFGA 3AJ9A 3WBBA 3LXUX 2XYVA 1L1EA 1B04A 4GSYA 5K6AC 2BSKB 1HDEA 1LBQA 1JG6A 1R12A 2XT9A 4FKMA 4ZPXA 2QX8A 2AI2A 3P30A 4ZOAA 2I9KA 2ZJAA 5DGTA 3FRHA 1IN8A 4RBNA 2P5TB 4YUYA 3EBOA 4RFSB 1C3JA 5DYIA 1WDWB 1DJQA 1YUBA 4FMDF 4YIPA 3NH9A 2NO9A 1YZYA 1L5RA 3QHDA 2WK1A 4X71A 3QFCA 3SICE 1FRVA 5HQ3B 4R9SA 3LHSA 3K16A 2YHIB 4XVCA 4TL6A 5L51A 3BFVA 1I3NA 2ADOA 4RTJA 1QHYA 2BM1A 1SPBS 1ONOA 2FMUA 3ZJ4A 3L6CA 3JQEA 5JDCA 1IBKB 1PT9A 3A1VA 4MS3A 3PITA 1L1RA 1U90A 4ZK2A 1V16A 4O4HB 2Y71A 4C2UA 1E66A 1OFVA 3VQWA 4I5DA 4B82A 4TVSA 3EIXA 5D3QA 3AW9A 3BMQB 3PRHA 4R31A 2NADA 4MW7A 3ABMC 4GMKA 2IBZH 3R23A 2VDLB 3FNHA 1CF4A 5HZMA 1H1TA 3GB9A 2O05A 2VSNA 2Z30A 1QLWA 4GI1A 1TCUA 1MN6A 1RSZA 2GZAA 3CEPB 1NUTA 2DB3A 3ZWQA 1C8BA 3HGTA 4B08A 2H1SA 4B4UA 5KREA 3HNRA 3CIOA 1H4QA 1UPUA 4LI0A 5JJBA 5AH0A 2HEGA 3FTCA 4NBTA 2QGFA 4BFVA 2YV2A 3TYXA 4JB2A 2PVSA 2XRFA 4ZAGA 3MCQA 4QUAA 4OHOA 3D8UA 5JISA 4DUZB 4KO3S 3KOUA 4NU6A 4TV8A 1P91A 2XHBA 1IV3A 1JLLA 4FJCC 3H5IA 1WAZA 1BWSA 4OPHA 1WMAA 3Q72A 4JASA 2WIDA 4FQ8A 4QPJC 4A5OA 2GD1O 2ZYIA 3FKJA 5K3FA 3WIUA 4GGPA 1KD1H 2H6LA 1RFGE 3MAGA 4LOKA 5C93A 2RJNA 1XYGA 3QG1A 4FZ5A 4XR4A 2GN0A 4DB4A 4OUDA 4OB6A 5B1OA 4X89A 1XQYA 4LP8A 4LDZA 1AKRA 3IHWA 5J2TB 1IE3A 3VQYA 1X1DA 2J5XA 4IMJB 3QVJA 3BHMA 1IATA 4NL4H 1BQZA 3HCDA 1IVSA 1FDIA 5CBFA 4N48A 2QY6A 2OD7A 2VNJA 5A05A 4WFFA 2BEWB 2E48A 1WLYA 3OWOA 2CXRA 3HH8A 1OZ0A 3UWPA 2X0RA 4JI6B 5I9SA 5EE3A 1NW3A 3BF7A 1N7IA 1KSHA 3DBRB 2X9QA 1EIWA 4C0XA 3U5TA 4ZVVA 1ZW6A 3GFSA 5DLQC 1JHMA 1PI3A 1EZZA 1RYNA 1GTSA 4UU8A 2C84A 3GRCA 4BX8A 3OQMA 1JW9B 1WJGA 5JECA 2R87A 3C3MA 3CN9A 1FYEA 3EGVA 3ZNOA 1IV2A 5HX7A 4WN9B 1IJFA 4G2TA 1ZXBA 2QTGA 2QD1A 3PPVA 3H5NA 1H2SB 1TD1A 5IXYA 1J0BA 2AKAB 4QDJA 1NH2D 2I67A 4LCBA 1LZKA 2I1VB 1KQFA 3L7LA 4DE5A 5EKTA 2QTNA 1SCQA 3H5RA 1PR0A 3COJA 4OBEA 2WHRA 1NW7A 3P0IA 4C7VA 4TQGA 5CJPA 4DHEA 3G17A 3U7QA 1J21A 3KQKA 1KZ6A 4XLLA 5A62A 2CNLA 4JT4A 5FDFA 3SC2B 2C59A 4OOFA 4JZ2A 3U3DA 5DP1A 4L9WA 2ZE8A 3A27A 2O7RA 3K6JA 3ER9A 1GUYA 2OXFA 3AZPA 1G5HA 1S6YA 3EF0A 5A3QA 4P4TA 4AF6A 3F8TA 3K0BA 2I2WA 3M84A 4HQ0A 3WK7A 4AKGA 5HILA 2PA0A 4HNUA 4CH4A 2HJDA 1RW4A 1SQBH 3ORRA 3FZQA 4W5WA 3KYCB 4KODA 3MWGA 1BCSA 1QOQB 5EI5A 1PTJA 4EJSB 1XKQA 2KB0A 3M81A 4ZJPA 1OREA 3GDOA 5FLXA 3ZCQA 4RWZA 2B82A 7MHTA 2VPZA 3DO8A 1TW2A 5DYYA 3K9HA 3RVRA 1X92A 3OIUA 1Y4SA 3GIDA 1FMTA 1MBZA 4DW8A 4GX1A 3U7HB 3LBFA 3AEXA 4LRXA 2CJPA 4B74A 4HAWA 3TLJA 2OFWA 3C0KA 3STYA 1T0IA 4ZRNA 2Q0AA 5AUPB 2ACVA 2XCSB 2P91A 3A2NA 4TWKA 1JCHA 1KSJA 1Z15A 3FNFA 1R8XA 2NYAA 3HXMA 3DZ8A 3SCZA 1RSOB 1POXA 3WNQA 1HNNA 2E89A 2ORVA 3WMXA 4WXPA 1AKMA 4B6FA 3HJUA 2VSXA 1E2BA 3B4SA 1TYDE 3DHEA 1JSXA 2QTVA 5KBYA 5IHPA 2CTPA 2B35A 4NH0A 2AOWA 3A3KA 4TT3A 2O2GA 2C4NA 3KQUA 5H02A 3ULKA 3OLQA 4S1WA 4CNQA 4HQRA 3PD0A 1A4UA 4EHKA 4WZBA 2QRQA 2XMGA 3KSZO 3T7SA 3ZCSA 1MX3A 2C03A 5JARA 4B17A 1Z17A 4IS3A 2IQQA 2OZKA 6AT1A 3HGMA 4F7DA 3M33A 4J76A 2P2LA 1DXHA 2ZIVB 4DXWA 3GVCA 4TTRA 1I13A 5IDJA 3GMDA 3H4MA 1DKQA 1FNBA 2DFNA 1E89A 4Q0MA 1R1DA 2W43A 4MT8A 3ODPA 3Q3CA 1M5RA 4BLTA 4ASUA 3K5LA 4D7TA 4E3ZA 3RYCA 1JDZA 1N8RH 4ZVQA 3UJDA 4FZJA 2XTAA 4Q3OA 3SWWA 3D6FA 5B1AB 2FLKA 4ABMA 5EZSA 2D2IA 5BV7A 2VDOB 5DIZA 1JU9A 4F3TA 3PWTA 4IGAA 2W22A 1QIIA 2PJDA 2PZKA 1WXWA 3DXRA 1XV2A 1GQSA 4RJIA 1Q91A 1BRMA 3OBBA 4PWYA 2YXLA 1ZN7A 3A0UA 3HDGA 1OLOA 1P1JA 4U7TB 3QJGA 2HF7A 3FX2A 4GPTA 1CF2O 1J0AA 2HY7A 4L07A 5GONA 1XEFA 2X5KO 1S3JA 3VH1A 2Q3MA 3R44A 4F04A 2ODAA 4JT2A 4EBBA 1YS6A 2RGWA 3UQZA 5L3QA 2ZRAA 4CPDA 4HNRA 2XQIA 1Q1BA 2XYRA 4NECA 1WXXA 2DVMA 3C3EA 3KZXA 3DS8A 1Q7EA 4TT3D 4DC1A 1EVQA 1OXKB 2BBOA 5E8JA 3B52X 4N7JA 3DV2A 4N0EA 3B09A 2PU7A 1CUAA 5KNLA 5BZBA 5JH7B 4M1ZA 1NFQA 3DZBA 3U31A 4X61A 3B82A 3BICA 2XIJA 5JHGB 1PJ3A 3NTOA 1FQOA 3PA8A 1GPJA 3QTLA 1DP4A 4P4SB 2QRGA 4XA8A 1GIAA 3SYOA 3CW8X 1PP4A 3KFXA 2A3RA 3KQHA 1RI2A 1X1QA 1PV0A 2BE3A 4C82A 2CLCX 4Q00A 4R2LA 3E15A 1K5HA 2CMDA 3NM6B 4KBGA 1AILA 5A2GA 1NSTA 5AM2A 3P5SA 4W9MC 4KL8S 5D8DA 2QL6A 5KTTA 1JZSA 1L7AA 3K03A 2QRMA 1TTPB 4B84A 3PUJA 3PXGA 1M1KW 1Z6YA 3BIJA 2P9GA 1FP4B 4FYPA 4Q9HA 4IFBA 2BO1A 4NQ3A 4DR4O 4DB2A 1E98A 4L27A 1UDAA 2QWPB 1W4CA 2PKQP 2NU8B 3ROGA 2ZUBA 3F8WA 2BMWA 2AZDA 4L6CA 1NXPA 5CU7A 2WLLA 2P22C 4LBVA 2IF0A 4ER6A 1XEQA 4R1TA 3TZKA 3BDAA 5HS6A 2N46A 5BSHA 2ZI7A 5TR9A 3D3JA 1GN9A 3BD7A 4PELA 3STUA 1XCJA 2ENUA 1VZ2A 1GR1A 3TW8B 1AJEA 2YYZA 1VQKV 1UPAA 3ND9A 4IXTA 3RUIA 3ZIAG 2PUCA 4IT5A 5DW0A 2G88A 3G82C 3IV9A 4IP0A 3CTPA 4GM4A 5KQRA 1RHJA 3O4IA 3H04A 2P1DA 1HURA 3MCWA 1YTFB 4XQGA 2YFQA 2QZJA 1Z0JA 2I1QA 2VPPA 1XNGA 4IXWA 1UBUS 2JF0A 2H3EA 3LVRE 1G291 1U9CA 4GBED 2UUCO 4EHLA 3F7YC 2HK7A 1ORRA 2EHDA 2GCOA 1BH2A 1ULTA 4BRUA 3I04A 4CKEB 4DGSA 4OY3A 1K92A 1K3UB 5HJ5A 1RRGA 2JRLA 2O2XA 2O8VA 1UMBA 2VUUA 3HCNA 3ADBA 1O08A 4CM8B 3EVGA 3P10A 5AOVA 2Y2UA 1HPLA 2BUBA 3TI7A 2YXNA 4BQPA 2I3AA 2FL4A 3G5AA 3KCXA 4QPNA 1UC9A 1CUHA 4E3WA 3H6HA 3NVMB 1YR1A 4DDKA 1T4MA 4JUBA 1QGAA 3GJSA 2DMRA 4A27A 3QWAA 3TTTA 3TRDA 4HR7A 3WY9A 4BO8A 3ZYCA 2YN4A 1ARZA 3LSUA 3IQZA 2KE5A 1T24A 1D2EA 3BXGA 4R1OA 5H9VA 3AP1A 1ZMBA 3ZXXA 2OTLF 1X2EA 4M0EA 4PF1A 3MB8A 4QDUA 1F6WA 4RL6A 2PLNA 1RLJA 5EJ4A 3Q9SA 2XKAA 2YBDA 2Q99A 3M2TA 4FPPA 4C89A 4XXHA 4X1IA 1YZTA 5ED4A 2A4KA 1HR0B 2V9CA 3W2HA 3GELA 4TXLA 3JYQA 4BNLA 5EIHA 3UNXA 4CMAA 5CVUA 4IYRA 3NBUA 2FMXA 4OXKA 1ZJ6A 2RGBA 2QVXX 3MINB 4MWGA 3LFOA 2OHIA 2PKXA 3X0DA 1JHAA 1WKBA 1SBHA 3K0DA 3BWCA 3OP4A 2H4JA 4NS4A 1IRXA 2J09A 4W9RA 4RUEA 1QYCA 4Q4JA 2X58A 5TX7A 4B6PA 1KKUA 4K9SA 2V7EA 3BMNA 3NCHA 1DAFA 2QM3A 5ICSA 4ZK7A 3RSZA 1QIJA 3KTDA 5CB6A 3CUEF 1TM7E 2XUHA 1BNCA 2VGNA 1HETA 2V6IA 1I7QB 2CJYA 2V0NA 5JJJB 1T8UA 4R6XA 3ANLA 4D97A 4O5AA 1P84F 2PMBA 1T36B 2C3UA 5NULA 5K3SA 2H5LA 5HOQA 1R1MA 4PPFA 2Y8EA 1N2XA 3VHLB 1TLLA 3LVBA 1GNVA 2NWQA 1GKIA 3TLCA 2FZKA 3S2EA 3THRA 3CHXA 1A7UA 4GYJA 1SRRA 4C87A 1YL7A 1V54C 4M1TA 3FNIA 2B30A 5EWRA 3LPNA 5I8ZA 1EM8B 3E81A 5EGSA 3FPAA 1XI1A 1GTRA 2WWTA 3GEBA 4FM0A 1L4KA 1N0HA 1R66A 1WHSA 2WHQA 4Z99A 4HH4A 3G2QA 3CPWF 3CVOA 1NI4B 2CYAA 1GM7A 4YCNA 4IFIA 4LZWA 2VUTA 4II2A 2XUDA 3GUUA 1SZPA 3VO1A 1S2OA 1KDZA 1ZUIA 4IJKA 4OLBA 2B78A 4L50A 1TEVA 1I2MA 3RRBA 5LUAA 4PZCA 2OP1A 1OWMA 1GVHA 3KTAA 4GLBA 1Y3CE 3G2KA 4JAUA 3BA1A 1W30A 4RD4A 1Z0SA 3V6MA 4KXVA 3W3AD 2QN9A 1ENOA 1PYDA 1WMFA 4KITB 1KYWA 4J4HA 1OX4B 1NDQA 4G8BA 5FL3A 4EA7A 2VUHB 4CDNA 3CRMA 3IO5A 2C88A 2PUHA 3ORYA 5CDGA 1C4OA 3LDHA 5DBOA 2NU9A 2DH5A 2ZTVA 1AI5A 2QRJA 3V1MA 4FGSA 4LRSB 2P8JA 3L8MA 2M1XA 1U2EA 3GUHA 1LRJA 1B8PA 4AZ3A 1RM5A 3INTA 4GOMD 3AUXA 3AESB 3LVFO 3N2KA 1B0ZA 4GLOA 3H9BA 5KYNA 3FLAA 2O0LA 3KJQA 1H2MA 4RO0A 4IW3B 3OUUA 2AZTA 1FSFA 3HAXD 5I4CA 3VUEA 1T2CA 1ZD1A 3ZHUA 3PN1A 1G5IA 3H2IA 4YGXB 3MPOA 1VCMA 2CXOA 1AH2A 3OCZA 2WKSA 3BSSA 1RWNA 1O77A 1YZHA 1FP2A 2W6ZA 2M6LA 3CO0S 3I45A 1OI2A 5U9CA 1TCVA 3OCCA 2NOAA 3U56A 1JIUA 1Y1SA 1RJGA 3OZ7A 5LZ7A 5B1IA 3QO7A 4OP3A 5HNKA 3L8DA 3TTYA 2W4MA 5AKXA 4RDIA 1I2AA 3H17A 3AEZA 3FAZA 4I9WA 4J6FA 1QZ3A 2RHMA 5ADUS 3SPJA 1NTMH 4O0LA 2HA5A 2O06A 5C9ZA 3C24A 5CR9A 3K79A 3GVMA 3PD7A 1H42A 4WINA 4IHJB 2WMDA 3EY9A 4OL9A 2RFLA 1NZJA 1L8AA 2Z9CA 4Z8YA 5ALEA 1XD2B 1ZSPA 1VLHA 1FVOA 4IOKA 1U7HA 3HJRA 1G66A 3CXRA 5BR8B 3TDNA 3IQXA 2AH5A 2WWRA 4QUDA 1T3HA 1G3QA 2QTTA 4QNRA 1U3WA 4NSNA 2EINC 4AJJA 4DJTA 2R00A 1N0WA 1NRWA 3OMAB 1MIHA 4N03A 1YB1A 3B8HA 3LJKA 4BVRA 3FUCA 3HB5X 5CX1B 3EFFK 4UHKA 4KWTA 1TFRA 1ZICA 1IZ8A 1IV1A 3RAEC 2NNWB 2TMKA 4K40A 3SP1A 4MKGA 2AG8A 2GM5A 2D54A 1C0EA 1GM8A 1RBZA 1U4NA 5KO2A 1TX4B 4EGSA 3OMNB 1WZEA 1XPJA 2AQ8A 4DIFA 2AHRA 5HF5A 2ZJZA 3M9XA 4E5KA 3G8AA 1KKLA 3JD0A 4IOMA 2UYJA 2PXHA 3ZQ6A 2D59A 1GNPA 3L8FA 5JXIA 2H5EA 1PUIA 2R751 1T5SA 2I76A 3ROTA 5TEVA 2WD7B 3C74A 1SKYE 1RP3B 1DQSA 1WA8A 3K5PA 4WXEA 2OXTA 3W78A 1PWEA 5ENDA 3R3UA 3P9NA 3M4JA 3IAYA 2HJFC 4BS9A 1MSDA 2DHRA 4CTKA 3VQXA 4WL0A 1N2ZA 1AQUA 1SOUA 3GRFA 1SCDA 4WK0B 4N5HX 4QLAA 3L5OA 3DAYA 1DAOA 1COWG 4OQLA 3EPRA 1KP9A 2QNRA 3SR2C 1JBQA 4X97A 3DWIA 3UJPA 5EC8A 1Z63A 2EX3A 2FI1A 2B5VA 4TVOA 3N86A 1SQ5A 5C37A 1WUIS 3OLVA 1Y6GA 4D3ZA 1U7OA 1QLJA 4RTOA 2GCPA 2IYYA 3C6KA 2ODBA 2HQSA 3EC1A 2C5GA 3HEBA 3SIPA 4F6RB 1WM1A 4HDNB 2NVUA 3N8KA 4LFAB 1MB4A 3P71T 4MEBA 3EFHA 3HJHA 4ZYUA 2F00A 3EGDA 1QQ7A 3JATA 4MQLA 3FVQA 4XDLA 2XCUA 1WV1A 3KHTA 4UKDA 2FUNB 1P17A 4YYZA 1BWPA 1P6XA 4DUYO 2FMKA 1HTBA 3PUYA 3PIDA 4K0RA 1MT3A 1Z82A 4HPXB 5AVJA 1AIPA 2GRUA 1IN4A 4NTXA 1JQLB 3ZOZA 3DONA 4RKYA 2XXAB 5TQJA 5K1PA 1M1NB 1QQTA 5F9FA 2XECA 1TYEB 4HN2A 1FS4A 1Z5GA 4HEA6 5L45A 1VGQA 1DO8A 4O63O 2FEMA 2IU6A 4GH5A 5I5EA 3VYTC 1ESEA 3FYUC 3L0OA 2DWOA 5SY9A 3ZE1B 3LWBA 1U8CB 5HFMA 2F4VB 1FMFA 1SN7A 3I01M 2P77A 5HJ2A 4Z0HO 5D84A 3A3PA 4LTDA 1MENA 5EMNA 1SK8A 4GPBA 2CDRA 3X1MA 3KKLA 4F3CA 1C50A 1PFWA 4HVTA 2WE7A 4YX9A 5JBNA 5ERYA 4EYEA 2JRIA 2R7LA 2FTKE 2O57A 1H5NA 4CM7A 3TQIA 3E18A 1UWLA 5DI3A 4CLEA 3CB2A 1Z73A 4KVAA 1FLNA 4Q02A 3SIVA 4G25A 4G5HA 4V2UA 3V32A 1VIBA 1X94A 5LCXA 3TEMA 3VH3A 1H65A 2EZ9A 4B31A 4EKEA 3B5JA 4R81A 5K3BA 3RU9A 1ODJA 5KHHA 4HFRA 1Z29A 1A88A 4U2KA 2ZR8A 4RMJA 4A5UB 3EISA 2V6GA 4OJQA 2A0FA 5G4LA 4LHXA 1K08A 4BGIA 1C41A 5CB4B 4W9NA 2G09A 1GTOA 2WSSG 3IMFA 3OPMA 3D4IA 1CDDA 1RM3A 2J3KA 1HWYA 2W6JA 4EI9A 3N2EA 1Q0PA 2C82A 3W6NA 1M2KA 5G0TA 4YHHO 1DKLA 4HDKA 5FNVB 2X1VA 2IG8A 2Q3DA 5FOQA 5AVKA 2OV8A 4LCEA 5EHGA 2R68A 1NMEA 4B3IA 4QDTA 3DV0A 2Z5GA 3I9NA 4BY9E 3R3ZA 1Y3HA 3KL2A 2ZIXA 4PSKA 1GAEO 3PNLA 4XRGA 2CXHA 5NLLA 4ENVA 4IDHA 4UD6A 5LXTB 2CUZA 2VHEA 4LF6O 4PLCA 2H0QA 3WK4A 1FUYB 5DLDA 1S8FA 3T3OA 3ZDCA 2O8DA 3EG9A 1EZVH 4YP9A 5EUCA 3FB7C 4B32A 3HMKA 4HG2A 1SS3A 4BNIA 2IVFA 2OFXA 1U97A 1IBSA 2LCIA 4KK4A 3MT7A 4PGFA 2DBZA 3OAAG 2X15A 4EI7A 4ZREA 2XMCA 4TKUA 4BZWA 5AHWA 4NVRA 2QG4A 2GETA 1XOUA 4EZIA 1Z13A 1ICEA 2YVAA 3HU3A 4N18A 5A6SB 2E5LB 4EFDA 1QYVA 3WWYA 1GVNB 3U4HA 4L95C 1RJFA 3PEUA 5BN3B 1P0PA 2Y05A 2AB0A 4RVCA 5EMHA 3TR5A 1AHPA 2V7GA 5F9MA 5HE8A 1ZMRA 1G6KA 1QH1A 4F56A 3NONA 1UBSB 2VJPA 1YL5A 1DDIA 3RJ5A 5BMVF 2HRCA 5AVRA 3IC9A 4IIJA 1AO3A 4M8LA 5CT6A 1R3IC 4TS9A 2PM8A 4RUFA 1QRRA 3LLVA 2GXSA 3UMSA 3AIOA 5DN6D 2VAMA 2VYNA 3CR8A 1G3UA 2MSWA 3B1ZA 3UBMA 1SHTX 3QELA 3RA6A 3I1YA 2P8SA 2I78A 2JAPA 1N0UA 5EVCA 3L70H 2FRDC 4MWSA 5KYWA 3FOBA 4Y1RB 2ACEA 2JIBA 5EAZA 3TWOA 3L4SO 1O4VA 2OB2A 2GKOA 3SHFA 3EGXB 1Z75A 1SU7A 3UW3A 4GICA 4MVYA 3DWGA 3VSCA 5A02A 2O2DA 1JU4A 1G59A 2AK2A 4LHVA 3FB4A 3MGKA 1ISSA 4DLZA 2FX3A 2BDTA 2H2FA 2BGGA 3LQKA 1GXSA 2QMHA 5JAPA 2A0LA 4IZOA 1XI2A 1JJIA 4PZUA 5IYZB 2P69A 3PUZA 5F7ZA 2O7QA 1GN4A 4IDDA 1EFRG 3K0HA 4WUTA 3HO8A 5TVKA 2QYTA 3H9EO 4ADSG 3WFVA 2V5VA 2TMDA 3DHWC 3SYTA 4YRFA 4WOJA 3P26A 1RAAA 2C57A 3JXEA 3IILA 4I4CA 4Y2SA 4XI9A 3R8CA 4BFYA 3CZ9A 4RTKA 2BI7A 1P5ZB 3JYLA 3RIEA 3PLNA 4ZIBA 4RHYA 5FXMA 2EFYA 4K9PA 2PTMA 4HOYA 4OFZA 4MEAA 2X6QA 2BGUA 3DP9A 1TJPB 2Y9MB 2KW5A 5CDSA 2C2AA 4X92A 1X7DA 1QWOA 3LSSA 4TTTS 3SC6A 3MMSA 2DERA 4O1MA 4BDTA 2HFKA 1VHDA 4D82A 2RQ6A 3HXKA 4CT5A 2LBWA 1H9BA 1EK5A 3WWEA 2Q5CA 4I9NA 1OLXA 3WIBA 1WL8A 4FYKA 5HRUA 4ZYZA 4AJ2A 2WRZA 5CHEA 4BXOA 1T35A 3UKMA 2HLHA 2NPOA 4HDSA 4KKVA 3DYIA 2H18A 2I66A 3F6MA 1YR2A 1HSZA 2FZCA 2FPIA 2B8EA 2YRWA 5E95A 2Z6UA 4ZANA 3V4SA 5BSKA 2D62A 4JJEA 3RJTA 1SU4A 4QL3A 1JQDA 3QKIA 4TTQA 2W6PA 4GR9A 3TJRA 1I5YA 1VIVA 2ZRFA 5TISZ 3ZGZA 2QM8A 3EPJA 4Q3EA 5D7BA 1Y6FA 2WIFA 4M55A 3ADPA 4FM2A 2P75A 3NIFB 1N7JA 1W4BA 3M99B 4RTNA 4YIHA 1XZIA 2JGDB 2YHUA 1KVQA 1ZGZA 3ADCA 4FLEA 1IU9A 4BO1A 2JLYA 3IQIX 3ML1A 1PVVA 1NBWB 4UCXA 2IYLD 2ZT9B 2OKCA 1ESZA 5ALYA 3IP7A 4F3KA 2VTBA 3CFYA 3DGFC 2I4TA 4DR3O 4C7UA 4YPFA 2O6LA 4J91A 3HRKA 5ADHA 2Z2YA 2VHQA 3EVBA 5HIJA 2BSXA 3WBFA 4MITA 2NAFA 3FKQA 4FMPA 1AROP 1UOQA 4PG4A 1XP5A 1S77D 3SYMA 1GGMA 3ZOKA 2XOEA 3RWMB 2HMTA 4JAAA 1VRVA 4UQLA 4CF6A 4DQKA 4LJAA 5D6NA 1P5RA 4BFWA 3NBKA 4OHVA 3ESBA 5EJ9A 4NP6A 3EUFA 5L6LB 3T1YO 3ONEA 2GEUA 3QUBA 1MJFA 4GOXA 2D0IA 4X3MA 4X64B 1CY2A 1EGMB 4LFBB 1K97A 4TN5A 5DE3A 3JRXA 4NYMQ 4TSFA 2ZSKA 5IHXA 1WXGA 4PBRA 5TMBA 4XB6B 5CA1F 2QL5A 2BLNA 2QZPA 4LRYA 1W47A 1X1RA 4KYVA 3A25A 1BD4A 1H2AS 5GVSA 3CUUA 5KJ6A 4QO7A 1I5XA 3FBAA 3CSUA 3EDMA 5TDHA 1L5NA 5KKNB 2WVGA 4YJDA 2X6AA 4PX2A 1XKTA 3VX3A 2F1JA 4TXHA 1JQ0A 1KYTA 2NU6B 1VE1A 3MXOA 3AFHA 4MEJA 3RVQA 5A5VA 4JLNA 4DV2O 2DT8A 1ZZGA 1VQ4F 2CHGA 2VWQA 4KQ6A 4PHGA 3ZK9A 1IHXA 3KJZA 1EK2A 1L1QA 2PMPA 1TUEB 1T1SA 3IUJA 2CFSA 3SHQA 1WN7A 1NJSA 2NTNA 2ILTA 1CN7A 4KZPA 3GJYA 4TLDA 5TGDA 2MJLA 3RREA 3VNSA 1WPGA 1TQ6A 2PNJA 3L43A 4FC7A 1GTL1 2ZSDA 3G1WA 3GFPA 3TD2A 1E4EB 3PP8A 4DR2O 3HCRA 2H54A 3HR0A 1U3PA 4XWTA 4G5SA 3S3WA 1Y8RA 5CG2A 2PTHA 4G5OA 1RJWA 2IIVA 2P4QA 1DB3A 4TWIA 3ES9A 1D3AA 1F8XA 4CBCA 1PXWA 3K96A 2HP3A 3LBNA 2ZIEA 4P80A 3A4VA 1VQ7F 4HX9A 3TQQA 1R0KA 4IEEA 1PZXA 3M5PA 4PLYA 1XNJA 3F5SA 4YEDA 1KMNA 1ULUA 4LNAA 1M5UA 2CTQA 3PHCA 4D4KA 4H1HA 4CM3A 1ISFA 4GDMA 4B81A 1YHZA 1UJNA 3D7SA 1T0AA 4C2AA 1LH0A 4F1KA 1EDZA 3ZH9B 1SXGA 5KMGA 4RSGA 3TDKA 4KXLA 4DTCA 4RF2A 2Q9LA 2WC1A 2XEXA 3KOMA 2F8TA 2DHQA 2C5EA 4Q3NA 2HSGA 2Z5VA 1OU4A 1VF5B 2E74B 2I6GA 3SK0A 1OB5A 4RANA 4G8JA 2OCDA 1QC5A 2Y0PA 1GU0A 4E12A 4NBWA 1L8QA 5AW1A 3DD1A 2MOKA 4ID3A 4CKCB 2RH4A 3IHKA 4B3JA 1N78A 4MS2A 1QHSA 1QJCA 5COQA 4BPRA 2GVDC 3BY6A 2I6SA 4XDYA 2XNDD 4G81A 4Q16A 1G7CA 4DMKA 4Q5IA 4Z9AA 3FPGA 2VSFA 3NEAA 5I45A 1U3UA 5A5DA 4CBVA 4F2HA 3RARA 4Q01A 3RBXA 3VKUA 4DEVA 4KQXA 4QBTA 2XB6A 4OLJA 2RKWA 5IC4A 3CF4A 2AC2A 1PX0A 3A6EA 2HT6A 5DHUA 4TLLB 1WPQA 1RBYA 2YHBA 3QVXA 4AW9A 3CH7A 1I4OA 2F90A 3U3RA 3D43A 2JKYA 3H2JA 5JSZA 3PC6A 4CL2A 5L3ZA 5C8DA 4LVNA 3NTXA 4O2AF 4EB6A 2C99A 3HKDA 2C42A 1EVEA 3HCEA 5JXWA 4E1AA 3AG2B 2P6YA 4C8GA 3RHSA 4ZJZA 3NPMA 1P29A 3Q3VA 4P7JA 1EZ1A 2C9ZA 2KYRA 2HRUA 3AI3A 1NBMG 5LYYA 2B9VA 3VR2D 1WNSA 3OIWA 2OP0A 2W2TA 2VPQA 2GCGA 1W36D 4EFMA 3COWA 3BMCB 2FKNA 3OPXA 4EHBA 3R3WA 4KACA 4YNBA 3DD5A 3LBHA 3CYOA 3PXAA 1A8SA 3DBLB 4XTRA 5IZ4A 1FW6A 1IFXA 1SCNE 4JD5A 2FZGA 3E5NA 2NO4A 1SETA 3ZGYA 1ZK2A 4V38A 3RVZA 5F64A 2NLOA 2EOAA 1RI4A 3U7JA 4EQZA 4KUGA 2N75A 2PAFA 4DEYA 3FKSA 4R0VA 3B1XA 1URFA 3RC3A 2W6CX 3HA3A 1Y7LA 2FGYA 1SVMA 2BFDA 3URMA 3NATA 4ZODA 1VMKA 4JT9A 1R18A 2PX5A 5A7HA 3QWHA 3S70A 3EUEA 3MGCA 1F2VA 1KVTA 3C41J 2IJGX 4LYFA 2DHDA 3NVAA 3Q9LA 3T95A 3X1WA 3UM7A 3R7DA 1M2NA 3ITKA 3RFFA 4BLSA 2UVDA 3K2EA 3IBTA 1DJMA 4JITA 3UMMA 4CIAA 4KR2A 4RZHA 5ALMA 4Q9LA 4WZBE 2EGGA 3H9VA 1U2ZA 3LECA 3RU3A 4P7FA 3I6YA 5HMLA 3SYLA 3RTGA 3IGAC 2H2AA 2WWIA 5IDVA 4MV8A 3SJBA 2EF1A 4IAOA 2X8LA 3ISJA 1Y8CA 3WLOA 4PNEA 3IMPA 1KPHA 2OTLV 5L3RA 4W1QA 1CK2A 2NXCA 3RKUA 4ITRC 4D9FA 4C4OA 1LDYA 2YV1A 2HHCA 4A0QA 1S02A 3O74A 3WXBA 3BM5A 4KTTE 4X66B 4G27B 3DLIA 1HYBA 3PQCA 4MV7A 1WE2A 4QU0A 4BCDA 2Z3WA 1J95A 3LBYA 4PA4A 2GS9A 3ZY6A 2JCBA 1W49A 1S1MA 1Z36A 3OKFA 3ICXA 1HNXO 1H85A 2A5YB 2Y4NA 2YXEA 3DH0A 3ON5A 2AFIA 3O1IC 1XGKA 3P9IA 4YPVA 3ITDA 4UPVA 2XZOA 4MV3A 1A7KA 4MJ7A 5EIWA 2RKOA 2UUBO 3E86A 2CDYA 1CZKA 1T9KA 3IOEA 1QR8A 5B4UA 4CKZA 4LR3A 5FQNA 2J87A 2VZ9A 4BE7B 2VS0A 2H4FA 2LKCA 3B1FA 4PYNA 3K9GA 3AETA 4Y0NA 4RV9A 1USVA 3OTIA 3FKSD 2PL5A 1T10A 5JAQA 1V11B 2G4CA 4BNJA 4MW3A 3PRKE 4V1CB 1UDCA 2Z5FA 4B62A 4D8XA 3REGA 3HCBA 2BZ0A 3RVBA 2B8JA 1AKYA 1NRJB 3PWZA 2G0TA 2BH9A 5HM6A 4LXYA 2JCGA 5LMUB 2IW1A 3ZU6A 4CQMA 1LBTA 4DQVA 2WM8A 1HRDA 4HUQA 1O97C 3W2EA 1BQ0A 1MRZA 2GI4A 1TYBE 2R47A 3ONFA 4CM6A 3HJFA 2CVOA 4D98A 1TVKA 3MLAA 4BBJA 1E7KA 4LVOA 4DA0A 3S0JA 1GPDG 2AYZA 4KE8A 1JFVA 1NYRA 1TJYA 2EQAA 4E4EA 3CCJF 2Z1FA 1IPAA 5LP6F 4JHXA 4UZEA 4EG4A 1E1CB 3MJSA 1UODA 1YZ3A 1N1MA 4US2R 3BCSA 1SKYB 1NVFA 4AZTA 4MVMA 4REOA 2BGLA 2G7ZA 3L40A 1VYTA 5T7BA 3K9LA 1P31A 2X41A 5CDTA 1BE0A 1ND6A 3HRHA 1RWMA 5KOHB 4AFNA 4KXXA 4AF8A 4GYWA 5LZ9A 5AK3A 3IIKA 1YFLA 2NZVG 3NV9A 2BF7A 2LD4A 1P74A 2JKZA 1UKVY 3CLUC 5JI2E 1RXUA 3R5KA 1WUHS 1JQ3A 4XGIA 1RXWA 5FBLB 2YJNA 3K3PA 3H87A 2YYEA 1NC3A 5JV5A 1ZHFA 2F48A 1Q6YA 4ME6A 5AJYA 3G85A 5EWJA 3T2MA 4KC0A 4LK3A 1OZAA 5KDLA 3HVJA 3IB3A 1U3DA 3G6KA 1EX1A 4K0KO 5D3MB 5K51A 3CT4A 3DOOA 4LRUA 4DLVA 5I48A 4I7EA 1J9EA 1XTIA 3WC4A 2IYTA 2O7VA 2P3QA 2IHBA 5AHXA 3CLRD 2CZQA 3ZVKA 1Z0AA 1DTWA 2VQEB 3HQ4O 4BEWA 2QN1A 4PYKA 2FWNA 3L0PA 1J8DA 2HLPA 1Z6XA 2YZGA 2UZ3A 4LJRA 5AUOB 2WUGA 2C2XA 1L7EA 1ZAYA 1QVZA 3R5HA 4KQGA 2NTEA 1P2DA 4YRCA 4FWTA 1PJRA 1M34A 2R86A 4H08A 4I3FA 4DHWA 2CK3A 4ON9A 3C8HA 3AIKA 1QYIA 2IKQA 2VQFO 1L7QA 1JD1A 1QVAA 2JFGA 5DM70 4CEIA 2WWVD 4QWWA 3LIPA 3RNOA 2YICA 3CCQV 5JCXA 1RYHA 2ZRMA 3RK0A 1EM6A 1ZM7A 4HZIA 1GRVA 5HIMA 3BEDA 5K8CA 4XQ9A 1BE6A 1KNKA 3BXOA 5JJIA 5HDBB 4HDRB 3F6EX 3NYRA 3I23A 4CKWA 4TLBA 2J59A 3L6OO 1Q83A 2JAHA 3UC9A 4D46A 1GR0A 2EILC 1C0IA 2Q5EA 1E3WA 4I9HA 5TRTA 1N5KA 1YR3A 3L74H 3P1JA 1UFVA 4YDHB 5CXQA 2P68A 4L8JA 4DG8A 1CLUA 1FSZA 1LQ2A 4MHOA 2AG6A 1FX0B 4BR6A 1SDSA 1ZH0A 4FGJA 4IICA 4H31A 2SCUB 1KYYA 4GKAA 4JXKA 3LKBA 1Z74A 1E9SA 3U0BA 3STVA 2Y3IA 2M6KA 5A06A 1T29A 3V8BA 3MBMA 3EEBA 3U3ZA 2IOFA 2XBUA 4FD2A 5C7LO 1MIOA 4BQOA 5BRAA 4KMMA 3QVMA 3C9SA 3OQVA 1OCEA 4AS3A 2JGJA 4UNRA 5C8YF 3LZCA 5AYVA 1E92A 1D2HA 3LWRC 4GP9A 3ZWPA 1Z6AA 3REOA 2VJMB 3RS8A 1KI9A 3CUTA 3WDKA 1LZLA 4ZKEA 2E4YA 4J03A 3QNWA 3AU9A 3T1HO 3AEQB 4DY4A 4DPMA 3M6XA 5REQB 5FWXA 2YWEA 1HTWA 3M49A 2BISA 4P53A 3N7AA 1WCWA 2YY7A 5EQDA 2UYNA 1NFRA 4PYQA 5CPFA 4RA9B 1CE8B 3QTTA 1XTVA 1JXQA 2BKUA 2EQ5A 4BC1A 1KBQA 5B1BB 1XUOA 5U1PA 1N1EA 3NHZA 3ZI7A 1DWPA 2GYWA 3GHYA 4XH9B 1C30A 3I4FA 4Z4EA 4C6HA 3I6BA 3BZUA 3K0CA 4H0NA 2W8BC 2XB4A 4TM7A 3A6HA 5KYGA 1Q2XA 1RAHA 5K4AA 2HUNA 2MINA 4E5VA 3F5QA 1CU1A 4AJEA 1X80A 3KZVA 1CRQA 2EJUA 3L7DA 3N8IA 2ZRDA 3VPCA 4XFDA 2HKOA 5B3JA 1RM4A 5EC1C 1M6EX 3EDOA 2IYXA 2XAFA 5LMNB 2ATEA 1Y6XA 4BEBA 1K5GA 4LJKA 2AYYA 2CLEB 4EITA 1L8LA 1YKFA 2UVQA 4JTCB 1N32B 1SULA 3F5MA 3I83A 1D6NA 3LYBA 2XMBA 3VDNB 2WA1A 4ER7A 3FPHA 3GBVA 4AKHA 1NXQA 4KTVE 3W9UA 5AOBA 2JFZA 3ECAA 2EP7A 1CQPA 3ZBUA 2PUFA 2ABWA 2XQVA 1GSOA 1GYPA 4ED9A 1GSAA 4BHTA 3W3ZB 4A8JA 4W1PA 1OV6A 1ZL8B 2NNLD 1PT7A 1SG0A 3OLWA 4CU2A 2QHXA 4X8AA 3OF3A 1ZJZA 3PTZA 1CR4A 1JFSA 4L6AA 4AZWA 5LDDC 4WADA 4BZXA 5L7WA 1NP7A 2PMEA 1GGNA 3NWOA 1QQ5A 1FFBA 5C53B 3NOVA 4M9RA 3BTVA 1GFZA 3BFRA 1CEEA 2PGXA 5ALUA 3A6KA 1EFAA 4PYLA 4R01A 4Z7OB 2PVPA 4QECA 5HY2A 4QBFA 4Q03A 2ZTUA 3UJ7A 5DHRA 1PKXA 4U9HS 2JL1A 4ASUD 3RK1A 2ZCEA 2FLVA 2CFTA 5A3SA 4PGMA 3NEYA 1JY8A 3HV0A 2Q7EA 1RS0A 2P4HX 3OJWA 1SGWA 1ZQ1A 3DW1X 4G0QA 4PFKA 4WKCA 3TE7A 4H18A 5JTTA 1E9VA 3FX7A 4KWIA 4EUFA 2VKTA 2XKBA 2HU8A 4JYYA 3FBTA 3QKSB 3W7AA 4S2UA 1YDEA 1SCIA 4WBSA 1YSCA 1F8GA 5JJNB 5FNZA 1M8KA 3SQDA 3ZWCA 3ICVA 2BGJA 3UJAA 1QR6A 1A5BB 1BS1A 1H4VB 4F4DA 3IX7A 2QORA 2Z09A 4RGBA 5C2JB 3BHIA 4EVQA 3CLKA 1HG0A 4JNCA 3AERA 3H1LH 5G4VC 3I39X 5CTAA 5BW5A 4HP8A 1NAIA 1CIPA 3KFLA 2ZRGA 1Y42X 1U6JA 1E2MA 1UFKA 4RD1A 3SPIA 3H2SA 3R7NA 2C4WA 3H2BA 2OXCA 3KV1A 1E61A 2C2BA 2R9VA 5KHKA 4Z3DA 1JPJA 1SVLA 4TXMA 3T8YA 1XZEA 3JZDA 2GEVA 1KS2A 3R3XA 2GCEA 1B1CA 3ZDFA 1HNWO 2MHCA 4D0RA 5JCOA 2ACKA 4ZQFA 4BZPA 1FPOA 4K2HA 5JWHA 3EW7A 2LP4Y 2R1UA 2VXYA 4LQLA 1KMHB 1VJDA 4KLNA 3IEVA 1QLNA 3GLKA 3FLEA 1ULHA 4CE6A 5E1OA 1T8PA 2A1TS 2W42A 1RMYA 1H2HA 1H8EA 2I1LA 2BBTA 3C7KA 2XUQA 4R2IA 3WKDA 4TL9A 3OW2F 4KN5A 3VCZA 3OOHA 1ZH8A 2XMDA 3O47A 4AK9A 1IM2A 3HXLA 4BRZA 3WIVA 2G76A 5AO9A 2PWZA 3ZTYA 1QRAA 1BXRA 5EZYB 2AI3A 5CHYA 2EYQA 3V1TC 4B44A 3FOWA 5KTMA 5EXEA 3T1NA 1OV9A 4U0JA 4MR9A 2YJ5A 4ZA2A 1ZOIA 3PNMA 2B8WA 2JI6A 2JAQA 1SIOA 4UFPA 2XAUA 1F0KA 1YZBA 3RTDA 2PL1A 2X8WA 1YVEI 3TBFA 5LUBA 1EDEA 1H2WA 1YCIA 3P45A 3N5KA 3ZHOA 4JZKA 3TAXA 3FYHA 1UPXA 4JQCA 5AJHA 2EIMB 2HQ1A 1QP7A 1I1NA 1E5XA 1W0JG 3UAZA 3A9SA 4WFIA 1W1WA 4QGFA 2CEKA 2CD9A 1KY4A 5HFNA 4MS3B 3WLNA 1WHTA 1KAQA 2AMYA 1V16B 4X85A 1GRJA 4B6SA 4RL4A 3ZX6A 1FLDA 1NYQA 1N3LA 3DQZA 3PXCX 1E6EA 3AR5A 3BBLA 4QREA 2ZW9A 1XVUA 4EKDA 3CVYA 3HUDA 2KPOA 3KG2A 3CE9A 4EGJA 4ND1A 1T1GA 5EP4A 5LFAA 4Q66C 4CMIA 3B5EA 2LXNA 4NYMR 4KHZA 2XADA 5AVVA 5CEEA 2VC2B 1WDMA 1BHSA 1A2OA 5K7SA 1H2GA 1Z4JA 2R1ZA 3OIYA 4Y2VA 4TWAA 1LDMA 4CL0A 1OMOA 2PZSA 4LNHA 3EFOA 1H8ED 2XODA 2W7TA 1YE3A 3O8DA 4JYPA 3A6LA 2G5CA 4YJKA 2SECE 4QC2A 1NH2B 3QO5A 1GILA 2DJVA 4TWBA 3RTBA 1Y9ZA 4FSHA 1Z37A 4UDYX 5DNDA 1N34B 4TV8B 4BT6A 3I2KA 1Q74A 1KQNA 1JLLB 4XVRA 2YI9A 3DB2A 1CUWA 4DW1A 1WA5A 2H8CA 3IKMB 3B77A 2PS0A 2NV0A 3DEAA 1XJQA 4YCMA 4C4RA 3ASYA 1LGYA 2XI4A 1GP2A 1GO1A 4B73A 5K3FB 1TNDA 3ET4A 1G8HA 2IYAA 1UQRA 5J63A 1UPBA 1J6UA 2DQYA 2I0FA 5E3IA 4OUDB 4IEIA 2DOSA 1UMDA 3PNSA 1JR9A 4JLOA 3D3QA 4CN8A 3KPUA 4JB3A 1N9KA 5BOSA 3EZXA 4YI5A 2Y4UA 4FZRA 3FGOA 4KMOA 2DYKA 1T0JB 2HLDG 4ZKIA 3X1XA 2O3QA 3OQ1A 4ZQEA 3BJIC 4N65A 2BJWA 5E4JA 1ZI6A 4MSUA 3JCZA 5BSUA 1KAOA 4JT8A 4EJSC 4HRYA 1YA8A 4EZEA 2H17A 3UJ6A 3U1VA 2FU5C 2YS8A 4TYQA 3I5DA 2V6FA 1BKDR 5J2UF 3KM0A 2Y48A 4RVGA 1EUDA 1Z56C 4S3MA 4R8SA 4PLFA 4RV4A 1DX6A 2JEZA 4BVHA 1XN4A 5CA3A 1U8EA 5LQNA 4EO7A 4OG2A 3WBJA 4KRGA 1G8FA 3V42A 4K8OA 4IF4A 3UJCA 2WALA 1BQ4A 4OHWA 1BE8A 5HQJA 1KIMA 4C0JA 4G1UC 5B6PA 3VKFA 5DSTA 1DO0A 4ODIA 3DVLA 3ZQJA 5A3JA 4XVUA 3U3OA 3HJGA 4WOBA 2RBKA 4ENUA 5K6TA 3U7QB 5J5AA 5K05A 3R7SA 1JFLA 1ABEA 2EL9A 1KI8A 3IPCA 1T1RA 4JGGA 2FP4A 3U4AA 4QUKA 4RH0A 3COYA 4NABA 5CUQA 2FJUA 2YC4C 3PS9A 4BKPA 2CYCA 2XZLA 1Z6ZA 1HQKA 8ABPA 5KTRA 2W9XA 4K9MA 1R3DA 4CUJA 4Z7JA 2JPDA 4J42A 4E1VA 1M67A 2QTMA 4QBGB 1EFPA 3WV4A 3NTQA 1AI4A 2ODNA 4Z9YA 1JG4A 5HKLA 3OVMA 3NHFA 3OO1A 2H29A 3R77A 2HN9A 1CXZA 1BCSB 2LO1A 2P0EA 1XXHA 2I6QA 1K4KA 2GF0A 2G9NA 4B3GA 1T9GR 2NUPA 2VP0A 1XTUA 5B1AC 4BT5A 4GKKB 3BXXA 3ZWXA 3S1AA 4HBZA 1K8RA 1DOHA 5CVEA 4L0MA 5IANA 3OR7C 4QWMA 3I6QA 3OHMA 5IJAA 1FTNA 3CNQS 1IBLO 3WJ1A 1BQEA 3Q3IA 1NVVR 3HN2A 4RPLA 1P9LA 1XZFA 2G06A 1VQ4V 3TO5A 5CLQA 4Y7DA 2QA5A 2X4GA 1X9IA 3ZPXA 2NZ8A 1MRSA 4UAJA 4EKIA 3GAFA 3L7MA 4CQNA 3S1LA 4MJ3A 1U6KA 4ZGBA 2XRZA 4XFJA 3BREA 2H4ZA 2BHRA 3JD2A 3SY8A 2QTVB 5DISB 3NT2A 2ZJ1A 4AI8A 2ZRCA 4N8EA 1K75A 4YP7A 1NE2A 4Q3LA 1R73A 4AT1A 3U9TA 3AY7A 1K5QA 1VPLA 3QLVA 3DEJA 4BRWA 3NW9A 1K7YA 6YASA 1SOMA 7ABPA 2R1VA 2XZTA 4WZBB 4WQMA 2EBUA 3WLAA 1QX3A 1XXLA 2D0OB 1F5NA 3NHJA 2FX2A 1Y7IA 5AUNB 4BFSA 1OFIA 3O93A 1VQ7V 4MVUA 3HJBA 1JHRA 3O4RA 3QI7A 5E6RA 2P2SA 4DRZA 3P9QA 1EDBA 3JWJA 1UKBA 5ER9A 1SEPA 1AGPA 1YFKA 3RYCB 2UYQA 3CWZA 2HSJA 3EULA 3S81A 4EL0A 2HIHA 1JNXX 2AG1A 3RAPR 1V39A 3T3IA 1NUUA 3DZKA 3P9YA 1TUIA 3RS4A 4PBTA 3CLTC 4HAYA 1PR1A 5BMVA 3M1IA 2R8YA 3ZWBA 4JVOA 1Z16A 3LU1A 5A2QA 1OZFA 3RFUA 4XB1A 4DR5B 3KXKA 3M8KA 2EKDA 1NN0A 3GV0A 2YFYA 2XVMA 4CUKA 4IR7A 4W63A 3DXRB 3T0GA 3ZE9A 2JVJA 1YRHA 2VXCA 3BL6A 2QQFA 1SWWA 2OXEA 4XWYA 2QU7A 1A4XA 3MILA 3O3CA 5JFTA 2JFPA 4CM4A 1QG6A 1BGWA 1CR1A 4UU1A 1EGQA 4LSZA 1SKVA 4BJ3A 5GONB 1FVXA 3CNOA 1PZFA 2FCRA 1YZNA 1GX1A 2PE5A 5TB5A 5KWIA 4QIHA 1R6AA 4MWBA 1C7EA 4GUDA 3OKAA 5L3QB 2QPOA 3PEEA 5JY6A 4NU8X 1SKUA 3TJMA 5EHNA 1QZZA 1Y3IA 2AMVA 3GDFA 3E2MA 1VF6C 3RIXA 4URHA 2HJRA 1VI2A 4LWSA 2I2FA 2DSTA 3PJSK 1X7HA 5KNDA 3FTNA 2PUVA 3CW9A 5B1NA 4P4NA 4NKRA 2W37A 2ZITA 4DSAA 4V39A 3U9SA 3BK2A 1EK1A 3CLSC 1KR2A 5COAA 1YQQA 4D4IA 4Q9NA 1WX1A 1QF6A 3HDQA 1U28A 1LLDA 3EPKA 3M9LA 2DPHA 4M87A 1ISRA 3C5WP 4DYVA 4OD0A 2C3YA 1VGVA 3F5DA 4C81A 1DT5A 3HZOA 2YN0A 4OKIA 4JJKA 1EFTA 2NSLA 4G9BA 3EHBB 3UH0A 2LW1A 1YMQA 1MO2A 4YVFA 5BQFA 1V3VA 3KQOA 2HJHA 2QTWB 1U80A 1UEIA 1KUQA 3MRVA 3RSSA 5JAZA 3LA8A 2G0AA 1ZOOA 5EMKA 4FPXA 4O4LF 4MVXA 2WLLB 3DKKA 2QBYA 1JR6A 3EZNA 1QYWA 4H37A 3WHPA 5J23A 1J4AA 1ODTC 4JVMA 4WD3A 4R2KA 4QVKA 2Z6VA 1E6UA 4C20A 2ZJ5A 1U3LA 2FEAA 4JDPA 4OLFA 2K2QB 1A2KC 3HC7A 1HRKA 1I94O 1DJOA 1TAUA 3SE0A 4FOOA 4ENTA 1O9BA 1RWQA 1SUBA 2O6HA 3DMTC 2QDXA 3VPDA 2J0VA 1RXCA 4V0QA 5FOSA 5KJFA 4LDRA 2PU5A 2FVYA 3ANTA 4EX7A 3A0RA 1JYEA 1PQPA 2GCOB 4ZV4A 5KTNA 1NI5A 3CO5A 3D2CA 3IMCA 4OO3A 5COBA 4BMCA 2EULA 1NX9A 3ZV6A 5KWJA 1UMBB 2WD9A 2A9JA 4DMMA 2FZEA 3T15A 2QSAA 4AN0A 1I08A 3ANXA 1O3YA 3IFSA 1N4DA 3WIEA 3CJTA 3W7XA 2QTOA 1ECCA 3QU9A 3E7PA 1ZM9A 2A9FA 2X77A 4GPD1 1JAXA 4KQCA 1EZJA 2R8PA 1URPA 2BDEA 2HCFA 1M6HA 3DXFA 1GV0A 3DSRA 3X1DA 5JVDB 2HIGA 1OAPA 1X19A 2C77A 4KQ2A 2GHTA 4OA5A 1CS0A 3AHDA 1SC9A 1MSWD 3HVRA 3ZS8C 5IWAO 5IJ0A 3LP5A 3BXPA 3MBKA 2H6EA 3LRPA 4NQZA 5AW2A 2IK8A 3IELA 1H38A 3A4IA 3AEYA 4CIYA 4I55F 1C0KA 4MLZA 5CA1A 1O5TA 2W6JD 4FCTA 5CGQB 1K7FB 5TXGA 2ZAUA 1U5CA 3GPLA 1TF5A 4X1IB 3S3XA 2FW6A 1OYWA 4TTVA 1COZA 1R74A 4QUGA 2EKQA 3FWYA 5IYBO 1ZCFA 1VA4A 5GIPC 3RB8A 3IAM1 3RH0A 1PKEA 3OPQA 4XQCA 4ALIA 3M1AA 1GN6A 4UXNA 2IZ1A 3I9MA 3U4MA 5LDGA 2UXBO 3QEMA 4Q4JB 2A9HA 1WU8A 4R1PA 1NR7A 2VDRB 1M7BA 4NHEA 1VPVA 3BMNB 3R7LA 3PTLA 4B0OA 4FLZA 3HPRA 4BT2A 1MQ8B 5E38A 4YQZA 3CCJV 3TGWA 1EEHA 3ZJVA 2H31A 4YCBA 3B13B 5J5CA 2BFNA 2VRBA 3B51X 1MVNA 5F76A 3ICWA 1F2TB 1V55B 2A67A 3GUCA 3GJ4A 3H11B 3SBXA 4OQQA 2DF8A 2Q0HA 2V4ZA 3KOWA 1NQUA 4OU5A 1SCKA 2Q1XA 1JH8A 1S3SA 3AUTA 3HL0A 4NAUA 3GDWA 4IDEA 1QZXA 5JR3A 3ER8A 1A50B 1C7RA 5FUMA 1Q43A 4DV1O 1YJAA 2GILA 2A5LA 1ZH2A 4CJXA 2R9RB 3FLBA 2MYTA 2WAOA 4A9AA 4JYMA 3G8DA 1WHSB 3LDFA 5JWOA 5T8KA 1SD1A 3Q0IA 5JQWA 1RLIA 2FR1A 1YTUA 4D96A 5B57C 2VYND 2ID4A 4CMGA 3AJDA 4LDQA 4NEGA 4NBSA 2BCJQ 3SZMA 4I14A 5EZ6B 1EUZA 3UUEA 4BU1A 4D4HA 3WYCA 3KTAB 1QVVA 5JALA 1NASA 2WMOB 3C3PA 3AILA 3WTCA 4N0PA 2OFOA 3L1VA 1XYYA 3IXMA 3TD5A 1MX9A 1G5PA 1EUCA 1YB7A 1TOAA 2HYDA 4KQFA 5I9BA 4CZ2A 4HQNA 4RLHA 3RW0A 2I3GA 2C4TA 1WSBA 5I9TA 2NU9B 5KNCH 3O65A 1GPMA 2GVNA 3THOA 3ZRVA 4L8GA 2G17A 2RJ3A 2VPXA 3IV7A 5I4KA 1QORA 4AZ3B 4PGHA 2C8LA 3OMWA 4IILA 5HW0A 5ERXA 3N2KB 2WDPA 4MAFA 1PN3A 1MAHA 3EXEA 2YMMA 2WV7A 1J42A 5AVXA 4A0HA 4F9GA 1MO4A 2XMRA 4YRNA 3M70A 2G67A 5BQ5A 5HOEA 1PL7A 4B2IA 3FR8A 5HP7A 2QLFA 3BPSA 3GJ6A 4O2AA 3GGGA 4G5RA 4AY4A 4S04A 2ZBVA 3MYRA 4YR7A 4CC5A 2J5QA 1OROA 2HDOA 2WICA 4DJEC 4F2GA 2FEOA 3MRSA 4M98A 3RU7A 3PNQA 4EMSA 2QWNB 3N28A 2ZOSA 3FDXA 1PR3A 5A4DA 1DAPA 3ZWWA 1SB9A 4WK2B 2PGJA 3TRIA 4Y2HA 5EEHA 3WRYC 4UE6A 1DUIA 1AX9A 2FW7A 1QBGA 2VUSA 3QW2A 2E4ZA 3IPLA 3PZRA 3KIPA 2GT1A 4UUNA 2Z56A 4QNNA 1KTIA 3ZJUA 4YP1A 4OAOA 3DDWA 3QX7A 4MRRA 3OUSA 3NJ4A 1RCUA 2AFIE 3STTA 2HWKA 1UBCA 4Y2JA 1F60A 1QV6A 4MK4A 4POAA 4BNWA 3N3AC 3NC1C 3OFSA 3NNNA 1R4NA 1Q44A 2FZ4A 1U0TA 1TMYA 3FTDA 4HLDA 1B6RA 2XDWA 5FLXN 4E5YA 5MGNA 3BXFA 3OPYI 3ON1A 3DXZA 2BEKA 4YV2A 2X2OA 3VMMA 4W5RA 3BA8A 2P7TC 1CIJA 1K1EA 1V0JA 5E3JA 2AFRA 1C2YA 1NG9A 5BN4A 3C4JA 4DLTA 1UC4B 3LTNC 3TETA 4QM7A 4UVDA 1E96A 3KS9A 2NYUA 1J5EO 3VYSB 1P19A 1WTCA 3QHPA 4NF2A 2Q9CA 1QYRA 1OJHA 1KOGA 4WKOA 4LS3A 1C29B 2ZT8A 3N75A 1I0ZA 2C1XA 2DQ4A 2IZ5A 4L4XA 3A05A 2GQ0A 1E2NA 2A14A 1LEHA 3S40A 2A9OA 1B26A 1L7OA 3W7BA 3GBPA 5JFGA 5HXZA 1VG8A 4E15A 4KDEA 2IODA 2J31A 5CBKA 5IH3A 2ZWPA 1TAQA 1A4RA 1W5SA 4KQ9A 1ZGGA 3FDJA 1QHNA 3AC0A 1QO7A 1K2VN 3UAXA 3UXEA 4BQFA 2CDBA 2HTFA 2G3YA 2WZDA 5K8LA 3IT2A 4NAHA 3JVUA 4LPKA 3AK2A 1NC1A 1WXDA 4ND3A 8AT1A 5IKXA 4TSFD 4YUVA 3MBIA 1WA8B 1YCDA 3BKXA 1FYWA 4M37A 3OF2A 2HV8A 3O94A 2TMGA 2OUKA 4UTRA 3STHA 4JEIA 4EHIA 1X3SA 4MIEA 1DAGA 4WLNA 3QF7A 4C5BA 4BO4A 5TGZA 5M7EA 5AVWA 2HJ9A 1J0CA 2J0EA 4HVLA 4PSCA 5BN5A 1VLVA 1SHKA 3LQYA 2DPGA 5TMEA 2NG1A 3DZGA 5GJWC 4AXXA 3EG5A 3BK1A 3TMAA 1WXQA 1OX6A 5ELXA 1A5SB 1TL7C 2ZYDA 1NJ8A 1PAUA 1O8CA 2OBMA 4J10A 1U8YA 3CINA 2G1KA 2MMCA 1ENZA 2NVUB 4KLCA 4XQEA 3FVVA 4WWHA 3CX8A 5D01A 3JYHA 1N1DA 5AOCA 3G0DA 2INGX 1FJGO 5LGNA 3EGDB 3JATB 4JP3A 1T8SA 4HAXA 4G0ZA 1VFNA 4M88A 2V7QG 3Q7RA 4XYEA 3HBLA 3CTMA 3TUZC 3B1VA 3IJPA 4IQ0A 3A1DA 5FUQA 2HO5A 5SYMA 3WO0A 2ORYA 3U1TA 4MA5A 4DOMA 5LP6A 1MX1A 2CW4A 3EIHA 2JC3A 3CEMA 4WJLA 3KLMX 3DNPA 3T3DA 1SUWA 2EDAA 1K6XA 4Q9IA 4QTZA 1M34E 1TJNA 1FTYA 1DRVA 2KJQA 5HIIA 4UMFA 2FW9A 1T0UA 1MABG 2QG6A 1L4EA 2HU2A 4EKWA 2H8PC 5H59A 4U8GA 2HI0A 3JWEA 3DR3A 3CPSA 1HFJA 4WZ6A 2BEVA 2R8BA 4J90A 4U00A 5LBTA 4UV8A 3VYUB 1F4PA 3QU4A 1NVVQ 2ZB2A 1NMQA 2R6R1 3D4OA 1EWVA 1R0XA 4D42A 4C4TA 2D13A 3ID6C 3ABOB 4IINA 1KO1A 2ZYRA 3UK1A 3GLQA 1CW2B 1H8HA 1V1RA 1ZONA 3R9KA 3NKLA 3K08A 1TB4A 5JANA 4MROA 1M2EA 2FSGA 2IP4A 5DI3B 1FUEA 1Y5RA 2L18A 3V34A 2F9ZC 1T9AA 2ZYVX 2PX4A 2JHPA 2R6DA 4YR9A 4PFQA 3DMGA 4JR2A 4XDZA 1U31A 2J5RA 2I3DA 3REQB 5IU6A 1VSVA 5LQRA 4J1NA 1QR9A 3W1EA 2X5JO 1ZKMA 3C1UA 2ZU6A 1E6LA 4AS2A 1UP6A 4CR6A 3HJNA 1EDOA 1AHNA 3LYLA 3LCUA 1JHYA 1AGNA 4R1NA 5AW3A 2ZM6O 5K3CA 3WKBA 3FTPA 1CP3A 3HZRA 1UC5B 4QOEA 1AF7A 4JBLA 3NHYA 2P1RA 2IZ6A 2X9VA 4KN8A 3PCXA 4XJXA 3AVVA 1TGVA 1CB0A 2JKVA 1OPXA 3DL4A 3VGPA 1KFKB 1BL8A 2VAVA 5JC1A 4QTUB 1ZRNA 1Y1TA 5EJ5A 1QX4A 4E30A 4HDKB 4B76A 1K8YB 2UKDA 1FTGA 1U9IA 4DFDA 4Z4FA 5F52A 3E05A 5HA5A 3DV0B 3ZBQA 3RADC 4AO8A 5CYPA 1DAKA 2IWRA 4JTAB 2ZIXB 1XTBA 4CDMA 2CXQA 4IUDS 2BUAA 3T9AA 1EM1A 1JG2A 4BZZA 5BWBA 1CWUA 4FOTA 4HLNA 5E9AA 4EOGA 4GX0A 1PJ2A 1QAHA 2B2NA 4AVYA 3GJ7A 4GUAA 2O8DB 3ORFA 1JTVA 3EG9B 4ZC8A 4Q37A 3PQ8A 3RRNA 3CCEF 3UYLA 4JOBA 3EFEA 1W59A 4FQ7A 1W76A 3EIUA 3F97A 1E2GA 3RVDA 4BT4A 3U26A 4TKUB 2LWIA 4M8SA 5JNLA 1R2QA 1KYVA 4CM1A 4CN9A 5ELMA 2A2ZA 4I1VA 4DRYA 1X8LA 2VZEA 3K9QO 1YVRA 4NBNA 2Y93A 1H8HD 2C8VA 1AXEA 1T8YA 4JDUA 4YMHA 3UA3A 3KAQA 2WG0A 3FOAA 1S3IA 3KQMA 3I0ZA 3M6UA 2NZUG 1YJBA 3L0DA 2VYCA 4FD3A 2NV2B 2YEVA 3A10A 4UE2A 2NO5A 2HA4A 5G3ZA 4PFSA 3H5LA 1QH1B 3SEAA 5L7YA 2XYQA 5C8YA 1PG0A 4FFMA 5JY1A 3GMIA 1ZD5A 1Y76A 3NFYA 1MV8A 2WLMA 2ROQA 4K6MA 2DJ5A 2GN4A 1ABBA 4X6UA 4IIJB 1RYZA 3GZNA 1BRTA 3U16A 3PK0A 1MP0A 4V0RA 5EIOA 5LWQA 4M99A 1QF9A 3QELB 3GN2A 4PM4A 1F2UA 4QU8A 4TL7A 1RRMA 5KVAA 1WBDA 5KYWB 4I8DA 4KN6A 3FPCA 3ENNA 4ETIA