3PAFA

M. jannaschii l7ae mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
MAVYVKFKVPEEIQKELLDAVAKAQQIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGVSRPASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title Structure and stability of M.jannaschii L7Ae El9 KtoQ mutant
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
total genus 38
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3pafA00
1N8RH 3RA5A 3G71F 3OW2F 1KC8H 5FJ4C 1X7PA 5GIOC 3WXMB 1NJIH 1VQ5F 1K73H 2KG4A 4TZZA 3RA6A 1VQ7F 1IPAA 3HAXD 3LWQC 4BY9D 3LWOC 3CCMF 3CCVF 2CZWA 3J80M 4C4WC 5EO3A 5GANK 3J81M 3CD6F 3N4YA 1YHQF 1RA4A 1VQNF 1W3EX 3NK6A 3G6EF 1VQMF 1YI2F 3HJWC 3CPWF 2LBWA 5G4UC 3SIVA 3CC7F 1Q82H 1CN7A 5GINC 1VQPF 1PXWA 3CPQA 1X52A 3OBYA 2AIFA 4LCKA 3CC2F 3CCEF 1ZWZA 3CCLF 1KD1H 3E20B 2JNBA 4X3LA 3JAMM 1W40A 1JJ2F 1H7MA 1YJ9F 3G4SF 1SDSA 3PLAC 4NUTA 3CCQF 2OTJF 1X7OA 3CCSF 1CK2A 1VQ8F 3I56F 3NVKE 2HVYD 1VQKF 2KTUA 1YJNF 1YIJF 2VGMA 2FC3A 5DCVA 1GO1A 2BO1A 1VQ9F 1Q7YH 2I6DA 3N4ZA 1Q86H 3VMFB 1VQLF 3CC4F 3NVIB 5EWRA 1YITF 1VQ4F 3CMAF 1XBIA 2LBXA 3CG6A 5IT9M 1QVGF 3LFOA 2ALEA 1S72F 1VQ6F 2OZBA 2VGNA 1QVFF 5A2QM 3V7QA 3VI6A 2OTLF 3NMUC 1K8AH 1K9MH 1T0KB 1M90H 3SIUA 1W42A 2OHWA 3CCRF 3LWRC 1VQOF 1E7KA 3FFMA 3LWVC 3CXCF 1M1KH 4X3MA 3PAFA 3AGKA 5GIPC 1W41A 3NK7A 1KQSF 1DT9A 2KTVA 5GAPK 3IR9A 3LWPC 1W2BF 3GYQA 1YJWF 3E1YA 1RLGA 3OBWA 5FLXM 2QEXF 5G4VC 3J7AR 3JCMM 3V7EA 4BW0B 3CMEF 3I55F 1GO0A 3O85A 2QA4F 3CCJF 3ON1A 3CCUF 1NMUB 2QI2A 2WALA 1GZ0A 1Q81H 3MCAB
chains in the Genus database with same CATH superfamily
5J2UB 4BT7A 4BT5A 3Q8HA 1N8RH 3VYSC 1CLIA 1W59A 5FJ4C 3HKDA 4O2AB 5HXZA 4TZZA 1VH8A 3S0YA 3E22A 4C82A 3HKCB 3LWQC 2G9IA 5MN5A 5JH7B 3LWOC 3S03A 3J80M 3OONA 3S0WA 4IHJB 2BTQB 1H48A 2DYYA 4O2AA 3HKCA 5HP8A 3NK6A 4B62A 1XHOA 1GX1A 2CSLA 1YI2F 2ZOVA 2LBWA 3R0PA 2CW4A 4FFBB 2CWJA 3CYQA 2HS4A 1PXWA 4ZHQA 1FNJA 2OTMA 2AIFA 2MQEA 1Z5VA 2HP0B 4LCKA 2I6RA 3CCEF 4IIJB 3CCLF 3RYHA 4E6EA 1W5EA 1VQVA 2JNBA 4X3LA 1VHAA 4X20A 1H7MA 1SDSA 5EYPB 4ZOLA 3LDTA 3PLAC 1PF5A 4BT3A 1SZQA 4YJ3A 1X7OA 3CCSF 4BVRA 5HP7A 5IYZA 1FNKA 5JVDA 4WBNA 2RHHA 2HVYD 1VQKF 1J7HA 1YJNF 4LNUB 4I55A 3S0HA 5EYPA 3WJPA 4EI7A 5FNVA 2FC3A 5DCVA 5C8YB 3S06A 4HNAA 1KNJA 4M8IA 1VQLF 5CA1A 3L7QA 5EIBC 1VQ4F 3HKBB 1IV3A 3CMAF 2LBXA 3LFOA 1S72F 1VQ6F 4BT2A 3V7QA 3NMUC 3KIZA 4NWOB 4RHAA 3HKBA 3JARA 3SIUA 1RQ2A 2UYPA 2GLZA 1VQOF 2RHOA 5JCOC 2ZVZA 4O2BA 5EB1B 3ESJA 3UT5B 1OFUA 4X3MA 1KQSF 3ZP7A 1DT9A 4X1IA 1IV1A 4PWTA 3C9SA 3IR9A 1W2BF 2BTOA 5LP6A 1UI9A 4YJ2A 2IG8A 5LOVA 5G4VC 3V7EA 3CMEF 3I55F 3VIUA 1U3LA 3KJKA 5LA6B 4G4ZA 1GO0A 3F6MA 3EORA 1NMUB 3VCZA 5EZYB 2QI2A 4G4VA 2WALA 3WJRA 3G71F 3OW2F 2NMUA 5LA6A 5GIOC 3JAWB 1YGYA 5EZYA 2YXZA 3CB2A 3CCMF 5EIBD 1W57A 3TD3A 2ZF8A 2PMPA 3C9UA 3GHZA 3J81M 5GANK 3CD6F 3D54A 4B5CA 1TUBA 3N4YA 2PHNA 2YYEA 3F0FA 5EB0A 1RA4A 4DRXB 4XCQA 3FD6A 1VQMF 4ZI7B 3IKFA 3WJQA 1SA0A 5GINC 1UFYA 4DRXA 3CPQA 5ITZB 2FGYA 3M1XA 4X1KB 1ZWZA 5J2UA 2Z1UA 4ZHYB 3E20B 4DXDA 1Q8RA 1W40A 5CA0B 1TVKB 1YJ9F 1W55A 3VOAA 4C8EA 3FBAA 3CCQF 5JH7A 2OTJF 1CK2A 5HY2A 4BT4A 2HRYA 3P10A 4I50B 1Z5WA 4IHJA 3NVKE 2EWCA 3IMPA 2VXYA 4RQOA 1TVKA 4ZHVA 2GVIA 2UYJA 1GO1A 1Q7YH 1Q86H 4X1YB 3CC4F 2UYNB 1XBIA 3CG6A 1QVGF 4C8IA 3N2GB 3ZO8A 5BMVB 3FD5A 1KNKA 4FFBA 1COMA 4O4IB 1QVFF 2Z1EA 5A2QM 3WPXA 2OTLF 1JY8A 4G4XA 1RQ7A 4B46A 4U39A 2HP0A 2UYNA 1M90H 1U43A 3N2GA 4IIJA 3CCRF 2BTUA 3LWVC 2N48A 5IJ9B 1M1KH 4O4IA 1JD1A 5KMGB 3NK7A 4G88A 2W8BC 3V3TA 2CHTA 3CYPB 5IJ9A 1YJWF 3E1YA 4O4HB 5KMGA 3J7AR 1RLUA 4LNUA 3TD5A 5IJ0B 3DDNA 2IQQA 3DC2A 5C8YA 2QA4F 1W5AA 3M84A 1GZ0A 1ONIA 4O4LB 2HS0A 3WXMB 5CB4B 1VQ5F 2KG4A 5JQGB 1FFXB 3HAXD 2R6R1 1U3PA 5AVMA 1XRGA 5EO3A 4B45A 5CB4A 3UT5A 3WGNA 1R1MA 5LYJB 2KGWA 5LP6C 3WGMA 2K1SA 3FPIA 5JCOA 1W3EX 3KJJA 3RYFB 3HJWC 2V9YA 2AMTA 1W5FA 4G4WA 3CPWF 5LYJA 5G4UC 3CC7F 4ZK7A 1CN7A 3I7TA 3TD4A 2DT4A 3WGKA 4U3JB 3CC2F 3ERNA 3C9TA 2B33A 1JJ2F 2HP3A 3JAWA 3HWUA 4TV8B 3U0OA 1U40A 3B6NA 4I4TB 1VQ8F 3LYBA 4G4YA 1FSZA 5HWEA 1YIJF 2VGMA 1YQNA 3V4DA 2Z01A 2RHLA 2BO1A 1VQ9F 2I6DA 4TV9B 3VMFB 5EWRA 1YITF 1OAPA 3JASB 3K0TA 4ZI7A 1IV2A 4C81A 2OZBA 5HY0A 3T80A 5HXUA 3VI6A 3HKDB 5ITZA 4KWEA 3VTIC 3E22B 3K14A 2VAMA 5MN6A 4X1KA 3LWRC 2QTPA 3CXCF 2GZLA 3D00A 1W581 3VYUC 2VAPA 5CA0A 5HY4A 3JVHA 3PAFA 5GIPC 1W41A 2R751 1QAHA 2KTVA 3D01A 2H6LA 3QTYA 3GYQA 4I50A 3MCQA 1X25A 3OBWA 4EI9A 1RLGA 2QEXF 3F0EA 4BW0B 3N2KB 4ZHWA 4R40B 3ON1A 4ZHQB 2HQSC 4X1YA 3QUWA 3WGLA 1T0KB 3N2KA 3RYHB 5BMVA 3RA5A 4BVTA 1KC8H 3WPWA 1X7PA 5HY1A 3C8LA 1NJIH 3IEQA 4X20B 1K73H 3RA6A 1VQ7F 2IAFA 1IPAA 4ZOLB 4F6RB 4BY9D 3CCVF 2CZWA 1W5BA 3P0ZA 4YJ3B 1JFFB 2ZODA 5LXTB 4C4WC 1H47A 2P6YA 5IYZB 3K2XA 5JVDB 4WBNB 3GTZA 5EAZA 1YHQF 4EB6B 4I55B 5FNVB 4F6RA 3KE1A 4HNAB 1VQNF 5CA1B 3G6EF 1JFFA 3VYTC 5LXTA 4O4HA 4EB6A 5IJ0A 3SIVA 1Q82H 5B8FA 1VQPF 3M4SA 5J2TB 4BVSA 1X52A 3OBYA 4C8GA 2F9ZC 2HX0A 3JARB 2ZAUA 1XV2A 4O4LA 3MDOA 1KD1H 4O2BB 3JAMM 2LBTA 5J2TA 1QU9A 5JQGA 1FFXA 1ODEA 1T0AA 3G4SF 3RYIB 2UZHA 3HTNA 4NUTA 3ZP4A 3JALB 4X1IB 3LMEA 2ZVYA 2H8EA 3K12A 3MBMA 5LP6B 3I56F 3QHDA 3JATB 3ELCA 2KTUA 4YJ2B 2Z1FA 3IEWA 5LOVB 3KHNA 2AIZP 3RYIA 3ZOPA 3JALA 3C9RA 3N4ZA 3RYFA 3NVIB 2LCAA 3RYCB 3VO8A 4ERHA 5IT9M 4TUYB 2Z1TA 3JATA 2ALEA 5MN4A 3VOBA 2L26A 2VGNA 5GONB 2Q1YA 1K8AH 3S02A 1DBFA 2H8CA 2UYKA 3IKEA 3RYCA 1K9MH 4U3JA 5KX5B 4TUYA 1W42A 2OHWA 1NQ3A 4O4JB 3WGJA 1E7KA 3FFMA 5GONA 2Q1XA 2CHSA 3JAKB 1TUBB 3MQWA 3I3FA 3P4EA 3AGKA 4TV8A 3HKEB 5KX5A 3F0GA 5GAPK 3F0DA 4O4JA 4I4TA 4NQ3A 3LWPC 1VK3A 1JN1A 4BT6A 3JAKA 3RE3A 5FLXM 2RB9A 3JCMM 2HRUA 1QD9A 1IV4A 2VAWA 4EI8A 1SA0B 3HKEA 3O85A 2HS3A 3CCJF 2RHJA 3CCUF 4TV9A 2CVLA 4BVQA 3BYQA 3JASA 1Q81H 3MCAB
chains in the Genus database with same CATH topology
1N8RH 3RA5A 3G71F 4BVTA 3OW2F 1KC8H 5FJ4C 1X7PA 5GIOC 3WXMB 5HY1A 1NJIH 1VQ5F 5HXZA 1K73H 2KG4A 4TZZA 3RA6A 1VQ7F 1IPAA 3HAXD 3LWQC 4BY9D 3LWOC 3CCMF 3CCVF 2CZWA 3J80M 4C4WC 5EO3A 5GANK 3J81M 3CD6F 3N4YA 1YHQF 1RA4A 4XCQA 1VQNF 1W3EX 3NK6A 3G6EF 1VQMF 1YI2F 3HJWC 3CPWF 2LBWA 5G4UC 3SIVA 3CC7F 1Q82H 1CN7A 5GINC 1VQPF 1PXWA 3CPQA 4BVSA 1X52A 3OBYA 2FGYA 2F9ZC 2AIFA 4LCKA 3CC2F 3CCEF 1ZWZA 3CCLF 1KD1H 3E20B 2JNBA 4X3LA 3JAMM 1W40A 1JJ2F 1H7MA 1YJ9F 3G4SF 1SDSA 3PLAC 4NUTA 3CCQF 2OTJF 1X7OA 3CCSF 4BVRA 1CK2A 5HY2A 1VQ8F 3I56F 3NVKE 2HVYD 1VQKF 2KTUA 5HWEA 1YJNF 1YIJF 4EI7A 2VGMA 2FC3A 5DCVA 1GO1A 2BO1A 1VQ9F 1Q7YH 2I6DA 3N4ZA 1Q86H 3VMFB 1VQLF 3CC4F 3NVIB 5EWRA 1YITF 1VQ4F 3CMAF 1XBIA 2LBXA 3CG6A 5IT9M 1QVGF 3LFOA 2ALEA 1S72F 1VQ6F 2OZBA 2VGNA 5HY0A 5HXUA 1QVFF 5A2QM 3V7QA 3VI6A 2OTLF 3NMUC 1K8AH 1K9MH 1T0KB 1M90H 3SIUA 1W42A 2OHWA 2GLZA 3LWRC 3CCRF 1VQOF 1E7KA 3FFMA 3LWVC 3CXCF 3D00A 1M1KH 5HY4A 4X3MA 3PAFA 3AGKA 3NK7A 1W41A 5GIPC 1KQSF 1DT9A 2KTVA 3V3TA 5GAPK 3IR9A 4NQ3A 3LWPC 1W2BF 3GYQA 1YJWF 3E1YA 1RLGA 3OBWA 4EI9A 5FLXM 2QEXF 5G4VC 3J7AR 3JCMM 3V7EA 4BW0B 3CMEF 4EI8A 3I55F 1GO0A 3O85A 2QA4F 3CCJF 3ON1A 3CCUF 1NMUB 4BVQA 2QI2A 2WALA 1GZ0A 1Q81H 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R H;  3RA5 A;  3G71 F;  3OW2 F;  1KC8 H;  5FJ4 C;  1X7P A;  5GIO C;  3WXM B;  1NJI H;  1VQ5 F;  1K73 H;  2KG4 A;  4TZZ A;  3RA6 A;  1VQ7 F;  1IPA A;  3HAX D;  3LWQ C;  4BY9 D;  3LWO C;  3CCM F;  3CCV F;  2CZW A;  3J80 M;  4C4W C;  5EO3 A;  5GAN K;  3J81 M;  3CD6 F;  3N4Y A;  1YHQ F;  1RA4 A;  1VQN F;  1W3E X;  3NK6 A;  3G6E F;  1VQM F;  1YI2 F;  3HJW C;  3CPW F;  2LBW A;  5G4U C;  3SIV A;  3CC7 F;  1Q82 H;  1CN7 A;  5GIN C;  1VQP F;  1PXW A;  3CPQ A;  1X52 A;  3OBY A;  2AIF A;  4LCK A;  3CC2 F;  3CCE F;  1ZWZ A;  3CCL F;  1KD1 H;  3E20 B;  2JNB A;  4X3L A;  3JAM M;  1W40 A;  1JJ2 F;  1H7M A;  1YJ9 F;  3G4S F;  1SDS A;  3PLA C;  4NUT A;  3CCQ F;  2OTJ F;  1X7O A;  3CCS F;  1CK2 A;  1VQ8 F;  3I56 F;  3NVK E;  2HVY D;  1VQK F;  2KTU A;  1YJN F;  1YIJ F;  2VGM A;  2FC3 A;  5DCV A;  1GO1 A;  2BO1 A;  1VQ9 F;  1Q7Y H;  2I6D A;  3N4Z A;  1Q86 H;  3VMF B;  1VQL F;  3CC4 F;  3NVI B;  5EWR A;  1YIT F;  1VQ4 F;  3CMA F;  1XBI A;  2LBX A;  3CG6 A;  5IT9 M;  1QVG F;  3LFO A;  2ALE A;  1S72 F;  1VQ6 F;  2OZB A;  2VGN A;  1QVF F;  5A2Q M;  3V7Q A;  3VI6 A;  2OTL F;  3NMU C;  1K8A H;  1K9M H;  1T0K B;  1M90 H;  3SIU A;  1W42 A;  2OHW A;  3CCR F;  3LWR C;  1VQO F;  1E7K A;  3FFM A;  3LWV C;  3CXC F;  1M1K H;  4X3M A;  3PAF A;  3AGK A;  5GIP C;  1W41 A;  3NK7 A;  1KQS F;  1DT9 A;  2KTV A;  5GAP K;  3IR9 A;  3LWP C;  1W2B F;  3GYQ A;  1YJW F;  3E1Y A;  1RLG A;  3OBW A;  5FLX M;  2QEX F;  5G4V C;  3J7A R;  3JCM M;  3V7E A;  4BW0 B;  3CME F;  3I55 F;  1GO0 A;  3O85 A;  2QA4 F;  3CCJ F;  3ON1 A;  3CCU F;  1NMU B;  2QI2 A;  2WAL A;  1GZ0 A;  1Q81 H;  3MCA B; 
#chains in the Genus database with same CATH topology
 5J2U B;  4BT7 A;  4BT5 A;  3Q8H A;  1N8R H;  3VYS C;  1CLI A;  1W59 A;  5FJ4 C;  3HKD A;  4O2A B;  5HXZ A;  4TZZ A;  1VH8 A;  3S0Y A;  3E22 A;  4C82 A;  3HKC B;  3LWQ C;  2G9I A;  5MN5 A;  5JH7 B;  3LWO C;  3S03 A;  3J80 M;  3OON A;  3S0W A;  4IHJ B;  2BTQ B;  1H48 A;  2DYY A;  4O2A A;  3HKC A;  5HP8 A;  3NK6 A;  4B62 A;  1XHO A;  1GX1 A;  2CSL A;  1YI2 F;  2ZOV A;  2LBW A;  3R0P A;  2CW4 A;  4FFB B;  2CWJ A;  3CYQ A;  2HS4 A;  1PXW A;  4ZHQ A;  1FNJ A;  2OTM A;  2AIF A;  2MQE A;  1Z5V A;  2HP0 B;  4LCK A;  2I6R A;  3CCE F;  4IIJ B;  3CCL F;  3RYH A;  4E6E A;  1W5E A;  1VQV A;  2JNB A;  4X3L A;  1VHA A;  4X20 A;  1H7M A;  1SDS A;  5EYP B;  4ZOL A;  3LDT A;  3PLA C;  1PF5 A;  4BT3 A;  1SZQ A;  4YJ3 A;  1X7O A;  3CCS F;  4BVR A;  5HP7 A;  5IYZ A;  1FNK A;  5JVD A;  4WBN A;  2RHH A;  2HVY D;  1VQK F;  1J7H A;  1YJN F;  4LNU B;  4I55 A;  3S0H A;  5EYP A;  3WJP A;  4EI7 A;  5FNV A;  2FC3 A;  5DCV A;  5C8Y B;  3S06 A;  4HNA A;  1KNJ A;  4M8I A;  1VQL F;  5CA1 A;  3L7Q A;  5EIB C;  1VQ4 F;  3HKB B;  1IV3 A;  3CMA F;  2LBX A;  3LFO A;  1S72 F;  1VQ6 F;  4BT2 A;  3V7Q A;  3NMU C;  3KIZ A;  4NWO B;  4RHA A;  3HKB A;  3JAR A;  3SIU A;  1RQ2 A;  2UYP A;  2GLZ A;  1VQO F;  2RHO A;  5JCO C;  2ZVZ A;  4O2B A;  5EB1 B;  3ESJ A;  3UT5 B;  1OFU A;  4X3M A;  1KQS F;  3ZP7 A;  1DT9 A;  4X1I A;  1IV1 A;  4PWT A;  3C9S A;  3IR9 A;  1W2B F;  2BTO A;  5LP6 A;  1UI9 A;  4YJ2 A;  2IG8 A;  5LOV A;  5G4V C;  3V7E A;  3CME F;  3I55 F;  3VIU A;  1U3L A;  3KJK A;  5LA6 B;  4G4Z A;  1GO0 A;  3F6M A;  3EOR A;  1NMU B;  3VCZ A;  5EZY B;  2QI2 A;  4G4V A;  2WAL A;  3WJR A;  3G71 F;  3OW2 F;  2NMU A;  5LA6 A;  5GIO C;  3JAW B;  1YGY A;  5EZY A;  2YXZ A;  3CB2 A;  3CCM F;  5EIB D;  1W57 A;  3TD3 A;  2ZF8 A;  2PMP A;  3C9U A;  3GHZ A;  3J81 M;  5GAN K;  3CD6 F;  3D54 A;  4B5C A;  1TUB A;  3N4Y A;  2PHN A;  2YYE A;  3F0F A;  5EB0 A;  1RA4 A;  4DRX B;  4XCQ A;  3FD6 A;  1VQM F;  4ZI7 B;  3IKF A;  3WJQ A;  1SA0 A;  5GIN C;  1UFY A;  4DRX A;  3CPQ A;  5ITZ B;  2FGY A;  3M1X A;  4X1K B;  1ZWZ A;  5J2U A;  2Z1U A;  4ZHY B;  3E20 B;  4DXD A;  1Q8R A;  1W40 A;  5CA0 B;  1TVK B;  1YJ9 F;  1W55 A;  3VOA A;  4C8E A;  3FBA A;  3CCQ F;  5JH7 A;  2OTJ F;  1CK2 A;  5HY2 A;  4BT4 A;  2HRY A;  3P10 A;  4I50 B;  1Z5W A;  4IHJ A;  3NVK E;  2EWC A;  3IMP A;  2VXY A;  4RQO A;  1TVK A;  4ZHV A;  2GVI A;  2UYJ A;  1GO1 A;  1Q7Y H;  1Q86 H;  4X1Y B;  3CC4 F;  2UYN B;  1XBI A;  3CG6 A;  1QVG F;  4C8I A;  3N2G B;  3ZO8 A;  5BMV B;  3FD5 A;  1KNK A;  4FFB A;  1COM A;  4O4I B;  1QVF F;  2Z1E A;  5A2Q M;  3WPX A;  2OTL F;  1JY8 A;  4G4X A;  1RQ7 A;  4B46 A;  4U39 A;  2HP0 A;  2UYN A;  1M90 H;  1U43 A;  3N2G A;  4IIJ A;  3CCR F;  2BTU A;  3LWV C;  2N48 A;  5IJ9 B;  1M1K H;  4O4I A;  1JD1 A;  5KMG B;  3NK7 A;  4G88 A;  2W8B C;  3V3T A;  2CHT A;  3CYP B;  5IJ9 A;  1YJW F;  3E1Y A;  4O4H B;  5KMG A;  3J7A R;  1RLU A;  4LNU A;  3TD5 A;  5IJ0 B;  3DDN A;  2IQQ A;  3DC2 A;  5C8Y A;  2QA4 F;  1W5A A;  3M84 A;  1GZ0 A;  1ONI A;  4O4L B;  2HS0 A;  3WXM B;  5CB4 B;  1VQ5 F;  2KG4 A;  5JQG B;  1FFX B;  3HAX D;  2R6R 1;  1U3P A;  5AVM A;  1XRG A;  5EO3 A;  4B45 A;  5CB4 A;  3UT5 A;  3WGN A;  1R1M A;  5LYJ B;  2KGW A;  5LP6 C;  3WGM A;  2K1S A;  3FPI A;  5JCO A;  1W3E X;  3KJJ A;  3RYF B;  3HJW C;  2V9Y A;  2AMT A;  1W5F A;  4G4W A;  3CPW F;  5LYJ A;  5G4U C;  3CC7 F;  4ZK7 A;  1CN7 A;  3I7T A;  3TD4 A;  2DT4 A;  3WGK A;  4U3J B;  3CC2 F;  3ERN A;  3C9T A;  2B33 A;  1JJ2 F;  2HP3 A;  3JAW A;  3HWU A;  4TV8 B;  3U0O A;  1U40 A;  3B6N A;  4I4T B;  1VQ8 F;  3LYB A;  4G4Y A;  1FSZ A;  5HWE A;  1YIJ F;  2VGM A;  1YQN A;  3V4D A;  2Z01 A;  2RHL A;  2BO1 A;  1VQ9 F;  2I6D A;  4TV9 B;  3VMF B;  5EWR A;  1YIT F;  1OAP A;  3JAS B;  3K0T A;  4ZI7 A;  1IV2 A;  4C81 A;  2OZB A;  5HY0 A;  3T80 A;  5HXU A;  3VI6 A;  3HKD B;  5ITZ A;  4KWE A;  3VTI C;  3E22 B;  3K14 A;  2VAM A;  5MN6 A;  4X1K A;  3LWR C;  2QTP A;  3CXC F;  2GZL A;  3D00 A;  1W58 1;  3VYU C;  2VAP A;  5CA0 A;  5HY4 A;  3JVH A;  3PAF A;  5GIP C;  1W41 A;  2R75 1;  1QAH A;  2KTV A;  3D01 A;  2H6L A;  3QTY A;  3GYQ A;  4I50 A;  3MCQ A;  1X25 A;  3OBW A;  4EI9 A;  1RLG A;  2QEX F;  3F0E A;  4BW0 B;  3N2K B;  4ZHW A;  4R40 B;  3ON1 A;  4ZHQ B;  2HQS C;  4X1Y A;  3QUW A;  3WGL A;  1T0K B;  3N2K A;  3RYH B;  5BMV A;  3RA5 A;  4BVT A;  1KC8 H;  3WPW A;  1X7P A;  5HY1 A;  3C8L A;  1NJI H;  3IEQ A;  4X20 B;  1K73 H;  3RA6 A;  1VQ7 F;  2IAF A;  1IPA A;  4ZOL B;  4F6R B;  4BY9 D;  3CCV F;  2CZW A;  1W5B A;  3P0Z A;  4YJ3 B;  1JFF B;  2ZOD A;  5LXT B;  4C4W C;  1H47 A;  2P6Y A;  5IYZ B;  3K2X A;  5JVD B;  4WBN B;  3GTZ A;  5EAZ A;  1YHQ F;  4EB6 B;  4I55 B;  5FNV B;  4F6R A;  3KE1 A;  4HNA B;  1VQN F;  5CA1 B;  3G6E F;  1JFF A;  3VYT C;  5LXT A;  4O4H A;  4EB6 A;  5IJ0 A;  3SIV A;  1Q82 H;  5B8F A;  1VQP F;  3M4S A;  5J2T B;  4BVS A;  1X52 A;  3OBY A;  4C8G A;  2F9Z C;  2HX0 A;  3JAR B;  2ZAU A;  1XV2 A;  4O4L A;  3MDO A;  1KD1 H;  4O2B B;  3JAM M;  2LBT A;  5J2T A;  1QU9 A;  5JQG A;  1FFX A;  1ODE A;  1T0A A;  3G4S F;  3RYI B;  2UZH A;  3HTN A;  4NUT A;  3ZP4 A;  3JAL B;  4X1I B;  3LME A;  2ZVY A;  2H8E A;  3K12 A;  3MBM A;  5LP6 B;  3I56 F;  3QHD A;  3JAT B;  3ELC A;  2KTU A;  4YJ2 B;  2Z1F A;  3IEW A;  5LOV B;  3KHN A;  2AIZ P;  3RYI A;  3ZOP A;  3JAL A;  3C9R A;  3N4Z A;  3RYF A;  3NVI B;  2LCA A;  3RYC B;  3VO8 A;  4ERH A;  5IT9 M;  4TUY B;  2Z1T A;  3JAT A;  2ALE A;  5MN4 A;  3VOB A;  2L26 A;  2VGN A;  5GON B;  2Q1Y A;  1K8A H;  3S02 A;  1DBF A;  2H8C A;  2UYK A;  3IKE A;  3RYC A;  1K9M H;  4U3J A;  5KX5 B;  4TUY A;  1W42 A;  2OHW A;  1NQ3 A;  4O4J B;  3WGJ A;  1E7K A;  3FFM A;  5GON A;  2Q1X A;  2CHS A;  3JAK B;  1TUB B;  3MQW A;  3I3F A;  3P4E A;  3AGK A;  4TV8 A;  3HKE B;  5KX5 A;  3F0G A;  5GAP K;  3F0D A;  4O4J A;  4I4T A;  4NQ3 A;  3LWP C;  1VK3 A;  1JN1 A;  4BT6 A;  3JAK A;  3RE3 A;  5FLX M;  2RB9 A;  3JCM M;  2HRU A;  1QD9 A;  1IV4 A;  2VAW A;  4EI8 A;  1SA0 B;  3HKE A;  3O85 A;  2HS3 A;  3CCJ F;  2RHJ A;  3CCU F;  4TV9 A;  2CVL A;  4BVQ A;  3BYQ A;  3JAS A;  1Q81 H;  3MCA B; 
#chains in the Genus database with same CATH homology
 1N8R H;  3RA5 A;  3G71 F;  4BVT A;  3OW2 F;  1KC8 H;  5FJ4 C;  1X7P A;  5GIO C;  3WXM B;  5HY1 A;  1NJI H;  1VQ5 F;  5HXZ A;  1K73 H;  2KG4 A;  4TZZ A;  3RA6 A;  1VQ7 F;  1IPA A;  3HAX D;  3LWQ C;  4BY9 D;  3LWO C;  3CCM F;  3CCV F;  2CZW A;  3J80 M;  4C4W C;  5EO3 A;  5GAN K;  3J81 M;  3CD6 F;  3N4Y A;  1YHQ F;  1RA4 A;  4XCQ A;  1VQN F;  1W3E X;  3NK6 A;  3G6E F;  1VQM F;  1YI2 F;  3HJW C;  3CPW F;  2LBW A;  5G4U C;  3SIV A;  3CC7 F;  1Q82 H;  1CN7 A;  5GIN C;  1VQP F;  1PXW A;  3CPQ A;  4BVS A;  1X52 A;  3OBY A;  2FGY A;  2F9Z C;  2AIF A;  4LCK A;  3CC2 F;  3CCE F;  1ZWZ A;  3CCL F;  1KD1 H;  3E20 B;  2JNB A;  4X3L A;  3JAM M;  1W40 A;  1JJ2 F;  1H7M A;  1YJ9 F;  3G4S F;  1SDS A;  3PLA C;  4NUT A;  3CCQ F;  2OTJ F;  1X7O A;  3CCS F;  4BVR A;  1CK2 A;  5HY2 A;  1VQ8 F;  3I56 F;  3NVK E;  2HVY D;  1VQK F;  2KTU A;  5HWE A;  1YJN F;  1YIJ F;  4EI7 A;  2VGM A;  2FC3 A;  5DCV A;  1GO1 A;  2BO1 A;  1VQ9 F;  1Q7Y H;  2I6D A;  3N4Z A;  1Q86 H;  3VMF B;  1VQL F;  3CC4 F;  3NVI B;  5EWR A;  1YIT F;  1VQ4 F;  3CMA F;  1XBI A;  2LBX A;  3CG6 A;  5IT9 M;  1QVG F;  3LFO A;  2ALE A;  1S72 F;  1VQ6 F;  2OZB A;  2VGN A;  5HY0 A;  5HXU A;  1QVF F;  5A2Q M;  3V7Q A;  3VI6 A;  2OTL F;  3NMU C;  1K8A H;  1K9M H;  1T0K B;  1M90 H;  3SIU A;  1W42 A;  2OHW A;  2GLZ A;  3LWR C;  3CCR F;  1VQO F;  1E7K A;  3FFM A;  3LWV C;  3CXC F;  3D00 A;  1M1K H;  5HY4 A;  4X3M A;  3PAF A;  3AGK A;  3NK7 A;  1W41 A;  5GIP C;  1KQS F;  1DT9 A;  2KTV A;  3V3T A;  5GAP K;  3IR9 A;  4NQ3 A;  3LWP C;  1W2B F;  3GYQ A;  1YJW F;  3E1Y A;  1RLG A;  3OBW A;  4EI9 A;  5FLX M;  2QEX F;  5G4V C;  3J7A R;  3JCM M;  3V7E A;  4BW0 B;  3CME F;  4EI8 A;  3I55 F;  1GO0 A;  3O85 A;  2QA4 F;  3CCJ F;  3ON1 A;  3CCU F;  1NMU B;  4BVQ A;  2QI2 A;  2WAL A;  1GZ0 A;  1Q81 H;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...