4YJ2B

Crystal structure of tubulin bound to mi-181
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of potent anticancer compounds bound to tubulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4yj2B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4yj2B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4yj2B01
3RYCA 5IYZB 3JATB 4I50A 3ZIDA 4LNUB 5CB4B 3N2KA 2Q1YA 3RYCB 3JASB 4EB6B 5BMVB 4DRXB 5LA6A 3HKDB 3WGJA 4I55B 4X1YB 4EI8A 3JARB 1SA0A 3JASA 4EB6A 5BMVA 3RYIA 4ZHQA 3N2KB 4ZOLA 5CA1A 4KWEA 4X1IA 3E22B 4B46A 4LNUA 3ZBPA 5LP6A 5IYZA 3VOBA 3WGMA 2RHLA 4I50B 4I4TA 3VPAA 2BTOA 5EZYA 4I55A 4IIJB 5IJ0B 2R751 5LP6C 4X20B 2VAPA 4F6RA 4YJ2B 1W5FA 3C8LA 1RQ2A 4O2AA 4O2BB 5LXTA 5JQGA 5J2TA 4TUYB 5LYJA 5J2UA 3HKCA 4YJ3A 4TV9B 5CA0B 5ITZB 3WGNA 1TVKA 5JH7A 3VO8A 3JAKB 4ZI7B 5KMGB 3M89A 4O2BA 3HKEA 1Z5WA 4X1KB 4O4HB 1RLUA 2VAMA 3CB2A 3JAKA 5MN5A 2BTQA 1OFUA 5IJ0A 1TVKB 5JH7B 4HNAB 4O4LB 5EYPA 1W59A 4TV9A 4WBNB 5IJ9B 2VXYA 5LYJB 1FSZA 1RQ7A 3RYFB 5LP6B 5ITZA 1W5AA 1W5EA 4ZOLB 5CA1B 3RYIB 4ZHQB 2GVIA 4U3JA 5KX5A 4X1YA 5M7EA 4TV8B 4XCQA 3RB8A 4I4TB 3JAWB 3VOAA 5JCOC 5EZYB 3HKBB 3JALA 4O4IA 5MN4A 1FFXA 3V3TA 1JFFB 5FNVB 1SA0B 2VAWA 5JCOA 2RHJA 3HKDA 1TUBA 4DRXA 4U3JB 5KX5B 5CB4A 2XKAA 1W581 1JFFA 4IHJB 1FFXB 4X1IB 4O4IB 1W5BA 5EIBC 3HKBA 3JALB 3RYHA 4O4LA 3JAWA 5C8YB 3E22A 4FFBA 4U39A 5EIBD 5FNVA 2R6R1 3N2GB 3WGKA 4M8IA 5GONB 5LOVA 3M8KA 5KMGA 3JATA 4WBNA 1Z5VA 5JVDB 4YJ3B 5CA0A 5J2UB 3UT5A 5MN6A 4TV8A 2Q1XA 2BTQB 5LXTB 5J2TB 5LOVB 2RHHA 3ZBQA 4EI9A 4O4HA 4X1KA 4O4JA 4X20A 3RYFA 3VO9A 3WGLA 4B45A 4ZI7A 5IJ9A 4IIJA 4HNAA 5EYPB 3UT5B 4TUYA 4EI7A 5JVDA 4O2AB 3N2GA 5JQGB 4F6RB 5GONA 4IHJA 4O4JB 4YJ2A 3R4VA 3HKEB 4DXDA 3JARA 2XKBA 1TUBB 4E6EA 5C8YA 5LA6B 2RHOA 3HKCB 4FFBB 3RYHB
chains in the Genus database with same CATH superfamily
1PF7E 1W8IA 1E62A 1GNRA 2A2ZA 2AD5A 3HVHA 2B83A 4R9NA 2ETXA 4KOEC 2YMQA 3U62A 4FKMA 3ZV5A 2ZJ8A 5A1TA 1DQZA 3ICXA 3SQDA 4URVR 2QSYA 4B6GA 1GGMA 3EVDA 2WG0A 1JJAA 1RYZA 3B3AA 3I2FA 5JHHB 1NPDA 2FWIA 2V9CA 5IW8A 1Z0IA 4LV6A 1EVEA 1IOLA 4H7HA 4HPJB 4IIUA 3MQ4A 1PV2A 4YALA 2VH1A 1H8HA 5IANA 2X76A 3NHUA 1NJ8A 4XM0A 2RJNA 2SBTA 4COKA 3UJ7A 2G9QA 4JI4B 3ABIA 2H06A 2EZPA 1C8LA 1JJ7A 3BDIA 3R23A 5JT1A 1DWOA 1FDRA 5NLLA 3MFYA 4XZ3A 1GPBA 4YC7A 5EWMB 2Q5ZA 4W5NA 1NXPA 2P6MA 4B7XA 4KXMA 2FB5A 1W36C 2VHZA 4CEIB 3FE2A 4EX7A 3K0TA 2HA3A 3C1TA 4WFQA 2VH5R 4CGYA 4W9MC 3H86A 3E6AA 5TPWA 3W4IA 3R7DA 3E9ZA 2XSZD 4R8VA 2XIQA 3RJTA 2IJJA 4KW7A 2AMFA 4GRIA 4Q3LA 3RJZA 4FPPA 4LFCO 3SDZA 2OXFA 4IJKA 4BJHB 1M93A 5DM60 4J1NA 2CLHB 3JQGB 2JCYA 3IUBA 3PR1A 4JB8A 3B52X 3RVNA 4QXMA 1W4BA 1JFRA 3QJYA 1H1DA 1P6QA 2COKA 2YOGA 3BXGA 3C1UA 4CKBB 4OI1A 3KVVA 3E5MA 2DFKB 4MSUA 5BXZA 3QPBA 5H3LA 4GLJA 2C03A 4M1QA 3EORA 3HB9A 1YE3A 4K35A 1O96B 2HO5A 2PWYA 4DR5B 1SQ6A 3O8OB 1V11B 4FYJA 3N6VA 4KQ1A 4OJNA 1NTOA 1RVDA 4CLOA 4HYOA 3N2NA 2WA2A 5DU2A 4TWBA 4BFUA 2ZSFA 4E08A 2DYKA 3ZDFA 3CPWU 5LHGA 5F98A 3DC6A 4U02A 5IPFA 3I52A 4M1EA 3RSQA 1J8FA 4CMIA 1T8UA 1ZQ1A 3JQ7B 1T9CA 4P83A 3T5CA 5EJ8A 1ZL0A 3VNSA 1JEEA 1I6KA 5FDFA 4TZZA 3DL2A 3IXLA 4PXSA 4IJUA 5EUCA 3CLUD 1C9MA 1YU6A 1W3EX 1EUDA 4EYGA 4A2CA 1M5TA 2AHOA 1OZAA 2CXXA 2XT0A 4ER3A 2WWYA 2G77B 1Y6FA 3HFGA 1KP3A 3HDGA 4S1VA 4GT1A 1QC5A 4OHKA 2NU7B 4WK2B 1L7BA 4Z1OA 2O2JA 3LX8A 4KRFA 1DTEA 3DKVA 4GR9A 1D9XA 3QYPA 1BXGB 1L5VA 1QUEA 3UG6A 4NMMA 3UXYA 1W25A 1R5BA 3OIVA 5KHGA 3LTEA 1V8PA 3VNUA 4YJFA 1RTTA 2IH1C 3BXEA 1GA4A 1UFOA 2ZE8A 2J08A 2QYHA 2WHYA 1X42A 3O0TA 2DC1A 4KBYA 4K9QA 4WVLA 2M6KA 1VQ7V 1SKYB 2YNMD 3PTZA 5JWHA 3URKA 1XMQO 2V1XA 4OJYA 3WYDA 2EX0A 4BKMA 5KWSA 4DO2A 2NT4A 1M0TA 1DKRA 4JA2A 3HJAA 4D8YA 4MLDA 4A8JB 1O1YA 2XNKA 4M0CA 4RF3A 1WEHA 3W1EA 3AEYA 2A0WA 3U0VA 1P7BA 4RY2A 121PA 4NBWA 1TUBB 2OD7A 2IELA 1OHHG 2Y8EA 2ZB7A 4PO3X 4RXMA 5JEEA 4JWTA 1QQ7A 1A4UA 4N8SA 4NONA 2V7BA 2YS7A 1MAVA 1Z83A 3F7MA 3OCZA 3AR8A 4PU0A 3OCJA 3BGSA 3WVNA 2XXAB 4L5CA 1XSEA 2R6ZA 4WY2A 1N3BA 1TC1A 3K9AA 3JASB 1J7KA 1U9IC 2HBZA 2ID9A 3JS5A 3EFOA 1QIJA 4RWUA 4GYYA 4MW5A 1M54A 3RFXA 3GEHA 3PCTA 1PZHA 3UJBA 3RUIA 4B33A 2I6FA 1EAYA 3MJEA 2YFQA 5KAIZ 3EDOA 3OCVA 2BFOA 4NZNA 1A3CA 4LJRA 1AROP 1K9VF 1Z82A 2ADOA 4GP9A 4YCDA 2WB2A 2GBIA 4EHAA 2NQ8A 1GPMA 5AM0A 4DA4A 3RFRA 5DGXA 2F90A 2OHWA 4FWBA 3OZAA 1RM0A 1JPVA 4NYIR 4KUGA 1E6KA 3VR2D 1U4SA 4R6ZA 2EFGA 2NSLA 2FSPA 1T2UA 4IQ4A 5F1KA 4IFEA 5A4FS 5EHQA 1LDYA 3A04A 5KJEA 2IHVA 4ODIA 4D4JA 3TDMA 1OAAA 4AY2A 4TV9B 2ZRDA 1K2WA 2IYLD 1Q2XA 1PZMA 4DLLA 4QQNA 1YQTA 1JQAA 1VPVA 2AFHB 3OIFA 2WLLA 3PKZA 3R1IA 1LDEA 4ZO8A 1E1RG 5K0ZA 3BE8A 3DEYX 3WP0A 2YY5A 3EYWA 2ZRGA 3RQSA 5ADWA 4UUJC 1YTFD 1G5HA 3DNMA 1N0WA 3GB9A 4WKGA 3VGPA 3RYFB 2CK3G 2PZAA 3HE3A 3IBCA 1ZHOA 3DW3X 3VYUB 4P0PB 3U5ZB 3PL1A 4AULA 2R6JA 3TI7A 1AU9A 1J0CA 2G28A 4DQUA 2JGDA 1M1ZA 4KXRA 3HJBA 3VTIC 1NE2A 1Z2NX 4PR0A 3VU8A 2YS8A 1GGKA 2ZBPA 2OIEA 1CP9A 1E4OA 2FEMA 5JUWA 1THZA 5D86A 3RK4A 2VIIA 3ZHYA 2AB0A 2PR7A 5UKDA 4TTTS 4MUGA 5FIUA 4OX9Y 1LVGA 1W88A 1XCOA 4QJ4A 2C82A 1SNYA 2IYUA 3VO2A 4D25A 2EG9A 3AGPA 1JHVA 1EGHA 3R7AA 1O9HA 2W6CX 6REQA 5JDIC 4EG8A 1IG0A 2G9UA 1C3OA 4IT5A 5D8DA 1B2LA 4FB4A 2FRXA 3BHJA 4BNDB 2DQKA 4RV5A 2EHJA 3GQVA 3WOVA 3DFIA 7GPBA 1PTJA 4OXQA 1Z4NA 3IVCA 3C14C 5B4TA 3CVVA 3FB1A 4QUBA 4KCGA 5CNKA 4DIUA 4I46A 1KJJA 2CDAA 4E2ZA 4GSYA 3T9CA 2KQUA 3WSTA 2J45A 1M34A 4JEMA 6NULA 5FOTA 4B62A 3H1IH 1JQ3A 5HP7A 1MN6A 3KTDA 4ZAGA 3ZGYA 4HEHA 2QTRA 3TW0A 2A1UB 4EELA 3D0KA 3QVWA 4IOLA 5M29A 3VR1A 1IAQA 4G5OA 2W6JG 3CRCA 1DFGA 1UUFA 3IIMA 4HZIA 1OXUA 4YP6A 5FO0A 1OD6A 1DCMA 3QEKA 1USVA 2PUSA 1QIFA 1UPAA 2Z04A 4KEAA 2F00A 2IW1A 3X2FA 3BE4A 1G21A 4RYDA 3SQLA 3CE6A 2A3QA 4JA0A 10MHA 2MHCA 4MR9A 1JBQA 1NIJA 5GGXA 3SLGA 1F8YA 3CEIA 3LZ6A 4PC1A 3C5HA 1MG0A 4FOOA 2XDAA 4K2AA 1V2GA 2XLBA 4R7TA 5JD5A 3BMQB 1XDDA 2OBNA 1UBUS 3KTAA 4ZV9A 1KDVA 3RTAA 2H1FA 3WB1A 4LC9A 3ZXXA 3PC2A 4ZGBA 1UBLS 1SQFA 5J58A 1CLUA 1S5LZ 1QBGA 4X8MA 4ER6A 1VE6A 3BMXA 3EFHA 3NJRA 3SDSA 4ZIRA 2XODA 1CLEA 3DJYA 3IERA 2RCYA 3T34A 3ZP4A 3DEIA 5EWRA 3O8QA 4OAQA 2Z08A 3OFSA 3RLIA 4ARIA 2ZBEA 5KYYB 1X19A 2COUA 2M1ZA 2NNWB 2OORA 4C76A 3QPDA 3X43A 2XUMA 2O59A 4DILA 3FOFC 3W6PA 1E2IA 1KJ8A 3A6ZA 4RNDB 3W9YA 1EQAA 1S3IA 2J3DA 1N77A 3C4VA 3CKLA 4YRJA 2BJVA 2UZ3A 4UFPA 4FLWA 1YJNV 1J97A 1K5HA 2ZRLA 3GAFA 4D98A 2KKWA 1RYEA 1TD1A 2EQBA 1UP7A 1MQ8B 3O8QB 4DARA 3FTQA 4DAOA 3IEKA 3VZCA 3VDMA 4A0FA 2HU7A 2AS0A 3EOAI 4ZTBA 4YCJA 3UIEA 4OXRA 3HUFA 4C4RA 1TW3A 4F3YA 2R751 2VQSA 3CF0A 4Z99A 3IQHX 1I0IA 3CMMA 4WK0B 4Q34A 1WMSA 5HIJA 4EW1A 2O0MA 1C9EA 1E60A 2Q9CA 1W85A 3OO0A 1YASA 2P9TA 4PYIA 1NJFA 1NY6A 2IYFA 4RVFA 1SXJA 1II9A 4P3YA 2JS7A 4PS1A 1IRIA 3IMPA 3UAGA 3ZG6A 1K34A 1K7SN 2MTBA 3TFOA 4C81A 3KV1A 3HXOA 3F0TA 4NUTA 1T2NA 1I3KA 2JRLA 1UMCB 1XMPA 3MUEA 4FN4A 4N39A 2Q6TA 2Z09A 1NN3A 3S03A 3MXOA 2PGIA 4FQ7A 5AW8A 2HDWA 3T1YO 5BY1A 4OHWA 4G4GA 4Z0TA 5GVRA 3Q6NA 3A1TA 4DV2O 1RHQA 4YAEA 3GGJA 1N2OA 1H6BA 1XKLA 1TGOA 3HBAA 2XYHA 5LQKA 3MD9A 4IVRA 4P93A 5AK6A 2N04A 3VH1A 5I7WA 2B8EA 2RKOA 2ORWA 1SJ9A 2PLAA 2JK0A 4X7PA 1AI6A 3LUKA 2WF6A 4JB3A 3DMGA 3E15A 2UXDO 3OUTA 4LYDA 3AF2A 4X3LA 3J81N 3HCDA 1DJPA 1W9HA 1Y5IA 4FC7A 1PNOA 4AL4A 1VSUA 3EGEA 5JE8A 1J49A 2J32A 5BRAA 5F9HA 3IQZA 4IV0A 2FOXA 3AH8A 2PUJA 4QBFA 2V97A 4TKMA 4B7CA 3E2PA 4BV9A 1WF3A 5AUPB 3WAJA 5KEIA 1CUJA 4KIGA 3VZPA 1Z45A 4JJKA 3G85A 3BD7A 4QECA 3QHDA 2GFHA 3G3EA 3I92A 4G1EB 2N42A 3M6UA 3FUVA 3K1YA 1K3TA 2HF8A 1ZPDA 1I51A 1XHLA 5CM2Z 3B85A 3DE4X 5CDFE 5L3QB 1E5XA 5CX4A 1SERA 4BV2A 2ET6A 5GIOE 2AMVA 1Z4QA 2VZ0A 4B08A 1L8QA 1USWA 3B8EA 3D5QA 2FQWA 2DWDC 1ADYA 4QRHA 4DJFC 7MHTA 4WCFB 1T9ZA 3F2IA 3FETA 3OTWA 1LB1B 4I9UA 3ENWA 5BN3B 3UJ8A 1M74A 1GRQA 4KYTA 2VSOA 5GQSA 3A0RA 4LOKA 5CHYA 5BWLA 3OJFA 2B92A 2VHCA 2YR0A 3RIMA 1HR0B 2Z9CA 3FD6A 4PLZA 2C7GA 2BSXA 2GCOB 2VT3A 3C97A 3E9QA 3FPLA 2HKOA 1IQUA 4UUQA 5AKGA 4G1MB 3C1AA 4TQAA 3WOHA 5GAJA 4EJSC 4QJ3A 3ZV3A 2C2ZA 1SBNE 2OGWA 1I6WA 3PWTA 1UXJA 2X5XA 2H94A 4PGGA 4ER7A 4GX2A 2UUBB 2PKCA 1V9PA 5IYBO 3G0GA 3M1YA 4WA8A 3TM5A 3ZD7A 3RSSA 1KVUA 5LD2B 3T1QA 1H0KA 3DAPA 1PBTA 1WV1A 3U49A 2GQ0A 1FD9A 4CYMA 3TNYA 1P4RA 4CH4A 1KYYA 3EYAA 1LK0A 3V2UA 3ENNA 1SKAA 5KQMA 2O19A 1ONNA 3RC2A 1WBDA 4A8TA 1RSOB 4X3PA 1W44A 4GBED 1AUXA 1FQKA 1M1UA 4ED9A 4Z4CA 2FPKA 2OR3A 5HUHA 3L02A 2YW2A 4L5AA 1F2TB 3WIEA 3ZIDA 4C4ZA 4D42A 4KLNA 1CUHA 2R4TA 3MTQA 4G28B 4DMLA 1QYIA 2L69A 3R6WA 3VUEA 3IHLA 4Z4EA 1EEXB 3OQOA 1SQPH 2X1MA 3KKYA 9ATCA 5FT9A 1F9AA 2DQYA 1N5KA 4YBZA 1RWWA 3C4JA 4LA4A 3IE0A 2V4UA 4Y1GA 1DDIA 2G5PA 2RGCA 3HCWA 3W5UA 2BEJA 3HYLA 5HFLA 1QGYA 1GXSA 3P71T 5JY1A 3AERA 4IIJB 2C2GA 4EUEA 1P91A 4MWBA 5IJ0B 2YYAA 2AI2A 4KP7A 3REQA 4BQEA 1P2GA 4UB6Z 1AD2A 2HSJA 3AOEC 3PRKE 3GZ4A 4M1MA 4QUIA 2E48A 1L8LA 4UBIA 5AKLA 3T7CA 4DA6A 4E2WA 4EFLA 4FMDB 2HP3A 1VQ4F 2HCFA 2X3FA 2R6HA 4HDRA 2IYNA 5TT0A 2HQSC 4D0GA 5AVXA 3NNDA 1Y7IA 5F12A 3TKYA 1DXQA 2DN9A 3ISTA 4J4HA 1WKCA 4KYVA 3QUQA 4J16A 3L6BA 1UPGA 1IURA 4DLYA 3JQDA 3RS7A 1WEKA 4BO1A 1RIIA 1ORQC 1ZUD1 4AG6A 2C7OA 5KBYA 2Q0HA 4DUGA 1P4JA 2F8LA 4JBWA 3CPEA 3AEIA 1YKSA 1RADA 1LZKA 4FGUA 1EP2B 1UM9A 2A9VA 2FDXA 2HU8A 3EGDA 3N2YA 3AB3A 2DUJA 1QWOA 2XMGA 1R3IC 2WM8A 3B2EA 4NOKA 4QJIA 5BOSB 5DNCA 3FBWA 4MX8A 4LNAA 4YP0A 5DIZA 2P79A 4DJEC 3UBTA 4B71A 1QKKA 2CVQA 2DTXA 3GP3A 1PL0A 4M9UA 5JS1A 1SBZA 1VMAA 3BXPA 2RHBA 3AG2C 3V3TA 1TEHA 3ZX6A 1H0HA 2VDLB 1NVEA 2YL2A 2YX1A 2EJTA 5D3QA 3TKAA 1JOYA 2QD3A 4HB0A 1JHZA 4NFYA 1MOPA 2EWVA 3UPDA 4DLVA 2GZMA 5E4TA 5G4LA 3ZK9A 3ITDA 3TTUA 4KR7A 2OCIA 3P4XA 4YPOA 2M98A 2FYTA 1OFTA 3ZBHA 2B1QA 2OKCA 2FQXA 1WHTB 3WLFA 1H9BA 4UOZA 2VT6A 5A3QA 2ALJA 1JKIA 2B4RO 1PL7A 5KA5A 1CK2A 1PD3A 2PGNA 3GK3A 2W00A 3QF4B 2W0SA 4H3VA 4RL6A 4DV6B 4AX8A 4RTPA 2GPJA 4QZVA 2KMLA 3WG7C 1TMOA 2KSQA 1YZUA 1MZPA 1U6IA 3EH1A 3FLEA 1BVYF 4LZPA 5E9JA 4WOBA 1PGJA 4RKWA 2AMYA 2DUWA 4U4AA 3QG5A 3T4DA 1Q3HA 4JFAA 1QGED 1AXGA 1OPRA 1U99A 2HMUA 1TZBA 4IVPA 3TFWA 4QT4A 1H2EA 1C8VB 2ZXWC 5A3VA 3BRSA 4JLBA 2AF3C 2NNUA 1KI8A 2HBQA 3BJZA 4LQCA 2DJIA 4U9UA 2P2GA 5KYKA 4DLTA 2Y4UA 3M9LA 1Z13A 1M75A 2CEAA 2IW3A 1S3FA 5DHFA 3NBFA 2P27A 2WZQA 1W8DA 2PZSA 2AOTA 2OBXA 3LUFA 4P2ZA 1H94A 3O4RA 2VC2B 4FW8A 4TWRA 4UDXX 2FE4A 2ZAGA 1PJ4A 5DK4A 4EJSB 1K8YB 2R87A 1HH4A 1X92A 4JLDA 3PA8A 4P4SB 3GMTA 4GRDA 4F2HA 3DQQA 4IHJA 1BH6A 3LRXA 4FDLA 4FFMA 3DDWA 1XHZA 3I73A 1JJ2F 2HREA 2VYND 3CU5A 4JAUA 1EZ1A 1K5DA 4RNCA 1RQNA 3ZVMA 2A5FA 4QOIA 3DVAB 5K3DA 2ZBQA 4QXOA 4EABA 3AHHA 2LV8A 2B8TA 3PK0A 3Q6MA 5DTEA 4XTRA 1WE2A 1FBTA 2JGFA 2QMUA 4NE2A 3OTFA 2QYTA 4LGYA 2VDWA 4YRMA 3AR9A 1EUCB 1BKSB 5CGZA 4ZIRB 1CN7A 2IUFA 3HB5X 4N5DA 1EA5A 4JDUA 3WGJA 4NESA 3GLIE 1JW9B 2PSSA 3LYLA 3O3OB 3VBEA 3KDPA 5C5IA 3CPWF 1YUMA 5EG5A 2O8CA 2UVPA 1KYQA 5CIQA 1QNMA 5K8IA 2QU8A 1GRCA 1YVUA 3DZIA 2BTOA 4UATA 4XD7D 1Q50A 1QVVA 1HNWO 3AOEA 3BPSA 5U4XA 5ES4B 5GTDA 2HD4A 16PKA 1QSGA 1DUVG 1YZFA 3DO5A 3NONA 5DO9A 4YWJA 2OFWA 2PQ2A 2P0EA 3EGDB 2DWPA 2HQSA 1OC4A 4ITRC 4JX8A 1NVPD 4MKIA 2CNOA 1V8DA 4NENA 1QGUA 2ZB3A 4H60A 1XJQA 4UDYX 4DR6B 4ER5A 1BWSA 1YL7A 3ABOB 2D06A 1TQ8A 2WQZA 2H9YA 5EAIA 1V1RA 1N5IA 1M2JA 1KK2A 1WQ4A 3W5CA 3FVTA 5CBPB 5GGYA 4JLWA 3H2HA 2GXAA 2YDEA 2PMPA 2A0KA 1TPZA 3EVEA 4HDRB 1A76A 3TLBA 3ICEA 1DUSA 1OTXA 2RFLA 1CT9A 1RI4A 1D3AA 2H2DA 4ZCPA 1HNXO 3C3YA 1RJ9A 2JJ1G 4JGBA 2OGTA 4GMKA 2GRAA 3LZCA 4X3OA 4H15A 5DBFA 5A6SA 4JUIA 3ER6A 1J7HA 2E4UA 2RCVA 1XROA 1PL8A 3AFMA 3D0QA 4G65A 2EJ7A 4FZ3A 5KJCA 3I9FA 3CBQA 2QL5A 4CMEC 4TRNA 5C5DA 2CDYA 4TZTA 4BBPA 3CG4A 1MOSA 1Z8HA 5DNDA 2X6AA 1R8JA 3I55V 3Q1LA 2QG9A 4EK9A 5M5BA 1TIBA 1Z6AA 2A3RA 3FAVA 4MSWC 4J1QA 1Z5GA 4QOGA 4CKWA 3L7AA 3U37A 1ABEA 2C57A 4ZVTA 2C7RA 1JJOA 4GGPA 1AP6A 1P9LA 1AP5A 3UA3A 1MEEA 5DHQA 1U7XA 3QVVA 4YRAA 1GTRA 3FGOA 4Q48A 1RZRA 1P81A 2V1UA 2UUBO 2B0JA 4DSNA 3F6EX 3IPRA 4L02A 3CCUV 3VTKA 3ZIAA 3UMFA 5H2FZ 4PHFA 3V97A 4ZPXA 2JJ8A 4BU0A 2W6NA 2GDSA 3HYNA 4YV1A 4TSFA 1TMKA 2IOYA 3WB0A 3K0AA 4A82A 1X9IA 3OM9A 2F3SA 3F5FA 1KDZA 3T99A 1U0TA 2GZLA 3CQ9A 6Q21A 2ZRNA 5JCZA 5BOVA 4MS4B 1QU2A 4ZAZA 4PANA 2CUKA 5C31A 5DASA 4CBVA 4LF7O 3GCXA 1FKAO 2GJKA 2QD1A 3D6FA 1GO1A 3MDOA 2ODBA 5KAPA 1F6DA 2D5AA 2JIQA 4BGIA 4I1PA 3RAPR 1ZD1A 2IPXA 1NP6A 1TK2A 2IHZA 1YBFA 2REQB 3DTYA 3M6FA 4UCFA 5I7EA 4B45A 2Q1SA 2QLNA 5BSHA 3BCUA 4PA3A 1G98A 5IBQA 1WKVA 4HNAA 4DJAA 5A3RA 4IBOA 3AEQA 4JR1A 2ZE5A 2JA1A 3LCRA 2JEYA 1ZEJA 3GJ4A 4E94A 3SZRA 2M32A 2FR1A 1E0JA 1OU0A 5EHGA 3NYQA 4B3SB 1KR2A 2GA8A 4MZDA 1QGAA 5DBIA 3IP1A 4J7KA 1S9HA 4UVIA 1R6BX 2A86A 2EBFX 4ILEA 2QT1A 1WDWB 3IEVA 3JQQA 4B9AA 3T35A 4YDSA 2QKYA 5ADUS 1DRKA 1IC6A 4H37A 2XGGA 4FE3A 1Q86H 2IPOA 3E9NA 1ZYUA 3DBHB 3DVQX 4MYRA 5CBKA 3I83A 4J7XA 5K2MA 3ZU5A 2Q3DA 4UE2A 4ENUA 1DO8A 1Y4SA 3FSEA 4HX2A 3SZ3A 1Q81H 2EFEB 2YDYA 2KG7A 3GC6A 1Q90D 1EFRG 4UFOA 1JCHA 2G0AA 4BZZA 4GVPA 2Q7HA 3T1TA 2CUNA 5IYZA 3DHVA 1R50A 1Y3FE 4Q3EA 4HNVA 1THMA 4YV0A 1UZUA 3QELB 2OHFA 1V11A 3TETA 2R2AA 3AI7A 4BNUA 3KBBA 4BNTA 4LYYA 1JR4A 1VG0B 2NO5A 3R3VA 1VQ1A 3L77A 5DEOA 4PZ9A 1XZDA 3AR5A 5H4HA 3WIDA 5F2NA 5JCPA 1PO7A 1QHSA 4UNSA 5CIYA 3EF1A 2AFVA 2FPGB 1BQZA 2IVFA 2XTMA 3EGWA 4HXGA 4P5PA 4CIAA 2O3UA 3N58A 2ZDQA 4K28A 2IQQA 1Q86W 1GA1A 4TLMB 5FKJA 1BHSA 5T8KC 1VQ5V 4PAOA 8OHMA 2C0PA 4RTOA 2VAMA 4G89A 4G4WA 1G3MA 2IYOA 3S06A 1OBCA 2QJFA 3GUVA 2AEMA 1EP1B 2DPHA 2E21A 2AH5A 3HHPA 3KZVA 2BTQA 3PEWA 4NR0A 5AOCA 4J9UE 1RKXA 1YRHA 5FP0A 3D81A 3C3TA 1VP9A 3ZGVA 5HSGA 3B12A 3OTOB 2BGWA 5KKCA 2XSZA 1M2OA 1RAGA 4B2YA 4D1YA 3E8GA 2P2YA 1KERA 2FYUH 3BQMB 3GIWA 2IYQA 4LKOA 4M99A 1HFJA 3OQ1A 5T5QA 4JHLA 3USCS 2FGJA 4I8DA 2Q67A 1D09A 1G60A 2AN4A 4I1RA 1GZ4A 3QELA 3EUWA 2TS1A 4QD3A 3CBGA 1IHDA 2C42A 1JWAB 3PWZA 2OZPA 5AKZA 1OAOA 2Z5GA 5FNVB 4OBBA 1YWGO 2GRJA 1W93A 3DV0B 4O2RA 4UPVA 2HNAA 3WL5A 1CIJA 4BIMA 2RHJA 4EO9A 1VHLA 1GZ6A 1Z26A 2PZJA 2ZUFA 4Q03A 1VPLA 3OEHG 3KQOA 4ZO4A 5CB4A 3LO8A 2ODWA 1RHKA 1U8EA 1XZKA 2MMCA 3D0OA 1NVFA 3PR3A 4JI3O 2QZ9A 2GLUA 3BUSA 3GJXC 4GMXA 3TLMA 3OQJA 4CDRA 2X6BA 2XUGA 3WLHA 4CM8B 2JIZA 1YJQA 3OCCA 5IRCD 4QOHA 3GLTA 1ZXXA 3DE6X 3OBYA 1A8HA 1ZMRA 2F55A 4X41A 1UJ2A 1EK5A 3A6JA 1GUYA 3CX4A 4JNCA 1CJMA 1KOFA 3K0CC 4PD4F 2OHHA 4ZI7F 2XT6A 1D03A 4O8ZA 4K3AA 4OPHA 1DX4A 2Q4OA 2ZAUA 4HDAA 4RC9A 4TV8A 2JJQA 4MV1A 4RD4A 3V8MA 1VQOV 3NVAA 2I4RA 4EEKA 4RORA 5CT5A 3UENA 3G02A 2AQKA 2P5SA 4O4JA 3QFFA 1RKUA 5DLQC 3W7BA 2VRBA 4ENVA 3Q12A 1QIIA 3HV0A 1H2AS 2EIMC 2J3HA 2Q28A 1NW5A 4O02B 3TEFA 1M66A 2ETNA 5KNBA 2IU3A 3RANA 3T7JA 4DPLA 3KCYA 2VPXA 4JV5B 4F46A 3ACBA 2FVXA 2NV0A 1QLNA 2Q2WA 3KP1A 5JZSA 3RT1A 3BTVA 2IK8A 3OZTA 4LSGA 4FBGA 1XZNA 1DG3A 1I0HA 1IBCA 1PZGA 1U8ZA 4MRPA 3DE7X 1Z2CA 1DAKA 3MYRA 1NYTA 4CF6A 1G3RA 1Z0KA 4OI2A 3JYLA 3U17A 5EJ9A 4HTFA 1ADGA 4XFJA 1D5AA 2DQZA 4YCAA 4ZCMA 3N2KA 3CZRA 1DCKA 2GLXA 2QVXX 2WSMA 3C8UA 3LT2A 4KO1S 1AUVA 1VQ9V 3I5DA 3LD9A 3FTFA 5DYGA 3FHJA 5BR1A 3AF3A 4MINA 4OU5A 3IESA 2GSWA 4O63O 3OOYA 3PE4A 2Y4NA 3T38A 4JJ6A 2H4WA 4H0NA 2H2HA 5FPKA 2QW0X 4Q9HA 1MVLA 3KM0A 3NUQA 4ZO9A 1XLTA 5CFZA 3CZPA 3AG2B 1AR5A 2QGNA 5HILA 3VPBA 1B8NA 2DOKA 1PVOA 3RJ9A 4KL8S 2VSXA 1G6Q1 3C45A 3CLSD 5FBWB 1YZHA 3ON1A 5HIMA 4YRKA 5HYVA 2P4HX 1Y74B 2XWPA 3TQOA 4MPDA 1R8QA 4RQAA 4R1LA 4RGBA 4WUTA 2PEYA 1NAIA 2A7XA 2WINI 2OB2A 3L7LA 2UZ1A 1TYBE 1SQBH 5DSZA 5KCZA 1CR1A 2I6SA 4UC0A 5CBFA 2NVWA 3FVQA 3CRMA 3Q7QA 1JQ5A 2HLHA 2FCAA 3D1VA 1NHWA 2GBLA 4H0CA 1RE0A 4B8ZA 4E0BA 2OKGA 2ZYAA 3A6KA 3U80A 2O8NA 4LTNA 4LXGA 1QZUA 5JAIA 4WBNB 1BCSB 5FD8A 1XJWA 3E7PA 5LP6B 2B5UA 3EJ6A 1YUBA 4PNEA 4FDAA 1F6BA 3SPCA 3E9DA 1NVDA 4IDNA 4BFVA 1QHNA 4EDHA 4BVFA 2B98A 5BWNA 3KWMA 4FIZA 4E4RA 2QBYB 4ZYXA 4UBMA 1AO3A 1PGNA 3ESBA 5G53C 1C9JA 4F4IA 5K0CA 1IVSA 1P9OA 3LHSA 3WA6A 1IV2A 2HCBA 4W5TA 2H2WA 3SS8A 3H7IA 1RABA 4F3KA 2V7UA 2XUZA 1W0JA 4ALLA 4HLCA 1KQSF 1I2ZA 3CXCU 4B3RO 1QVZA 4IDQA 1A97A 5B6PA 1ORHA 4PLCA 5ALVA 3E2IA 1DTOA 4EKWA 4LDAA 4DKJA 2H3OA 2O8BA 1KBHA 1D0VA 1E9BA 3MT7A 4Q9IA 1JHPA 3K5HA 1TZJA 5DHSA 4BNGA 5IC4A 2JFGA 3PIRA 4I2NA 2YXEA 4JYYA 1T6XA 1TE2A 4BX8A 1IXYA 1ZX3A 1ZA1A 4O4LA 3R3UA 4GS5A 3UG7A 1JLLB 1N5MA 4Y1RB 3ZHUA 3TLEA 1GITA 4TXMA 4HMQA 3D00A 3M4ZA 4PQGA 1IV1A 1FNSA 5FNVA 2R6R1 1IONA 1JN1A 1QYDA 2AOXA 3HWX1 4DCJA 1LLCA 3EOBI 2H9IA 4CV3A 3DAHA 3ASNC 2NYAA 2GB4A 4CF3A 2H1CA 1FLAA 3I2HA 5DN6A 3MSCA 3AP3A 1KI7A 2RIPA 2OTMA 1KF0A 5C93A 3M4SA 4IL6Z 2HDHA 3GCZA 5HKKD 4TSFG 1S1CA 3KTAB 3P9SA 1J0DA 1VQOF 2RHGB 2X77A 4WW0A 4XXHA 5B6IA 1VI6A 3FZEA 4G1FA 5IK2A 4M87A 3T52A 4HX9A 4G63A 4P7BA 4EECA 5AVMA 2OG1A 2GXUA 4FI3C 4BC0A 1NQXA 4J2HA 2PI5A 3I42A 1GVHA 4Z1VA 3O4VA 5LMUB 2QP3A 4UVDA 5DRTA 4F8EA 1ZH8A 5B4VA 1GFWA 4CEHA 1D07A 4AF8A 4TRJA 4LZAA 3FR7A 4LC1A 1SY7A 3AFGA 2F9LA 3GEEA 3HKCB 2FUNB 4Y1EA 3OPXA 3D0RA 2DWEC 2P4SA 4JEHA 4MQ6A 3VZBA 1Y3HA 2G0NA 4H2DA 1P7WA 1Y3IA 3RBVA 2Y2VA 2A30A 2ADFA 5FA8A 1R0RE 2BHNA 2H2FA 2P4QA 4L75A 4DR4O 5K1ZA 2VOJA 4LBWA 5HRCA 4LH6A 2PUDA 3EGXA 3GVCA 3QVGB 3JQ7A 4K6GA 2A9FA 4AJ1A 5BV1A 3ETQA 2R1VA 3WLPA 2QSJA 5BMVA 3QSGA 4UBOA 1XZFA 4X5OA 5CBGA 3DOJA 1ISJA 3UB2A 4F6CA 1GP2A 1QP4A 1C3OB 4ME6A 4ARCA 4JI5O 2QLTA 3Q6IA 2RHLA 4AJ2A 5JSUA 4KKVA 2HLNA 1B76A 4R98A 3RNLA 4D9BA 3JD4A 3VR4A 1PR2A 1ORVA 4BO8A 1RBZA 4WXRA 4GCZA 1FX0B 2PMCA 3CWZA 3LP6A 3NX4A 1IOZA 5K6AA 1P5HA 5FQNA 3ORSA 2G1JA 4QUHA 5LXTA 2I7XA 2CYBA 3OOJA 3BICA 1CUVA 3FPIA 3RTEA 3QVSA 1Z4PX 1BE6A 3IOYA 1DKMA 4LE1A 3LT5A 4YT5A 1I7SB 4H1UA 2VJMB 2Z8XA 4R1TA 1GN2A 2ZVQX 4QOJA 3LWPC 3K1JA 3GVPA 4MXDA 1GSIA 1SXJD 3RTGA 2I1VB 2VXYA 3D7SA 1KBOA 3OEHA 4FYHA 4NZYA 3KKNA 2G5TA 3ME5A 1QIGA 2QNRA 3NHFA 2PMEA 4BZQA 1Q0SA 3E8XA 5JSKA 4G4SO 2ZRMA 3D4LA 3JQ9A 2PD6A 4OQLA 4HNQA 2XF8A 5IZCA 1J1UA 3WZ2A 4PSUA 3ZU3A 4EMSA 3LWBA 3IAM6 1RBYA 1ZXLA 5D2CA 4JC8A 5HM8A 2RK4A 3P3NA 3T4XA 2OSVA 1PV1A 2J59A 4LYJA 4Q7LA 1ZUNB 4N9QA 4NEQA 3MEQA 4H1VA 1XNJA 2L0XA 1KQNA 3CFYA 4R9VA 3SKYA 5MGNA 3L2OB 1MH1A 1V3UA 4RENA 5FFMA 4RSHA 4ZDWA 1E3JA 2NP7A 2YIMA 1O4VA 4X84A 1OPXA 3DEZA 3H13A 4HAWA 4Y6SA 4DREA 3WDMA 3T7SA 4YUZA 1EN6A 4UTVA 2TSYB 2CHTA 4JC5A 1BQ4A 1P2UA 3QWIA 4LQDA 1LWOA 3UK6A 3KOMA 1GQRA 2B34A 4R6XA 4MA5A 4UE6A 3R4CA 1JN0A 3NDPA 1BMFG 4AVYA 1RSOA 1JIUA 2CUZA 1T3LA 2X4LA 4AKGA 4BWYA 2RQ6A 1OKKD 2ATCA 4FMBB 1QLEB 2Y4TA 3LW8A 3PB3A 2CNNA 3OQHA 5HGJA 2N46A 3AUAA 3GGCA 5CJ2A 2A59A 2W2KB 4LF5O 1SBTA 5IHXA 2ZSIA 3ZHCA 2Q2OA 4D9CA 5CLIA 4KL1A 3DLAA 1M5UA 1U65A 1Z4JA 3CE2A 3KAPA 4HHEA 4K40A 5IFKA 1F7UA 1W55A 1H85A 1OLSA 4HATA 2YZ2A 4M7RA 5G4KA 3M7MX 1NQTA 3HCRA 1CR0A 5DX0A 4O5AA 5E6UB 1YAHA 5EHNA 1EXMA 4KNVA 3UAYA 5THXA 1WDLA 4IDGA 4BVBA 2FKAA 4AF7A 3GQBA 2PG3A 5BSVA 4MV3A 4YUXA 1GGFA 5SYNA 3D6JA 1U94A 2HPZA 3DTTA 1JZTA 3QV1A 1L8DA 4NKRA 3EZ6A 4EMBA 1U7PA 3EXHA 3TLGA 1X59A 2UDPA 2FETA 4BX3A 1FFGA 4AO7A 4AP5A 3B38A 4C89A 3V3KA 2O54A 1OYWA 2PWBA 2VP2A 1URPA 3BEOA 4YJ2F 2BO1A 2WVJA 2PNJA 3ZE7A 4Z7JA 1WR8A 2LW7A 3SKVA 5AM4A 4X8OA 2L18A 1M90W 1H9CA 3WJ7A 1VQ8F 3ZMUA 3FNRA 1U8AA 1SR8A 2OFOA 3FMFA 1Z25A 2WJYA 4AP6A 2UU9O 4LXUA 1NRJB 5CLJA 3QXGA 3K0BA 1E1LA 4OCZA 1PBNA 1XCMA 1Z2DA 1IN8A 3FI0A 5CXSA 1B00A 4ARZA 4ISBA 4QYSA 1DKQA 1SOUA 1WHSA 3GA5A 2HUNA 3D5EA 4OFXA 3VHQA 5JOQA 1DQRA 4G5XA 5LP6C 2XZTA 2W6JA 3KQLA 4DUZO 3QY9A 3NT5A 3QNMA 3UK2A 4RDCA 3G6EF 1X3SA 3BREA 5L9AA 3NHWA 3PSAA 1UKCA 4FYVA 5JQGA 3SJQC 1XL1A 1P9NA 3RC7A 1RLTA 4JFRA 1Z47A 3FMOB 2A5JA 5CPFA 4E88A 3STZC 4I55F 2MWMA 4IJVA 2GEFA 3HO8A 2RHMA 4HLNA 3H18A 2N9UA 2P9FA 3L0OA 3NTVA 1Z29A 3ZV6A 2NV2B 2BEWB 2YJNA 4LHYA 2HX1A 4KGZA 2ECFA 3NBAA 1DEAA 4CKBA 1YOVB 5JD4A 1FRFS 3OO1A 3MOGA 4MWZA 3TZCA 1FU7A 3U10A 2BZSA 2GERA 5F35A 2REBA 2GK6A 2H9AA 4FHDA 5GWXA 4UTXA 5DTIA 2O1SA 2YY6A 2PNFA 5JPDA 3T12A 1N8RW 1XHOA 1J9EA 5D7BA 3KVNA 1VJ0A 4QXRA 3K2QA 3BQNB 4CG0A 1YMQA 2NUTA 1SZDA 2J4DA 5TIIA 1YC2A 1EXDA 4ZVRA 1WMBA 1D4ZA 3BH6A 4EPWA 4B8WA 3W7TA 5F3WB 2IYZA 3HJUA 5L3RA 2GZ1A 5LDGA 5DNAA 1ZOOA 4TS4A 4TM7A 1Z62A 1M6VB 4N18A 3UA4A 1G55A 3JYHA 1T2CA 3OFKA 1RJEA 1YKGA 1YBHA 2AXQA 4MS3A 1V0JA 2INGX 5AHKA 5B57C 3N5CA 3O9OA 5A2QA 4RHCA 2ZIXA 1W42A 1JHRA 1MKYA 3OUSA 1EINA 3L8CA 4GM1A 4GW3A 2J0QA 4MK4A 1E2FA 3TTWA 1W29A 2EZ4A 5EE9A 3N3AC 1W49A 3R3JA 4DM4A 4EHNA 3EAFA 3N0TA 4YFVA 1QAQA 1SCKA 2F23A 4F7DA 1J2JA 2RC5A 5EWLB 2G1PA 3WLEA 1J8QA 4WRRA 1E8NA 1Y4DE 4CIDA 4MVJD 3T1YB 1MQSA 1UL1X 3C3CA 4HEJA 4O33A 4X6XA 4BXOA 4ZWNA 4PAGA 1BL8A 1YDHA 1D9ZA 3RS4A 3TD6A 3W34A 3W7VA 3IT1A 4UTNA 3LWNA 1O8BA 1YFJA 3RTDA 5JZOA 1QAMA 2CFRA 4Q6BA 1JQLB 2M1XA 4P1ZA 1Z2OX 3QUCA 4ZQCB 4ZT4A 1S5HC 1T9KA 3LC0A 3SQOA 1OU4A 2GR9A 3T3NA 4PIMA 4BLOA 3R6TA 3FD5A 2R72A 3FYUA 4OKIA 3RAJA 1A9XA 2H29A 3G13A 1NVMB 3IALA 1C7ZA 4JNKA 1WB8A 1SIBE 3B7WA 3EISA 4ETIA 3QW4B 4QFCA 4F4JA 3RSOA 4B4OA 3HM9A 1QS0B 2HSZA 1M57B 2UUCO 1E7QA 4AUMA 4C1BA 4OA8A 3ZDBA 1X6VA 2YINC 1DLJA 3MTBA 2XCIA 3H1FA 3PRJA 5ALZA 5FEMA 3VYRB 5DKFA 5IKXA 4HYEA 4F84A 2VXOA 1ONIA 4PNHA 3UAXA 1DFIA 3IULA 3RRJA 3C9RA 3BZUA 4BNHA 3VBBA 1Z7EA 2NZ2A 1ZUQA 2R8OA 4CEJA 3LXMA 3K16A 3KYJB 1JEYA 2HSWA 4UNQA 3SEZA 3FWPA 4LVNA 1EGQA 1U0HC 1VA4A 5HZHA 3UUEA 4WVFA 2F8TA 4PPGA 3UHFA 2RJZA 2YWEA 3ZHZA 4V1CI 4EG3A 3IV9A 1JAXA 1MC5A 4W63A 3K09C 1VE3A 2PT5A 4KQ9A 1EFVB 1L0LH 1H4VB 3VZQA 5E7JA 1IUOA 5DM2A 4M98A 5ECGC 3VX3A 4ALIA 4AKSA 3CD6V 4RZ3A 5HY4A 4JI8O 1G0NA 1X7XA 3A27A 1YR6A 1Q0ZA 1XAGA 2OHJA 3AG6A 3M1LA 5LP6A 2XYRA 4Z7NB 5JADA 1Y1LA 1G20E 4WK4B 2I34A 1NV8A 2HADA 3MPUA 3KVRA 2I91A 3MCWA 3KKZA 4Q16A 5C7LO 1JHDA 4MRMA 4DOMA 1AK2A 1RZVA 4G07A 1WS6A 2YUIA 3K5WA 1T2AA 4LZZA 4OD0A 1F4NA 3CLHA 4O2AA 1FYDA 1Q7CA 4B75A 5HY0A 3RBXA 2PKWA 4FJCC 1NXXA 1EFRD 3U7JA 4ZREA 4JUBA 4Y2PA 5DM70 2KB0A 5JH7A 2ZITA 2OLJA 4XWAA 4DIDA 2OV8A 4FFWA 3U19A 4NFHA 3EIFA 1JIIA 1TF7A 2M9MA 2R4UA 1UBRS 4EMTA 5JNVA 1JQDA 2EKBA 3E0XA 1DO0A 5TGZA 2ONCA 2BHSA 3VA7A 1K66A 3FGNA 4M6WB 1KFCB 3NETA 3DTNA 1OT3A 2ZTSA 2ZIEA 5B3JA 1GV0A 4JV5O 2WHRA 3IODA 4LSWA 1JHMA 1FOEB 3UMGA 4B4UA 4BX9A 4RBNA 7REQB 1W36B 5KX5A 4Z4FA 4PAWA 1GG9A 4Q7MB 4G0OA 4YK7A 1RYYA 2YHBA 3CCLF 1H5NA 1IPFA 2AK3A 2QM3A 2R48A 3QV2A 2PTHA 3HP7A 1T0HB 4PA4A 2X2PA 3BJRA 3N0WA 4JOBA 4WJKB 3KU4A 2G1UA 2UYCA 4O4IA 3X1YA 1KR5A 2GVZC 2P2SA 3ULKA 2E75B 4ZEWA 5GIPE 2LP4Y 4P58A 4F91B 2VPWA 1YITV 3NWPA 3OZ7A 2VYQA 5J4HA 2X5OA 2CXHA 3ZJTA 2RBGA 4FUQA 2JAQA 2IUTA 3VDNB 3P3PA 4ASUD 4FGSA 2O48X 1I5EA 1VYUA 4Q4CA 1OX6A 3PKJA 2FPWA 1ZL8A 1YQGA 4M1WA 3LTNC 3PPIA 1M8FA 2FSSA 1SURA 2JFFA 4KIUA 4W6QA 1UMBB 3A6FA 4ZD6A 4ZK2A 1QHIA 2B61A 1OH5A 3RRZA 4RDHA 4LWOA 1I3LA 3NZEA 4P4LA 5IMSA 4F71A 2BBWA 2BZGA 3DEJA 4WNIA 3A32A 1S2MA 2J30A 4WJZA 1L4UA 1RZRD 4QPJC 4B5LA 2BFDB 2Z6UA 3Q4HA 3HR4A 4XR9A 1JKJA 1FFBA 1UFVA 2YJ6A 2CB9A 2FX5A 2Y1OA 4Z9YA 3ZIAD 3ZNPA 2NU6B 3E9CA 4NDZA 1R1MA 2JAXA 3I6QA 3KZXA 1Y4MA 1ESNA 3FOAA 3IOEA 1GKUB 4HSEA 4HVTA 1BD4A 4RQUA 5I9MA 4MDYA 5J63A 4BKUA 4KITB 5IH7A 3LOPA 1PV4A 1QFZA 4JEIA 4BPRA 2IH2A 1DT5A 1AKWA 2IS6A 4U7NA 5BR8O 5JLJA 3DAYA 3Q15C 4NC9A 4J0IA 3TJRA 3DQZA 2HW8A 1OWOA 2QE7A 4X62B 1M1YE 3ORRA 3CJHB 2RI1A 1D4FA 4JKIA 4ZU1X 1YB1A 1P74A 4NU5A 4YUVA 4F5YA 3I76A 1F0PA 3SI7A 4BYMA 2UXCB 3ZWCA 2IHJA 1PDVA 2YIDA 1WVIA 3DV0A 3WDSA 3ZMVA 1U9IA 1ODSA 2BKUA 2HK6A 3LM8A 4LHZA 2DLNA 2RG7A 1C14A 3NHLA 3PI6A 4MVJP 1LBTA 2W2XA 2B7CA 4JSTA 3PNOA 3F49S 1U6KA 5HK9A 4CQLA 3USZA 4OQDA 2XYVA 1C9YA 4DR5O 5DTRA 1VQNF 5IT9A 3MWEB 4RD6A 3A36A 3CMAF 1E79G 4MRRA 4FSDA 2WDZA 1PGPA 3IHWA 1A9SA 3VOBA 3O7MA 4OB7A 4QU9A 5AVTA 1CDDA 1PG0A 1V6SA 3H75A 3OF2A 4DCSA 1K9MW 3CD6F 4UHDA 4URXR 1EX6A 3U1TA 3UT0A 1VFPA 2WWIA 2UZIR 1BE0A 3LFHA 4GOKA 2A88A 4AS2A 4X20B 2WJPA 1MQ9A 4LF8O 2JD1A 4KWTA 4OBXA 1XRPA 2WJIA 5JZMA 1PJCA 2I8CA 3ZQUA 4MPJA 2XDWA 5CFNA 2FW0A 3NDBB 2ZS8A 1XLWA 5IJZA 4RS4A 1OXVA 4D4HA 2CXRA 5JXWA 1D6NA 2FZVA 1SEPA 4EITA 8ATCA 4MRAA 4TTPA 1U3LA 3UFBA 3PNYA 3G6KA 1ZCFA 3DAFA 3HU3A 2BFBA 5ELMA 1OA1A 2ZFUA 3K3PA 4BZWA 3PX2A 3LOQA 4ICIA 3UXMA 3LX4A 1L1RA 4E15A 5LKRA 4F3NA 1OAPA 1S3SA 2QN1A 2W5UA 3DZDA 2P4KA 3PGVA 3PUYA 4KNYA 2BMEA 3ER8A 2IYEA 1E79A 3GGSA 4NPHA 1G4AE 3PQDA 1GZ0A 2EL7A 4YVFA 3I8OA 4CF5A 1U8FO 3BJIC 5JJ5A 1QU7A 1P4HA 2QN6A 3A4IA 2C5EA 4K5QA 1CS0B 1VYVA 4IDEA 3WV5A 1UPUA 4I2VA 5JSYA 1SULA 1DWPA 2FK7A 3UO8B 5K0EA 3UPTA 1XTRA 4YP9A 1W35A 4V2IA 3GLIA 3CCLV 4N0MA 3HTXA 2G9RA 2XW6A 4W7SA 4P4UA 5KNBH 5JWRA 5LL6Y 4TSKA 1WL8A 3SEAA 3B09A 1GSAA 2P6YA 1OF1A 1Z07A 4IYJA 4LDRA 4PYRA 4ZRNA 3RBAA 1ARZA 2XUQA 3G5TA 4CIBA 3KXDA 2VRCA 2E4ZA 1LDMA 3GYBA 2UXBB 3I4LA 3K6RA 5DDIP 5LLSA 3OEED 3BGOS 4KXWA 1E3LA 3ID6C 2O1XA 5ALHA 1O57A 3S29A 1WETA 2IH3C 5IKOA 1OI2A 1G5RA 5LFAA 3L7NA 3WLMA 4DSAA 2REQA 1NVGA 3GDOA 3QO7A 1U2ZA 3TXYA 4W4KA 2HO4A 2PKEA 3U13A 1E4YA 3K8ZA 2OC4A 3UMMA 3DHEA 1DK1A 3D59A 1M1NA 4WKCA 3MD0A 4MKXA 3ROXA 3B70A 4CXMA 1BAPA 1YE8A 1N5DA 2W7TA 4L7QA 4RO0A 3I5YA 2XZOA 4HYYA 3QHAA 3CRQA 1AXEA 1NTMH 1N1MA 4GKKB 3IQEA 4M9QA 3K0KA 1C50A 3RS8A 1ILEA 3VXKA 2BN4A 2AFIB 3MB8A 3NIGB 3HZZA 2YTZA 4HAIA 5E3JA 5EXDA 3V1KA 3CUSA 4B7AA 3O1JC 3ICCA 3ESZA 1BT8A 4I50F 3OI7A 1NT4A 1GL3A 4OATA 3WG7B 3B3FA 5IMBA 3WGQA 3ANLA 3NW9A 3E9YA 4Q19A 1S72V 2J7PA 2QAIA 3N0RA 3ROEA 1DGQA 1RPTA 2LBTA 1DINA 2WF8A 5JS2A 4DPKA 3NUGA 5B4UA 3K8YA 1Y33E 4FNOA 4EUHA 1BWRA 2ENUA 3GHHA 3KYDA 1ZK4A 1E18A 4L95C 1J5XA 1MDBA 4RACA 4XX0A 1CB0A 3HWWA 3GT0A 4M9SA 3UATA 4BQOA 3UMYA 1DMRA 3CX3A 2XNCA 4AJ9A 4IL5A 6AT1A 1JIVA 1EHYA 1XPJA 3D1LA 3KT6A 3FDZB 2NO6A 3OPVA 1DVRA 1MTZA 2QL6A 5GV7A 1VDMA 3KUKA 2F9ZC 3LG2A 1F6WA 1PR4A 4CKCA 1PE0A 5IVHA 2P75A 2FPOA 4IWXA 3LIPA 1ZD5A 4G36A 1E2NA 5CH5A 3D3JA 3CINA 1TQ4A 1IN4A 4JLVA 1RJFA 2A0FA 2PKQP 1LPNA 4LF5B 4XGNA 3W5IA 1Y5LA 3G1TA 3QHPA 4KQWA 2GWHA 4BN4A 3SIRA 2C9CA 3TUIC 4J0JA 3N39C 4WMLA 2DTEA 1QS0A 1LV8A 1BJRE 4YT8A 4I3FA 2HNBA 2ZJBA 1M0EA 1KNKA 3TQRA 3DE2X 5BUZA 1FZTA 2BONA 4HRXA 4LOLA 4TMYA 1TLFA 4RA9A 3SZGA 2XRFA 2ZYRA 4CI0B 5LQUA 2Q5HA 3K0CA 2F62A 4JYMA 3RLFA 5GIOC 1IEWA 3CT4A 3OICA 4IV5A 4WLVA 1WW8A 5KQGA 1CZLA 4JITA 1E7YA 4UM5A 1SU4A 1IM8A 2CFTA 4X24A 5J2TF 4JAVC 1P5RA 1B7GO 1PR5A 2C3YA 2BFFA 3DM9B 1WOMA 3WFIA 2PUHA 2IBTA 3PNSA 5LYJB 4DR2O 2XNHA 4P9PA 1M2WA 2QTNA 4JLJA 3AVXA 3ZW8A 4M21A 2F4NA 1ECJA 1EDZA 1ESCA 1HDIA 1Y3AA 1P17A 2E4VA 3N8DA 1E9VA 1D0SA 2B8NA 4U5XA 4CM9D 2OO3A 2WPDD 1F7YA 1O8CA 4BO5A 1M76A 4OHCA 2XUKA 4JPRA 3I1JA 3JWHA 1EGAA 4GXQA 4HGOA 4KYIB 1VKOA 4CMCA 2N75A 4UW9A 3EWNA 1KQGA 1YV9A 1Z7GA 3DVAA 2YMPA 4L3WA 4M1ZA 3ZHVA 1IQRA 3GRKA 2Z57A 2WYOA 1KMMA 1IBLO 3LCCA 3ROKA 5D3KA 5JSZB 1QAOA 3FKSD 5A71A 4EEZA 1UBOS 2J5QA 2RH4A 4M49A 4CPDA 3TN7A 1EFDN 1PK9A 2KYRA 1VEWA 1VQ8V 3GEMA 4D43A 1W0JD 4DS3A 5K1PA 4FONA 1OCZB 4FFBA 3WFVA 2Y66A 1U5BA 4RKEA 1U9ZA 2DR0A 3OEEG 3ZP7A 1V35A 1WSWA 2HM7A 3DMPA 3FPGA 1C8BA 4BY9E 1TJYA 1VL0A 2FSVC 3M8KA 2B1JA 2A57A 5D51S 4LDNA 3H1KH 3MCTA 4DJTA 4CZZA 3DPSA 4YUWA 3PNQA 1XVLA 3I1FA 3JU3A 4KO4S 3TVTA 1W2WB 3WKDA 1Z0ZA 2QD5A 2VNSA 4TXHA 3X1WA 3ZJ4A 1V55B 4PZUA 4HDQB 5AUOB 1VQLF 2LIVA 5DXJA 3VH3A 4NAUA 3BWDD 4QNHB 1O94C 1K6JA 1VKRA 3W7XA 4D44A 3C6QA 1KC8H 1FU8A 4RX1A 1E1YA 4UNPA 3G0BA 3WXMA 4PDVA 2Q7XA 3DONA 4CKXA 2VK1A 4HSGA 1YT5A 1VGRA 1WHTA 1AQIA 3W6UA 2CVLA 1L7EA 4PYLA 4MYHA 2YXHA 3HXPA 3CCEF 1RLUA 1DAEA 3EB9A 3MB5A 5DEIA 3SNKA 3KXIA 3V4PB 5A5DA 5IK2D 4Z1MA 5FL7G 4IM7A 5FJJA 4Q4JA 4DVJA 3NV9A 4ZODA 2R8YA 3GNTA 4L9SA 1N0VC 4L7VA 1JVBA 3E5NA 3QFCA 1RWOA 2EZ8A 2QQGA 1E7RA 4FFNA 5EI5A 3TZQA 3J7AR 4YR9A 2IV2X 3L92A 1EH5A 2Q2NA 4WFJA 4ZJZA 1FQJA 2F1OA 2UXNA 3AEZA 5L3CA 3HY4A 2JFWA 2BCEA 5LGTA 3I4FA 4NULA 4KFSA 1Y98A 5ALWA 5EVJA 4WESA 1OYVA 2QTFA 5SZJA 3VHRA 4IUYA 3WP1B 4BV8A 3R9WA 3S2FA 2DFVA 2WTEA 1U40A 2Z2ZA 4DPMA 1LH0A 4D9NA 4NZ9A 4E46A 2DR2A 3IHKA 4NS1A 2PX5A 1MOZA 2JGJA 1QRDA 4FFKA 1NJ2A 2XWQA 1VBFA 1G66A 4KO3S 1T0BA 2BAGA 4GQBA 5J5VA 1PQUA 4DLXA 3QMVA 3LC7O 1B73A 4I1SA 5EIOA 4K9DA 3H19A 5I6DA 3QLUC 3VR4D 1CNFA 1P62B 4L8JA 3IB3A 2WJVA 3QUTA 2QDXA 1NKVA 1KUQA 2B1IA 1KEUA 4BCBA 3EDRA 4Z2YA 1ZISA 2HSDA 2NPIA 3TMKA 3VPXA 1C7RA 1XNGA 2XNJA 1FUYB 2W6QA 4IXNA 3A1NA 4IIFA 1KGDA 5G4VC 1RQ7A 2A94A 4MB6A 5IARA 3OMIB 3V55A 1TTPB 2H11A 2AHZA 1GVNB 3A05A 3VKUA 4M2LA 4K9SA 4EKIA 2YW9A 3NTRA 4A27A 1HK7A 3IELA 2ZBDA 4IHKA 4PFKA 4LVOA 1TUGA 4BNXA 3DTVB 1MOQA 2BGRA 1MB4A 2CLLB 2XAAA 1DOAA 4NHOA 3PUVA 1S9DA 1I6LA 5DRYA 5LGUA 4BRSA 3GIDA 3KJNA 1LBIA 3DOCA 3FCSB 5BSRA 2O8BB 1KMCA 1AQLA 1I7PA 3R65A 4MVSA 1A4RA 1TJPB 2O20A 3MWDA 3DBLA 5EUMA 4MPRA 4ACAA 4TTJA 3F8TA 1TEZA 1OWPA 3K31A 1E3SA 5G2OA 3UJ6A 2HY7A 2SCUA 4F4UA 5LJIA 1NMYA 2IP1A 1GG5A 5I01A 4HZ3A 1Z75A 4S3MA 5REQA 1J0EA 3JZIA 5AVQA 5EJ6A 3J81M 3OWXA 4JROA 4MW2A 3GPBA 3QQPA 2EJUA 4C7VA 5I5EA 2Y9MB 3RVJA 5ESWA 1XN4A 3T7RA 2V9PA 5JAZA 3LT1A 5AOVA 1N9GB 3MJDA 1KO7A 2AW9A 3RVYA 1FMCA 1L4MA 4JX9A 2QT9A 4MGEA 4YCLA 5LZ4A 2ATIA 4IIVA 3O92A 1AA6A 2GN0A 2EZUA 2DQSA 4X00A 3ITNA 3TEMA 4Z54A 2QRGA 4LX8A 1ECPA 3V00A 2IBMA 3FJ1A 2AEJA 3MWGA 2FJPA 3OFNA 4N5LA 4ZKEA 3ZKWA 1UQUA 4YUYA 4BW9A 2D1YA 4RXTA 3AK3A 4Z8YA 3GLFB 2UAGA 3L4KA 1Q0HA 5J9FA 1A95A 5DSXA 5IABA 4QDUA 5EUQB 1GQFA 2IUYA 1AZTA 4KQIA 5C3MA 4RDIA 4S0XA 3WQSB 1C7FA 2H07A 4J07A 4BE7B 4NCIA 4AROA 1S4QA 4E22A 4ZGWA 3AETB 2R70A 1II8B 1KBZA 3VTAA 5DNVA 5JFGA 1GNPA 2FAXA 2O7VA 1EAMA 1WUKS 5KIAA 2FF5A 1ZBQA 2J3MA 3OZIA 2PIDA 4I1OA 4MGZR 2HIGA 4G8DA 1M90H 2C9OA 4QYMA 3G2PA 3NATA 2Q7OE 5FEUA 3I9V6 2AR0A 4NNOA 2MW2B 2X0LA 3CCEV 2XMCA 3DWGA 2QRJA 4DF3A 4EOGA 2BZ0A 3ZBUA 3AKCA 4BNVA 5BMVB 2HXGA 3WNZA 4JP2A 2CBXA 3HSYA 3T3MB 3W3AH 3UJDA 2CL6X 3CC2V 5JAOA 1JR9A 2EJBA 4YTEA 1T9GS 4ZALA 3RYIA 4HWGA 1GZ5A 4M8KA 1YQQA 2HLDA 3QP9A 1U2SA 5C3UA 2DCMA 2ZYWX 5LQMA 2P6RA 4DQDA 5LZ9A 4NMWA 4GAEA 1UI9A 3AI2A 2AW3A 2WSSD 3IS3A 4N0QA 5HKBA 3IP3A 1LJUA 3KYBA 2X3UA 1FMLA 4F12A 1S8NA 4JI2B 2W4MA 4QTUB 3HUEA 4FHFA 3ZWPA 1WIWA 4F2GA 4RJTA 3ECAA 3OKFA 2BOBC 4N9WA 4W82A 3QLUA 4DANA 1UJWB 2HSGA 1ZUIA 2ZIUB 2POQX 4AK9A 3K5MA 3AF0A 3D2LA 5DYIA 4BZXA 4F7WA 3THWB 4CTNA 2VAVA 2PUBA 4QA9A 1V5EA 5BRNA 2CTRA 1W85B 3U0ZA 4QEKA 1ZZGA 3KL2A 3FZQA 3DTUB 1DBIA 1QE5A 1E2JA 1HETA 2RONA 2VSQA 2ZROA 3KVOA 4DWOA 1FXKC 2X4GA 4JI2O 4TWJA 5IJ9B 2BFCB 3BA6A 2JF0A 3V7UA 1U11A 1A9YA 2HT1A 3ETHA 5EXSA 1R3UA 4RDXA 4DR4B 1VJRA 3GFRA 2YVAA 2IUUA 3AY6A 1YS1X 4MKFA 4ZU6X 3T9DA 4TL9A 8GPBA 1IK6A 2BGNA 3DOEA 3PT5A 2H6EA 4Q47A 2HGSA 2DBRA 3AHCA 4PBTA 1IN1A 2QHXA 3Q9NA 3F74A 3S7TA 3ZQJA 3UK7A 4FMPA 1ZVMA 2K5UA 2D54A 1BGXT 2WHPB 5CVJA 1MAHA 5B30A 1YI2F 2FEOA 3H4MA 4CG3A 2VQDA 1Q11A 2QM7A 3K04A 1G63A 2RGDA 1SELA 3TZLA 1RXUA 1IL0A 3D2AA 2EP5A 3EWAA 3OQVA 3PDJA 5KU1A 3UO3A 4INAA 5BVGB 1TM1E 1ZLZA 3L06A 1LQ2A 5BQXA 4E6PA 3JQAA 4IJWA 4QL3A 2AGVA 3DUFA 1JX6A 4ERHA 1XG5A 4LCJA 1OR8A 3NC4A 1YEWA 2QTLA 1CUWA 1F8FA 1M6YA 3COPA 1KKUA 2DWUA 4OFWA 3W8EA 3NT4A 3IUYA 2Y1WA 5DNUA 1P0FA 1EYZA 2CXOA 2IE0A 3NHYA 5F5NA 5JNLA 1K7YA 4H27A 2BKAA 2FZ5A 1UKEA 2NPFA 1B3QA 1P1KA 4EFBA 2FOIA 5FWYB 4IDAA 3I9LA 4KAXA 1K98A 1KQOA 1Z6GA 2HR3A 2HFJA 3ITKA 2UUAB 2OCHA 2BMAA 3M3DA 1U7OA 1ZI9A 4NU0A 2FMHA 3R09A 2P5YA 4EX6A 2D0DA 1E59A 3AHFA 5CFLA 5DCLA 3H6KA 4WNCA 4YJHB 2PRZA 4OXXA 1ENVA 3OX4A 3O3MB 1R6NA 2HMWA 4KKXB 5CLHA 1ECCA 4NOLA 4PPFA 3QUBA 3UYKA 3PGXA 2HV8A 3QBEA 3TBKA 3RAEC 1IM5A 1XEXB 1E2QA 3WNCA 4Z4GA 2LR0A 3D4IA 3K9SA 1NBWB 1D7OA 3T95A 1EBBA 4MUBA 2Z8YM 3B51X 2ZDGA 3PTAA 1IXZA 5J4YA 4E5MA 3TMYA 2OTLF 1LX6A 2QKAA 5CB6A 5JJBA 3K5OA 3EG9A 5HOEA 2VQ3A 3QVXA 4PDLA 2NO4A 3OA0A 1Q7TA 2FCRA 4Z0NA 3FNQA 4JYBA 4Q9DA 2ZXFA 2DBQA 3U44A 5BWBA 3HKDB 2XXJA 3WGHA 3SSAA 1A04A 2WJAA 2G3YA 4D4MA 1NY5A 4OGWA 3N2KB 4RVCA 1D8TA 4BW0B 3F3MA 1UAGA 3ZO8A 3SC2A 1IPEA 4CWAA 1I0LA 3AONB 1T4CA 5DSTA 3J7TA 3DC2A 2FW1A 4BRUA 1NATA 2ZYVX 4UCOA 4R7GA 4K1LA 3A0HZ 1Y66A 1V48A 3QOXA 4B6RA 4CKZA 2FVYA 4KPEC 1VQ4V 1A8PA 2VAPA 3TD5A 2NVUA 3EXFB 5KNCA 4X64B 1N2SA 2XZPA 4BBZA 4FOTA 1RQ2A 2I7CA 4XWGA 3CSSA 3LV8A 1I6MA 1TEXA 1ZVQA 4LHWA 4XIYA 1XC7A 3SZMA 3KEGA 1G19A 2V6MA 5IP5A 1JPJA 1X8XA 4A6PA 5F21A 5IYCO 2VRZA 4FZ5A 2FP4B 3LSSA 1EDDA 2IIVA 3ASVA 3MCZA 3O5AA 4NTZA 5B1BB 3C7AA 5CLLA 3B60A 3MS7A 1QQAA 2NLJC 4JF3A 1C1YA 4R1OA 5C80A 4GU5A 3L46A 1NAHA 1X14A 2R44A 1UF9A 3FFMA 2QSUA 4KZKA 3SXUA 3KHUA 3NO4A 2NAFA 4BZPA 1NOJA 1IXBA 2P9QA 4CNQA 3B2QA 4EBFA 1EESA 1WULS 2ORED 3LPLA 4OYRA 1OAOC 1W4RA 1YR2A 5AHWA 4YS6A 1QP0A 1QZ3A 5HDQA 2QI2A 1YGYA 2A5DA 3HA2A 4CMGA 1H2GA 3PE6A 3ZE6A 3J80M 4QU5A 4S1PA 3VU0A 4I1VA 1L6IA 2PT9A 3N5KA 3T15A 1MB2A 1EHCA 4NYJR 4QEZA 1ZSPA 3NLLA 4MW7A 1R1BA 2GZSA 2Z6VA 1J2UA 2A79B 1KYVA 3ZDQA 2ONKA 1E8DA 4TMVA 1V8BA 2EGHA 2Z1TA 4PLPA 4HNUA 4B35A 1PEAA 1YZYA 4DY4A 1RBQA 1VL2A 3RC1A 2LDXA 5AI0A 3QFRA 4DABA 4JUFA 3WK8A 3AG1C 4LTMA 5HJ5A 1DQSA 3K9WA 4J7ZA 4WDQA 5T67A 3PCXA 3ICWA 1V9SA 4C4YA 3NV7A 3L0ZA 1K5PA 4EPXA 5H80A 1TAGA 1ZJ5A 1PSZA 2ZAOA 1H1LA 2UYGA 3BDAA 4KWHA 3TIVA 3ZDYB 1RKVA 4AIIA 3DXZA 5EJMA 1AHHA 1RWVA 2CFIA 1Y9DA 4EM6A 5BV7A 1N36B 4K8XA 3DAGA 1K8ZB 1YS7A 2Y0PA 4LUCA 4M9CA 4MUEA 4EUKA 3C7KA 4GF5A 4RCYA 1ZWZA 2JJYA 1G9SA 1AF7A 1HI9A 1LI5A 5CNJA 2ZW9A 4GNRA 1MC1A 2KSDA 2O5RA 1DPGA 1GCUA 5LDDC 2X15A 1TW2A 1BD3A 2IEAA 3RU2A 3V4ZA 2OK7A 3P45A 5JVDA 5BUSA 3A0UA 1YFLA 3N07A 2GPSA 2X8AA 3DHYA 3WBKA 3OFVA 2I3GA 3CCQV 2IS1A 2DMRA 4J0CA 3DQPA 3A3PA 3K4QA 1ESMA 5LQRA 4OQNA 4DXDA 1SUDA 4UMEA 5FNZA 1CDEA 1Y9JA 3IEPA 4MW4A 1UK7A 4N01A 1C3VA 4G5GA 4MV8A 4RPCA 5EJFA 1NXOA 5ITZA 1ACJA 2RHCA 2VDKB 2EJCA 3AUJB 2HPVA 4QGGA 5KCMA 3ZD9A 4BLVA 4I0WB 1RPAA 4CG1A 4A10A 2ALEA 3UPUA 5LQSA 1Y1RA 3A1CA 2W2PA 5LMUO 3BYZA 1ZJJA 2GN8A 3GFPA 3T5TA 1NYLA 4AYWA 4ZK6A 5JO0A 2IXAA 5JROA 2QE7D 2OTLV 1E2HA 4LJ4A 4GM0A 1WBJB 4X65O 1H6CA 3B1YA 4RU1A 3UV7A 4RQBA 4DTCA 2CMHA 2G4LA 4ETNA 2DQ4A 2OUKA 3LO5A 4IDHA 5LM3A 3ETCA 2FUKA 3KT0A 4CC6A 4TVBA 2PSEA 5EHXA 3WB9A 5LB2A 4RMHA 3AEUA 1NUHA 4UAUA 3JY6A 5DMXA 2I33A 3MMZA 4Z9XA 4XQ9A 2QPOA 2VZ8A 4LZLA 2XBMA 2HTFA 1CUCA 2NO9A 2LO1A 4QOFA 4Q93A 5C8XA 3AETA 2DT8A 2WSSG 2OHXA 3BK1A 5BSFA 3U9TA 2K1SA 2VN8A 2XDQB 4DT1A 2V96A 2ZUCA 3K30A 2QQ5A 2J6CA 2OILA 3AFIA 3TG2A 3EXHB 3G9TA 3DKKA 2XQJA 2ZSDA 5DBOA 3TLGB 1DAHA 1RFLA 2J9RA 3KYCA 1QZZA 3OETA 2ATEA 1S7GA 4ND5A 4PGMA 3BMNB 2J9XB 3I3OA 4BGUA 4P2BA 5DWQA 2OD2A 3C16C 5JCXA 2QE6A 2P2ZA 2YH2A 4KQKA 3UM7A 3OE7D 4MLCA 4ZKDA 3FDXA 5H8WA 2XQKA 2KTUA 1FU4A 2VZLA 1JI0A 2IOHA 4PYMA 4DA7A 5FWAA 1JR6A 1KYTA 2OHIA 1GEEA 2O8EB 1NSYA 3HMKA 3VYSB 2PLNA 1PEKE 4MW3A 2EX1A 1JE1A 1OLUA 2P11A 1TUEB 1EUQA 1NP7A 2D2IA 1XVVA 2PL5A 3MRXA 1OTYA 4F4LA 5GANK 1HDEA 3PNKA 4YXFA 3E84A 1CZHA 5TEWA 1Z38A 2V6JA 1Z5UA 4K7JA 1ZQ9A 4PFSA 4ROSA 1EIWA 2GPWA 5B1AC 2FPPB 4BMXA 3CM0A 4O0LA 3NVIB 4G97A 1SU6A 4E1AA 1E79D 2VWGA 2QRKA 3N4ZA 2V5VA 2NWQA 4JJ4A 3A25A 3JX9A 4MUAA 3UJCA 1SXQA 1MFZA 1CEYA 5P21A 1BX0A 5B7GA 3MAQA 1LZLA 4QREA 3GVXA 1NF8A 2OORC 3AIIA 4O08A 1E9AA 2NQTA 2BDUA 4QDZA 2N1MA 4RPKA 1Q12A 2QTHA 3VSEA 1DTWB 1SZPA 4HQ6A 4IIEA 3D2BA 3DSRA 3D8CA 4JZGA 3BCSA 1YB2A 4HWSA 1VF6C 1IXSB 2CE2X 3G82C 3CV3A 1UXGA 5CPBA 3V1UA 1B93A 3T3HA 4RTQA 5H02A 4PZAA 3AUFA 4UVHA 3D7NA 1DV2A 1FVHA 2HFKA 2RK6A 3QZUA 4OYYA 3IEMA 4WLFA 3A2FA 3VMFB 1AHNA 1YK1A 3HCCA 3ESYA 3PXEA 4AUNA 2CNWD 4HUTA 1O0CA 1W2GA 3B82A 3LL7A 4LJ5A 2CCJA 2QI9F 5JNTA 4DCGA 1ZOSA 1R0CA 4FMTA 1R9GA 1X87A 3LIIA 4OL0A 4OUDB 2JPDA 3GG2A 721PA 1SVLA 3QQ5A 1EWQA 1RRGA 5DYTA 1JLMA 1H2NA 1IJKA 3CRZA 2XE6A 1ENPA 4H4DA 4CM4A 5JPCA 3AIOA 4QX6A 3PUXA 2OTJF 2DJ5A 2CTPA 1WXXA 4ROTA 3RAGA 4RKRA 3QTCA 5LHHA 4TTRA 4XGQA 1TQ2A 2NU8A 5A06A 4GLOA 1QDLB 4JEUA 2OESA 1BOFA 2VP9A 2G07A 3LF2A 3NEAA 4NOJA 5IWAB 2W43A 1V45E 1T34A 3PAFA 3L01A 3LLSA 5AKYA 2ZYHA 4ZEVA 1EUYA 3PD0A 3A1DA 1HE3A 2ZBFA 3KQPA 1Q0QA 2AG8A 4R3WA 3F5SA 3O2QB 1P3JA 1Q84A 3DXXA 3FIUA 4WT7A 4Q1EA 4EATA 1ZK2A 3SBEA 1Z2PX 2WJ4A 2ENWA 4UUOA 2DFLA 1RC0A 2J7PD 3EEOA 3CURA 5GZ1A 3VPHA 1F51E 5BSUA 1OYOA 3W5BA 1ACLA 2EILB 2QRNA 4NJEA 4UDNA 3ZGZA 3VKGA 1WMEA 3P4YA 3G71V 1P75A 4RV9A 1EB9A 3EXIA 4FBMA 5CX1A 1XD9A 4UTZA 1KEVA 4FSHA 4FM0A 3EAGA 3KSRA 4G0NA 3BHPA 2WNIA 3KOZA 4IGAA 4KH0A 5TMEA 2ZAYA 4RANA 2CAZC 3H9EO 3MHSC 3LWQC 1L5HA 1R4NA 4GKAA 4C5BA 1GKKA 3INYA 4DV3B 2YWRA 5FB3A 1PJAA 3UJNA 1P7CA 5TPZD 4CC5A 3IFSA 3TNJA 2C9DA 3WYFA 5BVHB 1GZUA 5GZ3A 1XHFA 3IR5A 3OIYA 3X1JA 4L5BA 4YDQA 5U4QA 4UQPA 2ZRQA 5A03A 1MR3F 2JJ1D 3AZPA 4DLAA 1TVMA 1EWYA 2BE9A 4QYXA 4IEFB 1BSMA 1POXA 4P3NA 4TT3A 3DMRA 4P86A 4YDHB 3BRQA 4PZLA 3OQNA 2XF2A 4LF6B 3PVCA 2BMWA 1MDFA 1X1DA 2ZIGA 5F1OA 5YASA 4D2IA 2W8BB 3W3AA 1P29A 1Z0FA 4BUZA 2FJ0A 5BP7A 4F6LA 4L9AA 3JYCA 1DEKA 5BNWA 3K32A 4W1QA 1U28C 4PZEA 5IZ4A 1IWOA 1J09A 2HL6A 1ZM7A 3CUKA 4N3GA 2O3JA 2QTPA 2D5CA 4N0EA 2QUKA 2ZJ3A 1WNTA 4XWYA 2OGUA 4INOA 1NZFA 1YOBA 2HPHA 2PH1A 4L15A 1H6AA 5HFNA 1TFUA 4LZOA 1POWA 1QNLA 1RI2A 2YXLA 2Q9LA 4ZK7A 2RJOA 3FNGA 3PC3A 4TKUB 1KH3A 4ZEMA 4QE9A 1J8DA 5KYUB 1V54B 3QWAA 1J70A 1NI4B 4PQYA 4G0WA 2OENG 3CSXA 4Z8XA 2WPDA 3JQFC 4RM3A 3UXEA 2CL7X 3CPSA 5FNVF 3OBWA 4I14A 1NLFA 5L40A 2QDOA 4DR7O 3NFRA 5LOVF 3R24A 1ZGGA 3BY6A 4P4SA 3DLBA 1EDOA 1CJSA 3EQ8A 5H9WA 3GAMA 4A6EA 1TA4A 3TGPA 4LJ6A 4KX3A 5CFPA 2C2XA 1S5PA 1NF3A 1WP7A 2CHGA 3WIVA 4ISCA 2O6HA 3DVLA 3GB7C 4C0KA 1L4GA 1WZNA 4CIYA 3K9HA 3L7YA 1I4WA 3FKSA 4NFLA 4RIGA 2H1HA 5IG2A 4HAXA 3L5OA 1ECFA 1TZ2A 2QX7A 1CE8B 2H4FA 3LQ4A 2LD4A 4ZVKA 3SJ7A 3WO1A 3Q3GE 4DWVA 1FS6A 2QBYA 3KAKA 1FYFA 2V9YA 2FI1A 2I2CA 3A9RA 3RD5A 1RP1A 3SGLA 3IR9A 1K1EA 1P2VA 3EAQA 5E8RA 1VQPV 1F8UA 4KZPA 5ED4A 4FT2A 5E1AC 4BPBA 3C6ZA 2HYIC 2FDCA 2I3BA 3K06A 2A1UA 5U1PA 2WILA 4F60A 5IY5B 1U43A 4FD3A 3SJUA 2FNAA 2VJKA 4RAQA 4CUZA 3T3OA 3KPWA 3D36C 5KNLA 3AQ4A 2AA3A 3OBIA 4H1TA 2PVSA 3RVQA 1WB5A 1HG1A 1XEWY 3KB8A 2EFHB 4XM1A 2JFXA 4CRWB 1FFAA 2H4ZA 4M4SA 5LZ7A 3DULA 4P0TA 1CNMA 1KMHA 1QV7A 2ZJ5A 4JSRA 3ABUA 3QX7A 2V54A 1QHXA 5HW0A 2V6BA 3J81k 3BIJA 3F7OA 5HF5A 5CX1B 1LR1A 2XTZA 1N34O 4EGSA 1T4BA 1FYEA 3PEUA 1EK6A 1G3UA 1V3VA 1JG7A 3B9BA 3KRTA 2C5AA 5LA6A 2Z1DA 4RE6A 3LP5A 1OROA 3W05A 3C9TA 1FMTA 4A7PA 3IQDB 5H0IA 3EUFA 4OHYA 1XMXA 1LUWA 2BT4A 5AI4A 1IB0A 4FXPA 1U3GA 3TJTA 4BWGA 4IGFA 1U8UA 3IBSA 4WOJA 5BV0A 1B4DA 4DDUA 5LU9A 3K05A 4IJ5A 1OX4B 4LCBA 4LOAA 5F2OA 2Z83A 5DHUA 5HTKA 2HS3A 2QPTA 4G67A 1L5NA 1YQEA 2RHDA 4C7JA 3KB1A 3C8LA 4FZ0A 1Y81A 1ZIXA 1NV9A 1PD1A 3BFVA 3N86A 3E1GA 3ENQA 1JR3E 4LTDA 2ZJZA 1P1BA 1JECA 1IOVA 1YIOA 2C20A 2Q7EA 2F4VO 1Z6QA 4UD2A 2TMYA 3WPXA 2C2WA 1PR3A 3MCAB 2X40A 1NFRA 3MW8A 4J4BA 4MYCA 3VZSA 1U2PA 3DAOA 1CCWA 2WSIA 1ZG3A 4FHCA 3HXLA 1ESDA 2DJVA 4V0OA 4RFVA 3H4TA 3G2OA 3G80A 2DYRB 1LCIA 2YRXA 3D64A 3ZWWA 2CVZA 1P73A 4P54A 3BPZA 1N9GA 1ZM4A 5EMJA 4MRVA 5BT8A 5JWOA 4N40A 5FWXA 3T5AA 1DC8A 1ZI6A 4GI7A 2ODPA 5LZ5A 4HZGA 3TMAA 1R4AA 1X52A 1U31A 1XIVA 3BMNA 1NJIH 3C74A 5JR3A 5KREA 3IXQA 2WAMA 4JI6B 4LYHA 4QO8A 1I0ZA 4TV8B 2LUOA 1CDOA 3ZV7A 1XZJA 3KOYA 4M9ZA 2D4HA 2QY6A 3L4BC 3QITA 1NW7A 5B3LA 4LI3X 3TSWA 1LXCA 3QPCA 3I2KA 1Q57A 4OI4A 3RARA 5K8LA 4IX9A 3EFOB 4LRXA 5LMCA 2VSNA 4UEWA 3OUUA 3TSYA 3JYPA 5K0SA 4HEA1 1FJHA 2QXUA 1RSZA 2VR1A 2EIKB 3WKBA 2B5VA 1N3IA 2P41A 1CVRA 4EYOA 3RHTA 4CH6A 3SEFA 3CVUA 4ZQEA 4K0KO 4PPNA 5CA0F 1XTJA 1R0ZA 4JLKA 2JCXA 3JWEA 4BFWA 1S0VA 2BKLA 3U9SA 3WJRA 4J6EA 1PWYE 1E92A 4F8YA 4MYUA 4URWR 4XYMA 4U0JA 421PA 4RJJA 2A1IA 4Z6KA 2PKRA 1JAHA 5H70A 5K8JB 1PJBA 3KX2A 3AG4B 2OV3A 1AOXA 2AX4A 5LQCA 5LMNB 2MSWA 1OBOA 2UYNB 1KU0A 1QO0A 2EKQA 2IXFA 3E4DA 3NGMA 3O2JA 4FU0A 5K0BA 3BBLA 2QN8A 3BTSA 5E4JA 4NWIA 5B8FA 1XDGA 2R6AA 5EFOA 3UKOA 3A4YA 5D87A 5F3DA 3ESQA 4MDHA 2HMYB 2R11A 4MTCA 5BSMA 4DMGA 5DXAA 4EH1A 1SIOA 3OFND 5A3SA 4PF1A 1HNZB 3NBXX 1QG6A 4WCEV 2P67A 1M8PA 3K9CA 4PC2A 3ETDA 2JI8A 4ZO6A 1HG0A 3UZUA 4QEDA 1D4AA 4BVJA 4R0MA 4JVNA 1WPRA 4W5WA 5IAAA 2X13A 1WXWA 3LCVB 3LBAA 5DW3A 5F2KA 1SOVA 2WJJA 1L1EA 1PZXA 2XMQA 4LZJA 1PD0A 1KEKA 3DE0X 2P2CA 2ZWIA 1VM6A 1AC5A 3RS9A 1OXSC 2Q69A 4P80A 3TB6A 3P0HA 1OCOC 4C8IA 2HIAA 4PPYA 2AN1A 4WXYB 4EUNA 2RKWA 3RWRD 2DPXA 3ZMSA 1CU1A 1LC0A 2NW6A 1YK0A 2R65A 2AQHA 3MWEA 4IFBA 4TKVB 1G38A 4JGGA 1WZIA 3AWIA 4ND2A 1NHGA 4A9AA 1DNPA 1UBGA 5JJKA 2Q0XA 2J0UB 3EDCA 1Q1NA 4WN3A 4HGNA 4RKQA 2Y69B 2HK7A 2GM4A 3IVGA 3CRVA 2QSZA 3H5NA 4QO7A 4U2CA 4BT6A 1HYGA 1K5GA 3H84A 1AV6A 1QXSA 3HP4A 1GGNA 3K8OE 4LV8B 4IDDA 1SEVA 1OGIA 1EGVB 3U3MA 3A10A 3DBRB 5BT9A 1Z16A 2PZBA 2NR5A 3OD1A 4DNQA 1KYZA 1ZN7A 2C5HA 1VI5A 1R66A 1A0OA 3F90A 1E1QA 1HDCA 5E9QA 2I2XB 2OYSA 3D7RA 1RW4A 2ILVA 3A2NA 4NH4A 2YUAA 1OI7A 1JMKC 2F1RA 2VNHA 3FDIA 3ZEDA 2QN3A 2I0FA 1A88A 4UV8A 4JU9A 1TA9A 3MLBA 2IHKA 5TPWB 1X7YB 3G0IA 3TXAA 4PHHA 5T3YA 5GM2A 3OQIB 4LDZA 1KU6A 1SVSA 4ND6A 4PNZA 1YRLA 4JLSA 1H4SA 3KELA 1W5EA 1LBEA 4PRLA 2KHZA 3IDQA 3UY4A 1FVFA 2PUAA 1ZEMA 5JO9A 3THXB 1L9KA 3CSUA 3L4BA 2QAGB 3H16A 4FYMA 2CXSA 2WRZA 2GZ2A 1ANKA 4HG2A 2GLZA 4FJ0A 4YLGA 5AXBA 3GWOA 3WV4A 3ZZ0A 3I5XA 3QLTA 1NVVR 1GZVA 3R9KA 4PYNA 4Q5IA 1TM5E 2Y92A 4LH7A 4JCOA 2EOAA 1QG2A 1HT3A 1E2KA 2IHTA 3KR1A 4WX2B