3PAFA

M. jannaschii l7ae mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
b'MAVYVKFKVPEEIQKELLDAVAKAQQIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGVSRPASSVAIINEGDAEELKVLIEKVNVLKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title Structure and stability of M.jannaschii L7Ae El9 KtoQ mutant
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ribosomal protein
total genus 38
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3pafA00
2I6DA 5G4VC 3OBWA 2WALA 1Q81H 1VQ9F 3CCMF 1NMUB 3RA6A 1YJWF 3LWVC 5FLXM 2JNBA 1JJ2F 3NMUC 4C4WC 3J80M 3CC2F 1QVGF 1CK2A 4BY9D 3CC7F 1VQPF 1T0KB 1YIJF 3LWQC 3I56F 1VQ6F 1X52A 2KTUA 3I55F 1YI2F 5GIOC 5EO3A 1M1KH 2OTLF 1W3EX 4NUTA 3FFMA 3GYQA 5EWRA 3VI6A 4X3MA 2QI2A 1VQ7F 1DT9A 3HAXD 5GIPC 3OW2F 2OHWA 1IPAA 1W41A 1YJNF 3J7AR 2OTJF 3CCSF 3CCQF 1GZ0A 1YJ9F 3CCLF 3NVKE 1N8RH 1K9MH 3NK7A 3V7QA 1X7PA 3PLAC 2QEXF 2FC3A 4TZZA 3ON1A 3CMEF 3LWOC 1VQ5F 1VQ4F 3CD6F 3CCVF 3CCEF 1SDSA 5A2QM 3HJWC 3CXCF 2VGNA 1K73H 5IT9M 1KC8H 1YITF 2BO1A 1KD1H 3G71F 1YHQF 3AGKA 3CG6A 4BW0B 1RLGA 1X7OA 1Q86H 3N4ZA 1GO0A 3CMAF 4X3LA 2KG4A 1K8AH 1ZWZA 3CCUF 2HVYD 1GO1A 5GANK 1W42A 3MCAB 1VQLF 1VQMF 3CCJF 1QVFF 1KQSF 2OZBA 3SIVA 3WXMB 1PXWA 5GINC 1VQOF 3V7EA 5GAPK 1Q7YH 1CN7A 2LBXA 1RA4A 3J81M 3G6EF 3CPQA 2AIFA 2KTVA 1NJIH 5FJ4C 2ALEA 1VQKF 1E7KA 3LFOA 3CPWF 2QA4F 1S72F 3JCMM 3NVIB 1VQNF 3RA5A 3NK6A 3SIUA 5DCVA 3IR9A 3CC4F 1H7MA 1W40A 3E20B 3OBYA 3PAFA 3N4YA 3G4SF 3O85A 3VMFB 3LWRC 4LCKA 2VGMA 1VQ8F 2CZWA 3CCRF 1M90H 1W2BF 1XBIA 5G4UC 3E1YA 3JAMM 1Q82H 2LBWA 3LWPC
chains in the Genus database with same CATH superfamily
3CB2A 2VAPA 4TV8A 3VO8A 2HQSC 3EORA 2IAFA 3HKBA 5MN6A 5J2TA 2UYKA 3LWVC 4BT7A 3CC2F 1QVGF 1CK2A 3M84A 5J2UA 3C9TA 1XRGA 4U39A 1CLIA 2IG8A 5FNVB 3QHDA 1VQ7F 3GYQA 5EWRA 4DRXA 4X3MA 2CVLA 5BMVB 4ZHWA 3OW2F 2UZHA 5IYZB 1IPAA 1KNKA 2LCAA 3CCSF 1GZ0A 4PWTA 1W55A 3CCLF 3ZOPA 3RYFB 1K9MH 5LA6B 3C9UA 4O4HB 5HXUA 3VOBA 5ITZA 5JCOC 1QD9A 3WJRA 3F0DA 3RYCB 4TZZA 4O4JB 4WBNB 4E6EA 4DXDA 5BMVA 3TD3A 5HY4A 5HY1A 3HTNA 1OAPA 1W59A 2RHLA 3HKCA 3FD5A 3LMEA 2G9IA 4LNUB 5HP7A 1W5EA 1COMA 1KC8H 5JH7B 3VYSC 4O4HA 1YGYA 4TV9A 1KD1H 5LXTB 1YHQF 4WBNA 5LP6B 4ZHQB 1H47A 3KIZA 1TUBB 1QAHA 3QTYA 4BT3A 1K8AH 2Z1FA 1JD1A 1ZWZA 5GANK 5MN4A 5KX5A 1W5AA 5JH7A 3FPIA 5LXTA 1KQSF 3I3FA 3S03A 2B33A 1RQ2A 1VQOF 2RHHA 1Q7YH 4I50A 4ZHQA 3K14A 3CPQA 2KTVA 3ELCA 3LFOA 1S72F 3UT5A 3NVIB 4U3JB 3IR9A 4B45A 2VAMA 4G4WA 4I55B 3OBYA 1Z5WA 1TVKA 2Z01A 3N4YA 3O85A 3RYIB 2VGMA 4ZK7A 1X25A 5EYPB 3JATB 3MCQA 3WGJA 3I7TA 4B46A 4G4YA 3LWPC 1VK3A 4U3JA 1JFFB 5G4VC 2ZF8A 3WJPA 2GVIA 5EIBD 4O2BB 3V4DA 1NMUB 3E22A 3QUWA 3HKBB 1VQPF 1T0KB 4BVRA 3I56F 4B5CA 1X52A 2KTUA 2LBTA 3I55F 5GIOC 1FFXA 1M1KH 2OTLF 5CA0A 4RHAA 3KHNA 1VQVA 4EB6B 3MBMA 1QU9A 1W3EX 1KNJA 3KE1A 5EB0A 3D00A 5J2UB 3ZP7A 4ZI7B 2HS4A 2F9ZC 3GHZA 3U0OA 1IV4A 4G88A 1YJNF 1W41A 2CWJA 3WPXA 3CCQF 3WGLA 3NVKE 1N8RH 4DRXB 1W5FA 4G4XA 3PLAC 2QEXF 4X20A 1PF5A 5HY0A 1YQNA 2HRUA 4O4IA 4EB6A 4EI9A 3LWOC 1VQ5F 4ZI7A 1UI9A 3VIUA 3CCEF 4IIJA 5ITZB 3HJWC 3KJKA 2I6RA 3IEQA 2UYNB 5AVMA 3N2GB 4NWOB 3WPWA 5CB4A 2R751 3HKCB 4TUYA 1U3PA 2CW4A 5HP8A 2KG4A 4TV9B 5IJ0A 3JAWB 2ZAUA 5LOVA 2UYNA 2MQEA 1H48A 1QVFF 4ZHYB 2ZVYA 3N2GA 2Q1XA 2OZBA 5MN5A 5GINC 3V7EA 5HWEA 3IKEA 5GONA 1RA4A 3LDTA 1U40A 5KX5B 1NJIH 5FJ4C 3VYTC 3JAWA 5HXZA 1E7KA 2BTQB 1OFUA 1W581 2AIZP 4I50B 3F0FA 1SA0A 3JVHA 3TD4A 4G4VA 3CC4F 1H7MA 5LP6C 3E20B 4C8GA 3GTZA 3UT5B 4LCKA 1T0AA 3JARA 1M90H 2BTUA 5JCOA 1VH8A 2GZLA 2ZODA 2N48A 1TVKB 4I4TA 1U43A 2EWCA 3OBWA 3C8LA 1Q81H 1Z5VA 1XV2A 1VQ9F 3DC2A 2QTPA 2CHSA 3CYPB 1YJWF 3RA6A 4O2AB 5FLXM 1JJ2F 3NMUC 2ZVZA 4C4WC 3J80M 3P4EA 3ZP4A 4M8IA 1VHAA 1YIJF 1YI2F 3E22B 3HWUA 3DDNA 2YYEA 2BTOA 5KMGA 5C8YA 4FFBB 5EZYB 4NUTA 3VI6A 2QI2A 2CHTA 5EB1B 3ESJA 3C9RA 3LYBA 2PHNA 3HAXD 4O2AA 2HP0A 1FFXB 2OHWA 1NQ3A 2VAWA 3S06A 3J7AR 5CA0B 2YXZA 1W5BA 4BT5A 1YJ9F 4BVSA 3VOAA 3V7QA 3F0GA 1X7PA 1GX1A 4O4LB 3F0EA 4FFBA 5EZYA 1VQ4F 4C82A 3CD6F 3CCVF 4ZOLA 4C8EA 4KWEA 1SDSA 2L26A 4X20B 2HRYA 4HNAB 4O4IB 1K73H 5IT9M 3R0PA 2BO1A 4F6RB 1RLUA 3AGKA 3CG6A 4IIJB 4O4LA 4BW0B 1RLGA 3P0ZA 3RYHA 3K12A 4YJ2A 1J7HA 2V9YA 3ZO8A 1GO0A 3CMAF 2RHOA 5CA1A 1R1MA 3WGNA 3CCUF 3WJQA 2K1SA 5CB4B 1GO1A 5LYJA 2NMUA 4HNAA 2UYJA 4TUYB 3F6MA 3IKFA 3MCAB 2FGYA 1VQLF 4F6RA 3IEWA 5IJ0B 4C81A 3WXMB 4RQOA 4YJ3B 2OTMA 5LOVB 5GAPK 3J81M 3VTIC 3K0TA 5IJ9A 2KGWA 2H8EA 2ALEA 2ZOVA 2AMTA 3RA5A 3JAKB 5HY2A 3NK6A 3SIUA 1FNJA 5GONB 5DCVA 3KJJA 2HS0A 2DYYA 3M4SA 3Q8HA 1IV1A 4X1IA 4BVTA 2PMPA 3V3TA 4YJ3A 3G4SF 1VQ8F 2CZWA 4R40B 1SA0B 4C8IA 1U3LA 1W2BF 2CSLA 3D54A 1XBIA 4IHJB 1SZQA 4NQ3A 3JAKA 5B8FA 5JVDB 2I6DA 3JARB 2WALA 3JALB 2Z1EA 2VXYA 3CCMF 5EAZA 4BVQA 3N2KB 3CYQA 4I4TB 3K2XA 3WGMA 2JNBA 5FNVA 2RHJA 2HX0A 3S02A 3C9SA 4B62A 4IHJA 3T80A 4BY9D 3VCZA 3CC7F 3M1XA 4ZHVA 1VQ6F 3LWQC 3MDOA 2RB9A 5JVDA 3D01A 5IYZA 5EO3A 3JALA 1RQ7A 3FFMA 3RYFA 5EIBC 5LA6A 3N2KA 1DT9A 4X1YB 5GIPC 3B6NA 3RYCA 4O4JA 2OTJF 2H8CA 5KMGB 5C8YB 2Q1YA 3NK7A 2P6YA 1JN1A 2FC3A 2HP0B 3ON1A 3CMEF 1IV3A 3IMPA 4LNUA 3RE3A 4BT4A 3L7QA 3MQWA 4G4ZA 4X1YA 5A2QM 2Z1TA 4EI8A 5LP6A 3CXCF 2VGNA 3JASB 1TUBA 1YITF 4ZOLB 3G71F 1JY8A 2R6R1 3VYUC 1X7OA 1Q86H 1IV2A 3N4ZA 1ODEA 2UYPA 4X3LA 3S0YA 2Z1UA 3WGKA 4BT2A 2HVYD 4XCQA 3JASA 3RYHB 1FNKA 2GLZA 1W42A 4YJ2B 3S0HA 3S0WA 1VQMF 1DBFA 4X1KB 3CCJF 4EI7A 5CA1B 1XHOA 3SIVA 3HKEB 1PXWA 3HKDB 5LYJB 2H6LA 5JQGB 1CN7A 2LBXA 3G6EF 4BT6A 3OONA 2AIFA 2HS3A 1ONIA 2HP3A 1W57A 4I55A 1VQKF 3CPWF 2QA4F 3JCMM 3RYIA 1VQNF 4TV8B 5EYPA 4ERHA 3FBAA 3JATA 4X1KA 1Q8RA 5IJ9B 1W40A 3ERNA 3HKEA 3TD5A 3HKDA 3PAFA 3BYQA 5JQGA 1UFYA 3VMFB 5J2TB 3LWRC 1JFFA 1FSZA 3CCRF 2DT4A 4X1IB 5G4UC 3E1YA 3JAMM 1Q82H 3FD6A 4O2BA 2IQQA 2W8BC 3P10A 2LBWA
chains in the Genus database with same CATH topology
2I6DA 5G4VC 3OBWA 2WALA 1Q81H 1VQ9F 3CCMF 4BVQA 1NMUB 3RA6A 1YJWF 3LWVC 5FLXM 2JNBA 1JJ2F 3NMUC 4C4WC 3J80M 3CC2F 1QVGF 1CK2A 4BY9D 3CC7F 1VQPF 1T0KB 4BVRA 3LWQC 3I56F 1YIJF 1VQ6F 1X52A 2KTUA 3I55F 1YI2F 5GIOC 5EO3A 1M1KH 2OTLF 1W3EX 4NUTA 3FFMA 3GYQA 5EWRA 3VI6A 4X3MA 3D00A 2QI2A 1VQ7F 2F9ZC 1DT9A 3HAXD 5GIPC 3OW2F 2OHWA 1IPAA 1W41A 1YJNF 3J7AR 2OTJF 3CCSF 3CCQF 1GZ0A 4BVSA 1YJ9F 3CCLF 3NVKE 1N8RH 1K9MH 3NK7A 3V7QA 1X7PA 5HXUA 3PLAC 2QEXF 2FC3A 4TZZA 3ON1A 5HY0A 3CMEF 4EI9A 3LWOC 1VQ5F 1VQ4F 3CD6F 3CCVF 3CCEF 1SDSA 5HY4A 5A2QM 5HY1A 3HJWC 4EI8A 3CXCF 2VGNA 1K73H 5IT9M 1KC8H 1YITF 2BO1A 1KD1H 3G71F 1YHQF 3AGKA 3CG6A 4BW0B 1RLGA 1X7OA 1Q86H 3N4ZA 1GO0A 3CMAF 4X3LA 2KG4A 1K8AH 1ZWZA 3CCUF 2HVYD 1GO1A 5GANK 4XCQA 2GLZA 1W42A 3MCAB 1VQLF 2FGYA 1VQMF 3CCJF 4EI7A 1QVFF 1KQSF 2OZBA 3SIVA 3WXMB 1PXWA 5GINC 1VQOF 5HWEA 5GAPK 1Q7YH 3V7EA 1CN7A 2LBXA 1RA4A 3J81M 3G6EF 3CPQA 2AIFA 2KTVA 1NJIH 5FJ4C 2ALEA 1VQKF 5HXZA 1E7KA 3LFOA 3CPWF 2QA4F 1S72F 3JCMM 3NVIB 1VQNF 3RA5A 5HY2A 3NK6A 3SIUA 5DCVA 3IR9A 3CC4F 1H7MA 1W40A 3E20B 3OBYA 4BVTA 3PAFA 3N4YA 3V3TA 3G4SF 3O85A 3VMFB 3LWRC 4LCKA 2VGMA 1VQ8F 2CZWA 3CCRF 1M90H 1W2BF 1XBIA 5G4UC 3E1YA 3JAMM 1Q82H 4NQ3A 2LBWA 3LWPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  5G4V C;  3OBW A;  2WAL A;  1Q81 H;  1VQ9 F;  3CCM F;  1NMU B;  3RA6 A;  1YJW F;  3LWV C;  5FLX M;  2JNB A;  1JJ2 F;  3NMU C;  4C4W C;  3J80 M;  3CC2 F;  1QVG F;  1CK2 A;  4BY9 D;  3CC7 F;  1VQP F;  1T0K B;  1YIJ F;  3LWQ C;  3I56 F;  1VQ6 F;  1X52 A;  2KTU A;  3I55 F;  1YI2 F;  5GIO C;  5EO3 A;  1M1K H;  2OTL F;  1W3E X;  4NUT A;  3FFM A;  3GYQ A;  5EWR A;  3VI6 A;  4X3M A;  2QI2 A;  1VQ7 F;  1DT9 A;  3HAX D;  5GIP C;  3OW2 F;  2OHW A;  1IPA A;  1W41 A;  1YJN F;  3J7A R;  2OTJ F;  3CCS F;  3CCQ F;  1GZ0 A;  1YJ9 F;  3CCL F;  3NVK E;  1N8R H;  1K9M H;  3NK7 A;  3V7Q A;  1X7P A;  3PLA C;  2QEX F;  2FC3 A;  4TZZ A;  3ON1 A;  3CME F;  3LWO C;  1VQ5 F;  1VQ4 F;  3CD6 F;  3CCV F;  3CCE F;  1SDS A;  5A2Q M;  3HJW C;  3CXC F;  2VGN A;  1K73 H;  5IT9 M;  1KC8 H;  1YIT F;  2BO1 A;  1KD1 H;  3G71 F;  1YHQ F;  3AGK A;  3CG6 A;  4BW0 B;  1RLG A;  1X7O A;  1Q86 H;  3N4Z A;  1GO0 A;  3CMA F;  4X3L A;  2KG4 A;  1K8A H;  1ZWZ A;  3CCU F;  2HVY D;  1GO1 A;  5GAN K;  1W42 A;  3MCA B;  1VQL F;  1VQM F;  3CCJ F;  1QVF F;  1KQS F;  2OZB A;  3SIV A;  3WXM B;  1PXW A;  5GIN C;  1VQO F;  3V7E A;  5GAP K;  1Q7Y H;  1CN7 A;  2LBX A;  1RA4 A;  3J81 M;  3G6E F;  3CPQ A;  2AIF A;  2KTV A;  1NJI H;  5FJ4 C;  2ALE A;  1VQK F;  1E7K A;  3LFO A;  3CPW F;  2QA4 F;  1S72 F;  3JCM M;  3NVI B;  1VQN F;  3RA5 A;  3NK6 A;  3SIU A;  5DCV A;  3IR9 A;  3CC4 F;  1H7M A;  1W40 A;  3E20 B;  3OBY A;  3PAF A;  3N4Y A;  3G4S F;  3O85 A;  3VMF B;  3LWR C;  4LCK A;  2VGM A;  1VQ8 F;  2CZW A;  3CCR F;  1M90 H;  1W2B F;  1XBI A;  5G4U C;  3E1Y A;  3JAM M;  1Q82 H;  2LBW A;  3LWP C; 
#chains in the Genus database with same CATH topology
 3CB2 A;  2VAP A;  4TV8 A;  3VO8 A;  2HQS C;  3EOR A;  2IAF A;  3HKB A;  5MN6 A;  5J2T A;  2UYK A;  3LWV C;  4BT7 A;  3CC2 F;  1QVG F;  1CK2 A;  3M84 A;  5J2U A;  3C9T A;  1XRG A;  4U39 A;  1CLI A;  2IG8 A;  5FNV B;  3QHD A;  1VQ7 F;  3GYQ A;  5EWR A;  4DRX A;  4X3M A;  2CVL A;  5BMV B;  4ZHW A;  3OW2 F;  2UZH A;  5IYZ B;  1IPA A;  1KNK A;  2LCA A;  3CCS F;  1GZ0 A;  4PWT A;  1W55 A;  3CCL F;  3ZOP A;  3RYF B;  1K9M H;  5LA6 B;  3C9U A;  4O4H B;  5HXU A;  3VOB A;  5ITZ A;  5JCO C;  1QD9 A;  3WJR A;  3F0D A;  3RYC B;  4TZZ A;  4O4J B;  4WBN B;  4E6E A;  4DXD A;  5BMV A;  3TD3 A;  5HY4 A;  5HY1 A;  3HTN A;  1OAP A;  1W59 A;  2RHL A;  3HKC A;  3FD5 A;  3LME A;  2G9I A;  4LNU B;  5HP7 A;  1W5E A;  1COM A;  1KC8 H;  5JH7 B;  3VYS C;  4O4H A;  1YGY A;  4TV9 A;  1KD1 H;  5LXT B;  1YHQ F;  4WBN A;  5LP6 B;  4ZHQ B;  1H47 A;  3KIZ A;  1TUB B;  1QAH A;  3QTY A;  4BT3 A;  1K8A H;  2Z1F A;  1JD1 A;  1ZWZ A;  5GAN K;  5MN4 A;  5KX5 A;  1W5A A;  5JH7 A;  3FPI A;  5LXT A;  1KQS F;  3I3F A;  3S03 A;  2B33 A;  1RQ2 A;  1VQO F;  2RHH A;  1Q7Y H;  4I50 A;  4ZHQ A;  3K14 A;  3CPQ A;  2KTV A;  3ELC A;  3LFO A;  1S72 F;  3UT5 A;  3NVI B;  4U3J B;  3IR9 A;  4B45 A;  2VAM A;  4G4W A;  4I55 B;  3OBY A;  1Z5W A;  1TVK A;  2Z01 A;  3N4Y A;  3O85 A;  3RYI B;  2VGM A;  4ZK7 A;  1X25 A;  5EYP B;  3JAT B;  3MCQ A;  3WGJ A;  3I7T A;  4B46 A;  4G4Y A;  3LWP C;  1VK3 A;  4U3J A;  1JFF B;  5G4V C;  2ZF8 A;  3WJP A;  2GVI A;  5EIB D;  4O2B B;  3V4D A;  1NMU B;  3E22 A;  3QUW A;  3HKB B;  1VQP F;  1T0K B;  4BVR A;  3I56 F;  4B5C A;  1X52 A;  2KTU A;  2LBT A;  3I55 F;  5GIO C;  1FFX A;  1M1K H;  2OTL F;  5CA0 A;  4RHA A;  3KHN A;  1VQV A;  4EB6 B;  3MBM A;  1QU9 A;  1W3E X;  1KNJ A;  3KE1 A;  5EB0 A;  3D00 A;  5J2U B;  3ZP7 A;  4ZI7 B;  2HS4 A;  2F9Z C;  3GHZ A;  3U0O A;  1IV4 A;  4G88 A;  1YJN F;  1W41 A;  2CWJ A;  3WPX A;  3CCQ F;  3WGL A;  3NVK E;  1N8R H;  4DRX B;  1W5F A;  4G4X A;  3PLA C;  2QEX F;  4X20 A;  1PF5 A;  5HY0 A;  1YQN A;  2HRU A;  4O4I A;  4EB6 A;  4EI9 A;  3LWO C;  1VQ5 F;  4ZI7 A;  1UI9 A;  3VIU A;  3CCE F;  4IIJ A;  5ITZ B;  3HJW C;  3KJK A;  2I6R A;  3IEQ A;  2UYN B;  5AVM A;  3N2G B;  4NWO B;  3WPW A;  5CB4 A;  2R75 1;  3HKC B;  4TUY A;  1U3P A;  2CW4 A;  5HP8 A;  2KG4 A;  4TV9 B;  5IJ0 A;  3JAW B;  2ZAU A;  5LOV A;  2UYN A;  2MQE A;  1H48 A;  1QVF F;  4ZHY B;  2ZVY A;  3N2G A;  2Q1X A;  2OZB A;  5MN5 A;  5GIN C;  3V7E A;  5HWE A;  3IKE A;  5GON A;  1RA4 A;  3LDT A;  1U40 A;  5KX5 B;  1NJI H;  5FJ4 C;  3VYT C;  3JAW A;  5HXZ A;  1E7K A;  2BTQ B;  1OFU A;  1W58 1;  2AIZ P;  4I50 B;  3F0F A;  1SA0 A;  3JVH A;  3TD4 A;  4G4V A;  3CC4 F;  1H7M A;  5LP6 C;  3E20 B;  4C8G A;  3GTZ A;  3UT5 B;  4LCK A;  1T0A A;  3JAR A;  1M90 H;  2BTU A;  5JCO A;  1VH8 A;  2GZL A;  2ZOD A;  2N48 A;  1TVK B;  4I4T A;  1U43 A;  2EWC A;  3OBW A;  3C8L A;  1Q81 H;  1Z5V A;  1XV2 A;  1VQ9 F;  3DC2 A;  2QTP A;  2CHS A;  3CYP B;  1YJW F;  3RA6 A;  4O2A B;  5FLX M;  1JJ2 F;  3NMU C;  2ZVZ A;  4C4W C;  3J80 M;  3P4E A;  3ZP4 A;  4M8I A;  1VHA A;  1YIJ F;  1YI2 F;  3E22 B;  3HWU A;  3DDN A;  2YYE A;  2BTO A;  5KMG A;  5C8Y A;  4FFB B;  5EZY B;  4NUT A;  3VI6 A;  2QI2 A;  2CHT A;  5EB1 B;  3ESJ A;  3C9R A;  3LYB A;  2PHN A;  3HAX D;  4O2A A;  2HP0 A;  1FFX B;  2OHW A;  1NQ3 A;  2VAW A;  3S06 A;  3J7A R;  5CA0 B;  2YXZ A;  1W5B A;  4BT5 A;  1YJ9 F;  4BVS A;  3VOA A;  3V7Q A;  3F0G A;  1X7P A;  1GX1 A;  4O4L B;  3F0E A;  4FFB A;  5EZY A;  1VQ4 F;  4C82 A;  3CD6 F;  3CCV F;  4ZOL A;  4C8E A;  4KWE A;  1SDS A;  2L26 A;  4X20 B;  2HRY A;  4HNA B;  4O4I B;  1K73 H;  5IT9 M;  3R0P A;  2BO1 A;  4F6R B;  1RLU A;  3AGK A;  3CG6 A;  4IIJ B;  4O4L A;  4BW0 B;  1RLG A;  3P0Z A;  3RYH A;  3K12 A;  4YJ2 A;  1J7H A;  2V9Y A;  3ZO8 A;  1GO0 A;  3CMA F;  2RHO A;  5CA1 A;  1R1M A;  3WGN A;  3CCU F;  3WJQ A;  2K1S A;  5CB4 B;  1GO1 A;  5LYJ A;  2NMU A;  4HNA A;  2UYJ A;  4TUY B;  3F6M A;  3IKF A;  3MCA B;  2FGY A;  1VQL F;  4F6R A;  3IEW A;  5IJ0 B;  4C81 A;  3WXM B;  4RQO A;  4YJ3 B;  2OTM A;  5LOV B;  5GAP K;  3J81 M;  3VTI C;  3K0T A;  5IJ9 A;  2KGW A;  2H8E A;  2ALE A;  2ZOV A;  2AMT A;  3RA5 A;  3JAK B;  5HY2 A;  3NK6 A;  3SIU A;  1FNJ A;  5GON B;  5DCV A;  3KJJ A;  2HS0 A;  2DYY A;  3M4S A;  3Q8H A;  1IV1 A;  4X1I A;  4BVT A;  2PMP A;  3V3T A;  4YJ3 A;  3G4S F;  1VQ8 F;  2CZW A;  4R40 B;  1SA0 B;  4C8I A;  1U3L A;  1W2B F;  2CSL A;  3D54 A;  1XBI A;  4IHJ B;  1SZQ A;  4NQ3 A;  3JAK A;  5B8F A;  5JVD B;  2I6D A;  3JAR B;  2WAL A;  3JAL B;  2Z1E A;  2VXY A;  3CCM F;  5EAZ A;  4BVQ A;  3N2K B;  3CYQ A;  4I4T B;  3K2X A;  3WGM A;  2JNB A;  5FNV A;  2RHJ A;  2HX0 A;  3S02 A;  3C9S A;  4B62 A;  4IHJ A;  3T80 A;  4BY9 D;  3VCZ A;  3CC7 F;  3M1X A;  4ZHV A;  1VQ6 F;  3LWQ C;  3MDO A;  2RB9 A;  5JVD A;  3D01 A;  5IYZ A;  5EO3 A;  3JAL A;  1RQ7 A;  3FFM A;  3RYF A;  5EIB C;  5LA6 A;  3N2K A;  1DT9 A;  4X1Y B;  5GIP C;  3B6N A;  3RYC A;  4O4J A;  2OTJ F;  2H8C A;  5KMG B;  5C8Y B;  2Q1Y A;  3NK7 A;  2P6Y A;  1JN1 A;  2FC3 A;  2HP0 B;  3ON1 A;  3CME F;  1IV3 A;  3IMP A;  4LNU A;  3RE3 A;  4BT4 A;  3L7Q A;  3MQW A;  4G4Z A;  4X1Y A;  5A2Q M;  2Z1T A;  4EI8 A;  5LP6 A;  3CXC F;  2VGN A;  3JAS B;  1TUB A;  1YIT F;  4ZOL B;  3G71 F;  1JY8 A;  2R6R 1;  3VYU C;  1X7O A;  1Q86 H;  1IV2 A;  3N4Z A;  1ODE A;  2UYP A;  4X3L A;  3S0Y A;  2Z1U A;  3WGK A;  4BT2 A;  2HVY D;  4XCQ A;  3JAS A;  3RYH B;  1FNK A;  2GLZ A;  1W42 A;  4YJ2 B;  3S0H A;  3S0W A;  1VQM F;  1DBF A;  4X1K B;  3CCJ F;  4EI7 A;  5CA1 B;  1XHO A;  3SIV A;  3HKE B;  1PXW A;  3HKD B;  5LYJ B;  2H6L A;  5JQG B;  1CN7 A;  2LBX A;  3G6E F;  4BT6 A;  3OON A;  2AIF A;  2HS3 A;  1ONI A;  2HP3 A;  1W57 A;  4I55 A;  1VQK F;  3CPW F;  2QA4 F;  3JCM M;  3RYI A;  1VQN F;  4TV8 B;  5EYP A;  4ERH A;  3FBA A;  3JAT A;  4X1K A;  1Q8R A;  5IJ9 B;  1W40 A;  3ERN A;  3HKE A;  3TD5 A;  3HKD A;  3PAF A;  3BYQ A;  5JQG A;  1UFY A;  3VMF B;  5J2T B;  3LWR C;  1JFF A;  1FSZ A;  3CCR F;  2DT4 A;  4X1I B;  5G4U C;  3E1Y A;  3JAM M;  1Q82 H;  3FD6 A;  4O2B A;  2IQQ A;  2W8B C;  3P10 A;  2LBW A; 
#chains in the Genus database with same CATH homology
 2I6D A;  5G4V C;  3OBW A;  2WAL A;  1Q81 H;  1VQ9 F;  3CCM F;  4BVQ A;  1NMU B;  3RA6 A;  1YJW F;  3LWV C;  5FLX M;  2JNB A;  1JJ2 F;  3NMU C;  4C4W C;  3J80 M;  3CC2 F;  1QVG F;  1CK2 A;  4BY9 D;  3CC7 F;  1VQP F;  1T0K B;  4BVR A;  3LWQ C;  3I56 F;  1YIJ F;  1VQ6 F;  1X52 A;  2KTU A;  3I55 F;  1YI2 F;  5GIO C;  5EO3 A;  1M1K H;  2OTL F;  1W3E X;  4NUT A;  3FFM A;  3GYQ A;  5EWR A;  3VI6 A;  4X3M A;  3D00 A;  2QI2 A;  1VQ7 F;  2F9Z C;  1DT9 A;  3HAX D;  5GIP C;  3OW2 F;  2OHW A;  1IPA A;  1W41 A;  1YJN F;  3J7A R;  2OTJ F;  3CCS F;  3CCQ F;  1GZ0 A;  4BVS A;  1YJ9 F;  3CCL F;  3NVK E;  1N8R H;  1K9M H;  3NK7 A;  3V7Q A;  1X7P A;  5HXU A;  3PLA C;  2QEX F;  2FC3 A;  4TZZ A;  3ON1 A;  5HY0 A;  3CME F;  4EI9 A;  3LWO C;  1VQ5 F;  1VQ4 F;  3CD6 F;  3CCV F;  3CCE F;  1SDS A;  5HY4 A;  5A2Q M;  5HY1 A;  3HJW C;  4EI8 A;  3CXC F;  2VGN A;  1K73 H;  5IT9 M;  1KC8 H;  1YIT F;  2BO1 A;  1KD1 H;  3G71 F;  1YHQ F;  3AGK A;  3CG6 A;  4BW0 B;  1RLG A;  1X7O A;  1Q86 H;  3N4Z A;  1GO0 A;  3CMA F;  4X3L A;  2KG4 A;  1K8A H;  1ZWZ A;  3CCU F;  2HVY D;  1GO1 A;  5GAN K;  4XCQ A;  2GLZ A;  1W42 A;  3MCA B;  1VQL F;  2FGY A;  1VQM F;  3CCJ F;  4EI7 A;  1QVF F;  1KQS F;  2OZB A;  3SIV A;  3WXM B;  1PXW A;  5GIN C;  1VQO F;  5HWE A;  5GAP K;  1Q7Y H;  3V7E A;  1CN7 A;  2LBX A;  1RA4 A;  3J81 M;  3G6E F;  3CPQ A;  2AIF A;  2KTV A;  1NJI H;  5FJ4 C;  2ALE A;  1VQK F;  5HXZ A;  1E7K A;  3LFO A;  3CPW F;  2QA4 F;  1S72 F;  3JCM M;  3NVI B;  1VQN F;  3RA5 A;  5HY2 A;  3NK6 A;  3SIU A;  5DCV A;  3IR9 A;  3CC4 F;  1H7M A;  1W40 A;  3E20 B;  3OBY A;  4BVT A;  3PAF A;  3N4Y A;  3V3T A;  3G4S F;  3O85 A;  3VMF B;  3LWR C;  4LCK A;  2VGM A;  1VQ8 F;  2CZW A;  3CCR F;  1M90 H;  1W2B F;  1XBI A;  5G4U C;  3E1Y A;  3JAM M;  1Q82 H;  4NQ3 A;  2LBW A;  3LWP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...