2IQQA

The crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPETVDPASMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Iron, Sulfur-Dependent L-serine dehydratase
publication title The Crystal Structure of Iron, Sulfur-Dependent L-serine dehydratase from Legionella pneumophila subsp. pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 37
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03315 SDH_beta Serine dehydratase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iqqA00
4RQOA 3DDNA 1YGYA 3DC2A 2IAFA 2IQQA
chains in the Genus database with same CATH superfamily
5LOVB 2KTVA 4DRXA 4BW0B 3NK7A 3LMEA 3QUWA 4BT7A 2G9IA 5G4VC 3GHZA 1SA0A 3OW2F 1KNKA 4ZOLB 3ESJA 5KX5A 3HAXD 3N2KA 2IQQA 3V4DA 1FNJA 3J7AR 3G71F 3RYCB 1IV2A 3IR9A 5J2UB 2HS0A 4NWOB 3VYUC 3WGMA 1TVKA 3WJQA 1DBFA 5GAPK 2OHWA 2AMTA 1KNJA 1ONIA 2GVIA 4C4WC 4FFBA 5LP6C 1VQPF 3P10A 3GYQA 2FGYA 2BO1A 3RE3A 1SDSA 3CG6A 1YGYA 1ZWZA 4O4HB 5JQGA 1YJNF 5EAZA 3CXCF 4ERHA 4O4LB 1YQNA 1QAHA 2UZHA 4EI9A 1PXWA 4TV8A 3DC2A 4BT5A 1Q82H 3IKFA 4LCKA 2Q1XA 3S02A 4X1YA 4E6EA 1K73H 4TUYB 5EYPA 2JNBA 5LA6A 2PHNA 4X1IA 3RYHA 2H8EA 4I50B 5FLXM 3ZO8A 3M4SA 5FJ4C 1W42A 2QTPA 5EB1B 5LYJB 4B45A 1TUBA 5CA1B 2H8CA 3JAKA 1CLIA 3PLAC 5LP6B 3WGJA 2HS4A 2VXYA 3DDNA 3ZP4A 5G4UC 3J81M 3V3TA 3WGNA 3V7QA 4B5CA 2UYJA 1U43A 2AIFA 4ZK7A 1XRGA 4IHJB 3D54A 3VTIC 4O2AB 1IV1A 5BMVA 5LXTA 3HJWC 4ZHVA 1JN1A 3M84A 4O2BA 5FNVA 4X3MA 4U39A 1VH8A 4RHAA 1IV4A 2UYNA 2CVLA 3VIUA 1XBIA 2F9ZC 3NVIB 4ZHQA 3HWUA 3B6NA 5EIBD 4X1KA 3HKEA 3U0OA 1Q8RA 2CHSA 1X7OA 3E1YA 3S06A 3O85A 3NK6A 5HY2A 3JAWA 4RQOA 2OTLF 2CHTA 3MDOA 3PAFA 5GONA 2B33A 3P4EA 3FD6A 3EORA 5GINC 5IJ0B 1W59A 4O4IA 3CMAF 4EB6A 5IYZA 3HKBA 4C81A 2Z1TA 2HRUA 4WBNB 4XCQA 2ZOVA 3T80A 3RYIB 1S72F 2W8BC 2QEXF 3CCJF 1SA0B 3S0WA 1U3PA 5CB4B 3JARA 5A2QM 4C8GA 2VGMA 3SIVA 2ZVZA 4HNAA 3JALA 4I55B 4TV9A 4YJ2A 1JFFA 1W41A 4O4JA 1W5EA 2KGWA 3N4ZA 3WPXA 1VK3A 3QTYA 1M1KH 1RLUA 4G4ZA 3UT5B 1RQ2A 1Z5VA 1UFYA 3JATB 3KHNA 3ON1A 1YI2F 1VQMF 2HQSC 3D00A 4KWEA 1VQNF 5EZYB 4EI8A 3AGKA 4IIJA 5CA0A 4BVSA 5JVDA 3I3FA 5ITZB 4LNUA 3HKDA 4ZI7B 4BT3A 5GIOC 1U40A 3VOAA 3VMFB 3G6EF 4F6RA 1W40A 1SZQA 1DT9A 4YJ3A 3S0YA 1W581 4M8IA 2YYEA 3K0TA 5LA6B 2RB9A 3F6MA 3RYHB 3CPWF 3RYFA 5HY4A 5HY0A 2V9YA 2CSLA 3WXMB 2HP0B 1NQ3A 1RA4A 2UYPA 1W2BF 5LOVA 3VI6A 3N2GB 1M90H 2N48A 2ZF8A 2WALA 5HP8A 2LCAA 4B46A 4NUTA 1VQOF 1CN7A 4ZOLA 4C8IA 3CCSF 1JY8A 5EWRA 1K9MH 3Q8HA 1VQ4F 3HKCB 3LDTA 4G88A 3C9TA 3RYCA 5J2UA 1KD1H 3BYQA 3KE1A 4TZZA 3ZOPA 2Z1FA 3MQWA 5JCOA 5FNVB 1H7MA 1VQLF 2Z1EA 2HX0A 3FBAA 3CCEF 4X20B 1N8RH 2BTOA 3C9SA 1VHAA 2Z01A 4BVQA 4O4HA 3LWPC 1QVFF 2EWCA 3FFMA 4R40B 4I4TB 3VYTC 3C9UA 3CCQF 5IJ9B 5C8YB 1GX1A 1YJ9F 4O4LA 5EB0A 3JASB 1JD1A 1GO1A 5JH7B 4EB6B 3SIUA 1Q7YH 1IPAA 4BY9D 3CC4F 2CZWA 5B8FA 1ODEA 2DYYA 4TUYA 2YXZA 3E22B 4I50A 2MQEA 2QI2A 3CD6F 4U3JB 3LWOC 2OZBA 5LYJA 2PMPA 1W3EX 3KJKA 5CA1A 5LP6A 2I6DA 3IEQA 3VOBA 1QVGF 4G4YA 4BVRA 5KMGB 1RQ7A 5MN5A 2RHLA 3V7EA 1T0KB 3S0HA 4DRXB 3CYPB 3CCVF 3OONA 1Q86H 1GO0A 4IHJA 1COMA 1X7PA 4O2AA 4ZHYB 3CPQA 2VAMA 3QHDA 2IAFA 1VQVA 5KX5B 3WJPA 3CCLF 3N2KB 3I7TA 2HP3A 2LBTA 2LBXA 3D01A 1T0AA 3MCQA 3IMPA 2P6YA 1VQKF 5EIBC 1TVKB 3M1XA 1W5FA 2ALEA 1FFXA 1OFUA 2BTUA 3CC7F 1QD9A 2LBWA 5IT9M 4C8EA 4FFBB 1IV3A 4G4VA 2L26A 2RHOA 1GZ0A 4NQ3A 3ZP7A 5JQGB 4C82A 3L7QA 5J2TA 1W5AA 3CYQA 1PF5A 2I6RA 3F0EA 3K14A 3OBYA 5IJ0A 4TV8B 2QA4F 3LWVC 4X3LA 4WBNA 3F0GA 5AVMA 2UYKA 3RYIA 2HS3A 4PWTA 4BT4A 3CMEF 4ZHWA 2GLZA 5DCVA 4B62A 1RLGA 5CB4A 2ZODA 2KG4A 2VGNA 1Q81H 4X1YB 5EYPB 3S03A 4X1IB 3LWQC 3TD5A 4G4XA 4I55A 1YJWF 4BT2A 1TUBB 3F0DA 3JAKB 3CC2F 3UT5A 1YITF 3JATA 3I56F 5EO3A 2DT4A 3IKEA 2R751 2RHHA 5BMVB 1K8AH 5EZYA 2ZAUA 3FPIA 5GIPC 5LXTB 5MN6A 2Q1YA 2VAPA 3K12A 4O2BB 1E7KA 3P0ZA 3C8LA 3ERNA 5ITZA 1YIJF 2OTJF 3GTZA 4ZI7A 1H47A 3WGKA 5MN4A 1UI9A 3MCAB 4BT6A 3G4SF 3I55F 3CB2A 2UYNB 5HXZA 3TD4A 1H48A 1OAPA 1VQ9F 3J80M 3WGLA 4ZHQB 4X1KB 3HKEB 3HTNA 1XV2A 1W57A 2HP0A 3JAWB 3LWRC 1U3LA 3ELCA 1VQ5F 3N2GA 2IG8A 5GONB 3WPWA 3NMUC 1R1MA 2KTUA 4O4IB 5IYZB 3HKBB 3VCZA 1Z5WA 3TD3A 1FNKA 1X25A 3HKCA 3NVKE 1KQSF 3N4YA 3E20B 1CK2A 3C9RA 3VO8A 1VQ7F 2FC3A 2H6LA 3IEWA 3JARB 2RHJA 3OBWA 3RA5A 3LFOA 3CCUF 4EI7A 4X20A 3KJJA 1NJIH 2OTMA 4HNAB 2K1SA 5HY1A 1X52A 3JALB 4TV9B 4YJ2B 1JFFB 4O4JB 1FFXB 2R6R1 1JJ2F 3RA6A 4I4TA 2GZLA 5IJ9A 5C8YA 1J7HA 3JASA 3JCMM 1VQ6F 3R0PA 3KIZA 3VYSC 2ZVYA 4BVTA 5J2TB 4IIJB 1NMUB 3CCRF 5JH7A 5HXUA 5HWEA 2Z1UA 1FSZA 1QU9A 1W55A 5CA0B 3CCMF 5JVDB 5JCOC 1KC8H 3JVHA 3HKDB 3MBMA 4LNUB 1VQ8F 2HVYD 2AIZP 2CW4A 5GANK 2NMUA 2BTQB 3F0FA 3E22A 3K2XA 2HRYA 1XHOA 4F6RB 1W5BA 4U3JA 4YJ3B 2VAWA 4DXDA 3JAMM 2CWJA 4G4WA 1YHQF 3WJRA 3RYFB 3FD5A 5HP7A 3LYBA 5KMGA
chains in the Genus database with same CATH topology
4RQOA 3DDNA 1YGYA 3DC2A 2IAFA 2IQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQO A;  3DDN A;  1YGY A;  3DC2 A;  2IAF A;  2IQQ A; 
#chains in the Genus database with same CATH topology
 5LOV B;  2KTV A;  4DRX A;  4BW0 B;  3NK7 A;  3LME A;  3QUW A;  4BT7 A;  2G9I A;  5G4V C;  3GHZ A;  1SA0 A;  3OW2 F;  1KNK A;  4ZOL B;  3ESJ A;  5KX5 A;  3HAX D;  3N2K A;  2IQQ A;  3V4D A;  1FNJ A;  3J7A R;  3G71 F;  3RYC B;  1IV2 A;  3IR9 A;  5J2U B;  2HS0 A;  4NWO B;  3VYU C;  3WGM A;  1TVK A;  3WJQ A;  1DBF A;  5GAP K;  2OHW A;  2AMT A;  1KNJ A;  1ONI A;  2GVI A;  4C4W C;  4FFB A;  5LP6 C;  1VQP F;  3P10 A;  3GYQ A;  2FGY A;  2BO1 A;  3RE3 A;  1SDS A;  3CG6 A;  1YGY A;  1ZWZ A;  4O4H B;  5JQG A;  1YJN F;  5EAZ A;  3CXC F;  4ERH A;  4O4L B;  1YQN A;  1QAH A;  2UZH A;  4EI9 A;  1PXW A;  4TV8 A;  3DC2 A;  4BT5 A;  1Q82 H;  3IKF A;  4LCK A;  2Q1X A;  3S02 A;  4X1Y A;  4E6E A;  1K73 H;  4TUY B;  5EYP A;  2JNB A;  5LA6 A;  2PHN A;  4X1I A;  3RYH A;  2H8E A;  4I50 B;  5FLX M;  3ZO8 A;  3M4S A;  5FJ4 C;  1W42 A;  2QTP A;  5EB1 B;  5LYJ B;  4B45 A;  1TUB A;  5CA1 B;  2H8C A;  3JAK A;  1CLI A;  3PLA C;  5LP6 B;  3WGJ A;  2HS4 A;  2VXY A;  3DDN A;  3ZP4 A;  5G4U C;  3J81 M;  3V3T A;  3WGN A;  3V7Q A;  4B5C A;  2UYJ A;  1U43 A;  2AIF A;  4ZK7 A;  1XRG A;  4IHJ B;  3D54 A;  3VTI C;  4O2A B;  1IV1 A;  5BMV A;  5LXT A;  3HJW C;  4ZHV A;  1JN1 A;  3M84 A;  4O2B A;  5FNV A;  4X3M A;  4U39 A;  1VH8 A;  4RHA A;  1IV4 A;  2UYN A;  2CVL A;  3VIU A;  1XBI A;  2F9Z C;  3NVI B;  4ZHQ A;  3HWU A;  3B6N A;  5EIB D;  4X1K A;  3HKE A;  3U0O A;  1Q8R A;  2CHS A;  1X7O A;  3E1Y A;  3S06 A;  3O85 A;  3NK6 A;  5HY2 A;  3JAW A;  4RQO A;  2OTL F;  2CHT A;  3MDO A;  3PAF A;  5GON A;  2B33 A;  3P4E A;  3FD6 A;  3EOR A;  5GIN C;  5IJ0 B;  1W59 A;  4O4I A;  3CMA F;  4EB6 A;  5IYZ A;  3HKB A;  4C81 A;  2Z1T A;  2HRU A;  4WBN B;  4XCQ A;  2ZOV A;  3T80 A;  3RYI B;  1S72 F;  2W8B C;  2QEX F;  3CCJ F;  1SA0 B;  3S0W A;  1U3P A;  5CB4 B;  3JAR A;  5A2Q M;  4C8G A;  2VGM A;  3SIV A;  2ZVZ A;  4HNA A;  3JAL A;  4I55 B;  4TV9 A;  4YJ2 A;  1JFF A;  1W41 A;  4O4J A;  1W5E A;  2KGW A;  3N4Z A;  3WPX A;  1VK3 A;  3QTY A;  1M1K H;  1RLU A;  4G4Z A;  3UT5 B;  1RQ2 A;  1Z5V A;  1UFY A;  3JAT B;  3KHN A;  3ON1 A;  1YI2 F;  1VQM F;  2HQS C;  3D00 A;  4KWE A;  1VQN F;  5EZY B;  4EI8 A;  3AGK A;  4IIJ A;  5CA0 A;  4BVS A;  5JVD A;  3I3F A;  5ITZ B;  4LNU A;  3HKD A;  4ZI7 B;  4BT3 A;  5GIO C;  1U40 A;  3VOA A;  3VMF B;  3G6E F;  4F6R A;  1W40 A;  1SZQ A;  1DT9 A;  4YJ3 A;  3S0Y A;  1W58 1;  4M8I A;  2YYE A;  3K0T A;  5LA6 B;  2RB9 A;  3F6M A;  3RYH B;  3CPW F;  3RYF A;  5HY4 A;  5HY0 A;  2V9Y A;  2CSL A;  3WXM B;  2HP0 B;  1NQ3 A;  1RA4 A;  2UYP A;  1W2B F;  5LOV A;  3VI6 A;  3N2G B;  1M90 H;  2N48 A;  2ZF8 A;  2WAL A;  5HP8 A;  2LCA A;  4B46 A;  4NUT A;  1VQO F;  1CN7 A;  4ZOL A;  4C8I A;  3CCS F;  1JY8 A;  5EWR A;  1K9M H;  3Q8H A;  1VQ4 F;  3HKC B;  3LDT A;  4G88 A;  3C9T A;  3RYC A;  5J2U A;  1KD1 H;  3BYQ A;  3KE1 A;  4TZZ A;  3ZOP A;  2Z1F A;  3MQW A;  5JCO A;  5FNV B;  1H7M A;  1VQL F;  2Z1E A;  2HX0 A;  3FBA A;  3CCE F;  4X20 B;  1N8R H;  2BTO A;  3C9S A;  1VHA A;  2Z01 A;  4BVQ A;  4O4H A;  3LWP C;  1QVF F;  2EWC A;  3FFM A;  4R40 B;  4I4T B;  3VYT C;  3C9U A;  3CCQ F;  5IJ9 B;  5C8Y B;  1GX1 A;  1YJ9 F;  4O4L A;  5EB0 A;  3JAS B;  1JD1 A;  1GO1 A;  5JH7 B;  4EB6 B;  3SIU A;  1Q7Y H;  1IPA A;  4BY9 D;  3CC4 F;  2CZW A;  5B8F A;  1ODE A;  2DYY A;  4TUY A;  2YXZ A;  3E22 B;  4I50 A;  2MQE A;  2QI2 A;  3CD6 F;  4U3J B;  3LWO C;  2OZB A;  5LYJ A;  2PMP A;  1W3E X;  3KJK A;  5CA1 A;  5LP6 A;  2I6D A;  3IEQ A;  3VOB A;  1QVG F;  4G4Y A;  4BVR A;  5KMG B;  1RQ7 A;  5MN5 A;  2RHL A;  3V7E A;  1T0K B;  3S0H A;  4DRX B;  3CYP B;  3CCV F;  3OON A;  1Q86 H;  1GO0 A;  4IHJ A;  1COM A;  1X7P A;  4O2A A;  4ZHY B;  3CPQ A;  2VAM A;  3QHD A;  2IAF A;  1VQV A;  5KX5 B;  3WJP A;  3CCL F;  3N2K B;  3I7T A;  2HP3 A;  2LBT A;  2LBX A;  3D01 A;  1T0A A;  3MCQ A;  3IMP A;  2P6Y A;  1VQK F;  5EIB C;  1TVK B;  3M1X A;  1W5F A;  2ALE A;  1FFX A;  1OFU A;  2BTU A;  3CC7 F;  1QD9 A;  2LBW A;  5IT9 M;  4C8E A;  4FFB B;  1IV3 A;  4G4V A;  2L26 A;  2RHO A;  1GZ0 A;  4NQ3 A;  3ZP7 A;  5JQG B;  4C82 A;  3L7Q A;  5J2T A;  1W5A A;  3CYQ A;  1PF5 A;  2I6R A;  3F0E A;  3K14 A;  3OBY A;  5IJ0 A;  4TV8 B;  2QA4 F;  3LWV C;  4X3L A;  4WBN A;  3F0G A;  5AVM A;  2UYK A;  3RYI A;  2HS3 A;  4PWT A;  4BT4 A;  3CME F;  4ZHW A;  2GLZ A;  5DCV A;  4B62 A;  1RLG A;  5CB4 A;  2ZOD A;  2KG4 A;  2VGN A;  1Q81 H;  4X1Y B;  5EYP B;  3S03 A;  4X1I B;  3LWQ C;  3TD5 A;  4G4X A;  4I55 A;  1YJW F;  4BT2 A;  1TUB B;  3F0D A;  3JAK B;  3CC2 F;  3UT5 A;  1YIT F;  3JAT A;  3I56 F;  5EO3 A;  2DT4 A;  3IKE A;  2R75 1;  2RHH A;  5BMV B;  1K8A H;  5EZY A;  2ZAU A;  3FPI A;  5GIP C;  5LXT B;  5MN6 A;  2Q1Y A;  2VAP A;  3K12 A;  4O2B B;  1E7K A;  3P0Z A;  3C8L A;  3ERN A;  5ITZ A;  1YIJ F;  2OTJ F;  3GTZ A;  4ZI7 A;  1H47 A;  3WGK A;  5MN4 A;  1UI9 A;  3MCA B;  4BT6 A;  3G4S F;  3I55 F;  3CB2 A;  2UYN B;  5HXZ A;  3TD4 A;  1H48 A;  1OAP A;  1VQ9 F;  3J80 M;  3WGL A;  4ZHQ B;  4X1K B;  3HKE B;  3HTN A;  1XV2 A;  1W57 A;  2HP0 A;  3JAW B;  3LWR C;  1U3L A;  3ELC A;  1VQ5 F;  3N2G A;  2IG8 A;  5GON B;  3WPW A;  3NMU C;  1R1M A;  2KTU A;  4O4I B;  5IYZ B;  3HKB B;  3VCZ A;  1Z5W A;  3TD3 A;  1FNK A;  1X25 A;  3HKC A;  3NVK E;  1KQS F;  3N4Y A;  3E20 B;  1CK2 A;  3C9R A;  3VO8 A;  1VQ7 F;  2FC3 A;  2H6L A;  3IEW A;  3JAR B;  2RHJ A;  3OBW A;  3RA5 A;  3LFO A;  3CCU F;  4EI7 A;  4X20 A;  3KJJ A;  1NJI H;  2OTM A;  4HNA B;  2K1S A;  5HY1 A;  1X52 A;  3JAL B;  4TV9 B;  4YJ2 B;  1JFF B;  4O4J B;  1FFX B;  2R6R 1;  1JJ2 F;  3RA6 A;  4I4T A;  2GZL A;  5IJ9 A;  5C8Y A;  1J7H A;  3JAS A;  3JCM M;  1VQ6 F;  3R0P A;  3KIZ A;  3VYS C;  2ZVY A;  4BVT A;  5J2T B;  4IIJ B;  1NMU B;  3CCR F;  5JH7 A;  5HXU A;  5HWE A;  2Z1U A;  1FSZ A;  1QU9 A;  1W55 A;  5CA0 B;  3CCM F;  5JVD B;  5JCO C;  1KC8 H;  3JVH A;  3HKD B;  3MBM A;  4LNU B;  1VQ8 F;  2HVY D;  2AIZ P;  2CW4 A;  5GAN K;  2NMU A;  2BTQ B;  3F0F A;  3E22 A;  3K2X A;  2HRY A;  1XHO A;  4F6R B;  1W5B A;  4U3J A;  4YJ3 B;  2VAW A;  4DXD A;  3JAM M;  2CWJ A;  4G4W A;  1YHQ F;  3WJR A;  3RYF B;  3FD5 A;  5HP7 A;  3LYB A;  5KMG A; 
#chains in the Genus database with same CATH homology
 4RQO A;  3DDN A;  1YGY A;  3DC2 A;  2IAF A;  2IQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...