2IQQA

The crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
b'SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPETVDPASMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron, Sulfur-Dependent L-serine dehydratase
molecule tags Lyase
source organism Legionella pneumophila subsp. pneumophila
publication title The Crystal Structure of Iron, Sulfur-Dependent L-serine dehydratase from Legionella pneumophila subsp. pneumophila
rcsb
total genus 37
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03315 SDH_beta Serine dehydratase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iqqA00
3DDNA 2IAFA 2IQQA 4RQOA 1YGYA 3DC2A
chains in the Genus database with same CATH superfamily
2Z1EA 2V9YA 5C8YB 5KMGB 5EWRA 1DBFA 3RE3A 1W5FA 3ERNA 4G4ZA 4ZHVA 2VAPA 3D00A 3JAWA 4YJ2A 3CYQA 1QAHA 3HAXD 3CCEF 3LMEA 3TD3A 3MQWA 1M90H 1W3EX 3IKFA 2HS0A 1VQ9F 1TUBA 3ELCA 3JASB 3S0YA 4IIJA 2AMTA 5IYZA 3WGMA 1T0KB 2BO1A 5LXTB 1JN1A 2IAFA 3C9SA 2I6DA 4O4JB 2ZVZA 5J2UB 2BTUA 3GTZA 5CA0B 5A2QM 5EYPB 4ZHWA 2GZLA 3HTNA 1Q7YH 5CA1A 3RYIB 4ZHQA 2UZHA 4O2AA 2QTPA 3VTIC 3HWUA 2BTQB 3J81M 1RA4A 4DRXA 3LFOA 1SZQA 1M1KH 4X3LA 2R6R1 4BVRA 4X1KA 5IJ0A 3CB2A 5LP6C 3G6EF 3GYQA 5FJ4C 1YGYA 2HP3A 4IHJA 4C81A 3VOAA 5GINC 4F6RA 2OHWA 1RLGA 4I50A 3N2GB 2Q1YA 1U3PA 1X7PA 1UI9A 4O4LA 1CK2A 1U3LA 3KE1A 1KNJA 3VI6A 4BVSA 2ZOVA 1SA0B 3KIZA 4G4VA 3LWRC 4BT3A 4NUTA 3VYSC 2CHTA 3ZP7A 1S72F 3JAKA 1NJIH 3CYPB 2PHNA 4TUYA 1W41A 3M84A 1GX1A 3CPQA 5J2TB 3L7QA 1K73H 4G4YA 5JQGA 5GAPK 3F6MA 3AGKA 2ZODA 1ONIA 1KD1H 2RB9A 2QI2A 1R1MA 3CCVF 1FNJA 3CCRF 1JY8A 5JVDA 1VH8A 3N2KB 3CMEF 2IQQA 2KG4A 3GHZA 2Q1XA 2I6RA 4XCQA 4C82A 3HKBA 2EWCA 3M1XA 2CZWA 3OBYA 3JCMM 3F0FA 2UYNA 4BT5A 3N2KA 1ODEA 4R40B 3QUWA 2FC3A 5JH7B 5EZYB 3D54A 5GIPC 3IMPA 5LOVB 4IIJB 4BW0B 2LBWA 3MBMA 1TUBB 1XHOA 1U40A 1XBIA 1CLIA 3HJWC 4YJ3A 3LWOC 1VQOF 4U3JA 3PLAC 1GO1A 5KX5A 2UYKA 5C8YA 5EZYA 3CCJF 3Q8HA 5LOVA 3RYCB 2RHJA 1K8AH 1Q86H 3P0ZA 1K9MH 3KJKA 3FBAA 4X1YA 4DXDA 1SDSA 1YJNF 2DYYA 3LWPC 3PAFA 4EB6B 1YI2F 4RHAA 3WJPA 3LDTA 2QEXF 2VGNA 4TV8A 1W40A 4X1KB 1U43A 2UYNB 5KMGA 4F6RB 2OZBA 3C8LA 5EAZA 2KGWA 3B6NA 3SIVA 5BMVB 5LXTA 2OTJF 1CN7A 3RYFB 3E22A 1VQNF 3S03A 1QU9A 2VAWA 3LWQC 1W59A 3RYIA 4ZHQB 2GVIA 4WBNA 3IEWA 1VQ6F 3S0HA 3T80A 2IG8A 5MN4A 4O2BA 3JAMM 5LYJB 2VAMA 3KHNA 2Z1FA 1GO0A 3BYQA 4LNUA 1QVFF 2P6YA 3U0OA 4BVQA 3K12A 3OONA 5AVMA 3QTYA 3JARA 3F0EA 3EORA 1OAPA 1TVKB 2HS4A 2OTMA 3I7TA 3F0DA 1FFXB 1JFFB 3VMFB 4I4TB 1JD1A 3RYHB 1YITF 1W55A 1W581 2HVYD 2MQEA 2NMUA 3HKDA 4G88A 4G4WA 2K1SA 3I3FA 2H8CA 3CG6A 5IJ0B 2W8BC 3VOBA 1PXWA 3CCSF 4ZOLB 4HNAA 3I55F 3HKBB 3RYHA 1UFYA 4KWEA 1W42A 4HNAB 4BT7A 3WGJA 2HQSC 3K14A 4ZOLA 1H48A 3V7QA 4O4HB 2HX0A 5HY0A 4O4JA 5CA0A 5ITZB 5EIBD 5KX5B 4ZI7B 5LP6A 3RYCA 4X20B 5HY1A 4EI7A 4TUYB 3HKEB 5GONB 3RA5A 3ZP4A 2CSLA 2UYPA 4U3JB 1VQ7F 3JVHA 2CW4A 2HRYA 3C9TA 3G71F 1IV3A 4RQOA 1VQPF 3JASA 5JCOC 3HKEA 3FPIA 4NQ3A 4TV9A 3JALB 4X20A 5JCOA 5IT9M 5GIOC 3CD6F 4B46A 1YIJF 1T0AA 3HKCB 1KQSF 2HS3A 1X25A 3OW2F 3VYUC 4EB6A 1VQ4F 2ZAUA 3E22B 4WBNB 3WGLA 3FD6A 3KJJA 2VXYA 5IJ9B 4FFBA 3WXMB 3RYFA 3RA6A 3JARB 2YYEA 3LWVC 4B45A 2HP0B 5IYZB 1GZ0A 3D01A 5HP8A 3WJRA 5JQGB 3UT5A 1KNKA 5HP7A 4EI9A 1JFFA 1H7MA 2L26A 2AIFA 3MCQA 2FGYA 2H8EA 4X1IA 5HXUA 5FNVB 3WPWA 3JAKB 2CWJA 4X1YB 3C9UA 3TD5A 3JATB 2G9IA 2VGMA 3P4EA 3V4DA 4ZHYB 1NQ3A 5FNVA 4C8GA 1OFUA 3FD5A 3K2XA 3V3TA 5JH7A 2PMPA 1FSZA 5BMVA 2AIZP 4O2BB 3K0TA 1X52A 3VYTC 2RHOA 4X3MA 5JVDB 3N4ZA 2DT4A 3VIUA 3ZO8A 4O4IA 5HY2A 4I55A 3CPWF 2KTVA 5EIBC 4ERHA 4EI8A 1W5EA 1FNKA 4C8IA 3SIUA 5J2TA 3CMAF 1E7KA 3C9RA 1VQMF 3WPXA 1VQLF 5G4UC 5B8FA 4TV8B 1YQNA 3S06A 3ESJA 1JJ2F 3OBWA 1W57A 1DT9A 1IPAA 3E20B 3V7EA 5J2UA 4I50B 3CCLF 5LP6B 4YJ3B 3O85A 5GANK 4E6EA 4ZK7A 2OTLF 2HRUA 4M8IA 4BT4A 2CHSA 3MDOA 5LYJA 3WGKA 3DDNA 1SA0A 3N2GA 2BTOA 4I55B 5IJ9A 5ITZA 5DCVA 5MN5A 3CC4F 2ALEA 4G4XA 4O4LB 3I56F 3NVKE 1XRGA 3JAWB 4YJ2B 1QD9A 4BT2A 4FFBB 3FFMA 3NVIB 1VK3A 4BY9D 2JNBA 4O4HA 3NMUC 1VQVA 5HWEA 1ZWZA 2HP0A 3QHDA 1IV2A 1KC8H 1RQ7A 1VQ5F 1VHAA 3S0WA 1J7HA 4B62A 2Z01A 2Z1UA 1IV4A 3TD4A 5CA1B 1Z5WA 2KTUA 5CB4A 1NMUB 4O2AB 1Q8RA 3DC2A 3JALA 1X7OA 5EYPA 1PF5A 2QA4F 3WGNA 2ZF8A 4X1IB 2ZVYA 1W5BA 4U39A 3CCUF 3IKEA 4DRXB 3CC2F 3E1YA 5FLXM 4TV9B 1VQ8F 5EB0A 4PWTA 3ZOPA 5HXZA 3UT5B 4LNUB 3P10A 4B5CA 3CCMF 3R0PA 4IHJB 3HKCA 1H47A 5LA6B 1RQ2A 3IEQA 3J80M 2H6LA 2N48A 2YXZA 1RLUA 1QVGF 2LBXA 1W5AA 2RHLA 3LYBA 3F0GA 3NK7A 3VO8A 5MN6A 2RHHA 3JATA 3S02A 3WJQA 1TVKA 5EB1B 3N4YA 3IR9A 2Z1TA 1COMA 5LA6A 4C8EA 4BVTA 5GONA 1XV2A 2B33A 5G4VC 4BT6A 5CB4B 1YHQF 1Q81H 1YJ9F 2R751 3VCZA 2LBTA 1W2BF 5EO3A 4ZI7A 1VQKF 2LCAA 2GLZA 3ON1A 2F9ZC 4O4IB 2UYJA 3MCAB 3NK6A 4NWOB 3CXCF 3CCQF 4LCKA 1Z5VA 3HKDB 3J7AR 3CC7F 5HY4A 1IV1A 2CVLA 1Q82H 3G4SF 1YJWF 2WALA 1FFXA 4C4WC 4TZZA 1N8RH 4I4TA 3M4SA
chains in the Genus database with same CATH topology
3DDNA 2IAFA 2IQQA 4RQOA 1YGYA 3DC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDN A;  2IAF A;  2IQQ A;  4RQO A;  1YGY A;  3DC2 A; 
#chains in the Genus database with same CATH topology
 2Z1E A;  2V9Y A;  5C8Y B;  5KMG B;  5EWR A;  1DBF A;  3RE3 A;  1W5F A;  3ERN A;  4G4Z A;  4ZHV A;  2VAP A;  3D00 A;  3JAW A;  4YJ2 A;  3CYQ A;  1QAH A;  3HAX D;  3CCE F;  3LME A;  3TD3 A;  3MQW A;  1M90 H;  1W3E X;  3IKF A;  2HS0 A;  1VQ9 F;  1TUB A;  3ELC A;  3JAS B;  3S0Y A;  4IIJ A;  2AMT A;  5IYZ A;  3WGM A;  1T0K B;  2BO1 A;  5LXT B;  1JN1 A;  2IAF A;  3C9S A;  2I6D A;  4O4J B;  2ZVZ A;  5J2U B;  2BTU A;  3GTZ A;  5CA0 B;  5A2Q M;  5EYP B;  4ZHW A;  2GZL A;  3HTN A;  1Q7Y H;  5CA1 A;  3RYI B;  4ZHQ A;  2UZH A;  4O2A A;  2QTP A;  3VTI C;  3HWU A;  2BTQ B;  3J81 M;  1RA4 A;  4DRX A;  3LFO A;  1SZQ A;  1M1K H;  4X3L A;  2R6R 1;  4BVR A;  4X1K A;  5IJ0 A;  3CB2 A;  5LP6 C;  3G6E F;  3GYQ A;  5FJ4 C;  1YGY A;  2HP3 A;  4IHJ A;  4C81 A;  3VOA A;  5GIN C;  4F6R A;  2OHW A;  1RLG A;  4I50 A;  3N2G B;  2Q1Y A;  1U3P A;  1X7P A;  1UI9 A;  4O4L A;  1CK2 A;  1U3L A;  3KE1 A;  1KNJ A;  3VI6 A;  4BVS A;  2ZOV A;  1SA0 B;  3KIZ A;  4G4V A;  3LWR C;  4BT3 A;  4NUT A;  3VYS C;  2CHT A;  3ZP7 A;  1S72 F;  3JAK A;  1NJI H;  3CYP B;  2PHN A;  4TUY A;  1W41 A;  3M84 A;  1GX1 A;  3CPQ A;  5J2T B;  3L7Q A;  1K73 H;  4G4Y A;  5JQG A;  5GAP K;  3F6M A;  3AGK A;  2ZOD A;  1ONI A;  1KD1 H;  2RB9 A;  2QI2 A;  1R1M A;  3CCV F;  1FNJ A;  3CCR F;  1JY8 A;  5JVD A;  1VH8 A;  3N2K B;  3CME F;  2IQQ A;  2KG4 A;  3GHZ A;  2Q1X A;  2I6R A;  4XCQ A;  4C82 A;  3HKB A;  2EWC A;  3M1X A;  2CZW A;  3OBY A;  3JCM M;  3F0F A;  2UYN A;  4BT5 A;  3N2K A;  1ODE A;  4R40 B;  3QUW A;  2FC3 A;  5JH7 B;  5EZY B;  3D54 A;  5GIP C;  3IMP A;  5LOV B;  4IIJ B;  4BW0 B;  2LBW A;  3MBM A;  1TUB B;  1XHO A;  1U40 A;  1XBI A;  1CLI A;  3HJW C;  4YJ3 A;  3LWO C;  1VQO F;  4U3J A;  3PLA C;  1GO1 A;  5KX5 A;  2UYK A;  5C8Y A;  5EZY A;  3CCJ F;  3Q8H A;  5LOV A;  3RYC B;  2RHJ A;  1K8A H;  1Q86 H;  3P0Z A;  1K9M H;  3KJK A;  3FBA A;  4X1Y A;  4DXD A;  1SDS A;  1YJN F;  2DYY A;  3LWP C;  3PAF A;  4EB6 B;  1YI2 F;  4RHA A;  3WJP A;  3LDT A;  2QEX F;  2VGN A;  4TV8 A;  1W40 A;  4X1K B;  1U43 A;  2UYN B;  5KMG A;  4F6R B;  2OZB A;  3C8L A;  5EAZ A;  2KGW A;  3B6N A;  3SIV A;  5BMV B;  5LXT A;  2OTJ F;  1CN7 A;  3RYF B;  3E22 A;  1VQN F;  3S03 A;  1QU9 A;  2VAW A;  3LWQ C;  1W59 A;  3RYI A;  4ZHQ B;  2GVI A;  4WBN A;  3IEW A;  1VQ6 F;  3S0H A;  3T80 A;  2IG8 A;  5MN4 A;  4O2B A;  3JAM M;  5LYJ B;  2VAM A;  3KHN A;  2Z1F A;  1GO0 A;  3BYQ A;  4LNU A;  1QVF F;  2P6Y A;  3U0O A;  4BVQ A;  3K12 A;  3OON A;  5AVM A;  3QTY A;  3JAR A;  3F0E A;  3EOR A;  1OAP A;  1TVK B;  2HS4 A;  2OTM A;  3I7T A;  3F0D A;  1FFX B;  1JFF B;  3VMF B;  4I4T B;  1JD1 A;  3RYH B;  1YIT F;  1W55 A;  1W58 1;  2HVY D;  2MQE A;  2NMU A;  3HKD A;  4G88 A;  4G4W A;  2K1S A;  3I3F A;  2H8C A;  3CG6 A;  5IJ0 B;  2W8B C;  3VOB A;  1PXW A;  3CCS F;  4ZOL B;  4HNA A;  3I55 F;  3HKB B;  3RYH A;  1UFY A;  4KWE A;  1W42 A;  4HNA B;  4BT7 A;  3WGJ A;  2HQS C;  3K14 A;  4ZOL A;  1H48 A;  3V7Q A;  4O4H B;  2HX0 A;  5HY0 A;  4O4J A;  5CA0 A;  5ITZ B;  5EIB D;  5KX5 B;  4ZI7 B;  5LP6 A;  3RYC A;  4X20 B;  5HY1 A;  4EI7 A;  4TUY B;  3HKE B;  5GON B;  3RA5 A;  3ZP4 A;  2CSL A;  2UYP A;  4U3J B;  1VQ7 F;  3JVH A;  2CW4 A;  2HRY A;  3C9T A;  3G71 F;  1IV3 A;  4RQO A;  1VQP F;  3JAS A;  5JCO C;  3HKE A;  3FPI A;  4NQ3 A;  4TV9 A;  3JAL B;  4X20 A;  5JCO A;  5IT9 M;  5GIO C;  3CD6 F;  4B46 A;  1YIJ F;  1T0A A;  3HKC B;  1KQS F;  2HS3 A;  1X25 A;  3OW2 F;  3VYU C;  4EB6 A;  1VQ4 F;  2ZAU A;  3E22 B;  4WBN B;  3WGL A;  3FD6 A;  3KJJ A;  2VXY A;  5IJ9 B;  4FFB A;  3WXM B;  3RYF A;  3RA6 A;  3JAR B;  2YYE A;  3LWV C;  4B45 A;  2HP0 B;  5IYZ B;  1GZ0 A;  3D01 A;  5HP8 A;  3WJR A;  5JQG B;  3UT5 A;  1KNK A;  5HP7 A;  4EI9 A;  1JFF A;  1H7M A;  2L26 A;  2AIF A;  3MCQ A;  2FGY A;  2H8E A;  4X1I A;  5HXU A;  5FNV B;  3WPW A;  3JAK B;  2CWJ A;  4X1Y B;  3C9U A;  3TD5 A;  3JAT B;  2G9I A;  2VGM A;  3P4E A;  3V4D A;  4ZHY B;  1NQ3 A;  5FNV A;  4C8G A;  1OFU A;  3FD5 A;  3K2X A;  3V3T A;  5JH7 A;  2PMP A;  1FSZ A;  5BMV A;  2AIZ P;  4O2B B;  3K0T A;  1X52 A;  3VYT C;  2RHO A;  4X3M A;  5JVD B;  3N4Z A;  2DT4 A;  3VIU A;  3ZO8 A;  4O4I A;  5HY2 A;  4I55 A;  3CPW F;  2KTV A;  5EIB C;  4ERH A;  4EI8 A;  1W5E A;  1FNK A;  4C8I A;  3SIU A;  5J2T A;  3CMA F;  1E7K A;  3C9R A;  1VQM F;  3WPX A;  1VQL F;  5G4U C;  5B8F A;  4TV8 B;  1YQN A;  3S06 A;  3ESJ A;  1JJ2 F;  3OBW A;  1W57 A;  1DT9 A;  1IPA A;  3E20 B;  3V7E A;  5J2U A;  4I50 B;  3CCL F;  5LP6 B;  4YJ3 B;  3O85 A;  5GAN K;  4E6E A;  4ZK7 A;  2OTL F;  2HRU A;  4M8I A;  4BT4 A;  2CHS A;  3MDO A;  5LYJ A;  3WGK A;  3DDN A;  1SA0 A;  3N2G A;  2BTO A;  4I55 B;  5IJ9 A;  5ITZ A;  5DCV A;  5MN5 A;  3CC4 F;  2ALE A;  4G4X A;  4O4L B;  3I56 F;  3NVK E;  1XRG A;  3JAW B;  4YJ2 B;  1QD9 A;  4BT2 A;  4FFB B;  3FFM A;  3NVI B;  1VK3 A;  4BY9 D;  2JNB A;  4O4H A;  3NMU C;  1VQV A;  5HWE A;  1ZWZ A;  2HP0 A;  3QHD A;  1IV2 A;  1KC8 H;  1RQ7 A;  1VQ5 F;  1VHA A;  3S0W A;  1J7H A;  4B62 A;  2Z01 A;  2Z1U A;  1IV4 A;  3TD4 A;  5CA1 B;  1Z5W A;  2KTU A;  5CB4 A;  1NMU B;  4O2A B;  1Q8R A;  3DC2 A;  3JAL A;  1X7O A;  5EYP A;  1PF5 A;  2QA4 F;  3WGN A;  2ZF8 A;  4X1I B;  2ZVY A;  1W5B A;  4U39 A;  3CCU F;  3IKE A;  4DRX B;  3CC2 F;  3E1Y A;  5FLX M;  4TV9 B;  1VQ8 F;  5EB0 A;  4PWT A;  3ZOP A;  5HXZ A;  3UT5 B;  4LNU B;  3P10 A;  4B5C A;  3CCM F;  3R0P A;  4IHJ B;  3HKC A;  1H47 A;  5LA6 B;  1RQ2 A;  3IEQ A;  3J80 M;  2H6L A;  2N48 A;  2YXZ A;  1RLU A;  1QVG F;  2LBX A;  1W5A A;  2RHL A;  3LYB A;  3F0G A;  3NK7 A;  3VO8 A;  5MN6 A;  2RHH A;  3JAT A;  3S02 A;  3WJQ A;  1TVK A;  5EB1 B;  3N4Y A;  3IR9 A;  2Z1T A;  1COM A;  5LA6 A;  4C8E A;  4BVT A;  5GON A;  1XV2 A;  2B33 A;  5G4V C;  4BT6 A;  5CB4 B;  1YHQ F;  1Q81 H;  1YJ9 F;  2R75 1;  3VCZ A;  2LBT A;  1W2B F;  5EO3 A;  4ZI7 A;  1VQK F;  2LCA A;  2GLZ A;  3ON1 A;  2F9Z C;  4O4I B;  2UYJ A;  3MCA B;  3NK6 A;  4NWO B;  3CXC F;  3CCQ F;  4LCK A;  1Z5V A;  3HKD B;  3J7A R;  3CC7 F;  5HY4 A;  1IV1 A;  2CVL A;  1Q82 H;  3G4S F;  1YJW F;  2WAL A;  1FFX A;  4C4W C;  4TZZ A;  1N8R H;  4I4T A;  3M4S A; 
#chains in the Genus database with same CATH homology
 3DDN A;  2IAF A;  2IQQ A;  4RQO A;  1YGY A;  3DC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...