3PAFA

M. jannaschii l7ae mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
MAVYVKFKVPEEIQKELLDAVAKAQQIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGVSRPASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L7Ae
publication title Structure and stability of M.jannaschii L7Ae El9 KtoQ mutant
rcsb
source organism Methanocaldococcus jannaschii
total genus 38
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3pafA00
1W42A 2KTVA 3CC2F 3RA6A 3LFOA 1QVGF 5FJ4C 2OTJF 1YHQF 2CZWA 5DCVA 4BY9D 1DT9A 3E20B 1GO0A 3CCEF 1KD1H 1Q82H 3CPWF 3O85A 2HVYD 3I56F 1K73H 1X7OA 4LCKA 3OW2F 4C4WC 3NVIB 1XBIA 2I6DA 1QVFF 2OTLF 1VQMF 1CN7A 3G71F 1YJNF 1W2BF 3LWVC 4NUTA 1VQ4F 1T0KB 3OBYA 3J7AR 3CCMF 3CCLF 3CMAF 3PAFA 3CCJF 1Q81H 3E1YA 1JJ2F 2JNBA 5A2QM 1X7PA 2WALA 3JCMM 1RA4A 1VQPF 3CCRF 1KC8H 5G4VC 2AIFA 5GAPK 1YITF 1VQKF 2FC3A 1K9MH 3CC4F 1CK2A 3CCVF 1VQOF 3AGKA 4X3MA 3NVKE 4BW0B 3HAXD 3NK7A 3G6EF 3JAMM 5GIPC 1VQ6F 3SIVA 3CPQA 1VQLF 1YI2F 3WXMB 1W40A 3J80M 1VQ5F 1ZWZA 3PLAC 2ALEA 3VI6A 1YIJF 3CG6A 1X52A 3LWQC 3N4YA 3J81M 1SDSA 5GANK 1KQSF 3GYQA 3SIUA 3ON1A 2QA4F 1Q86H 1VQ7F 1W3EX 3OBWA 1GO1A 2QEXF 5G4UC 2OZBA 5IT9M 3RA5A 5EWRA 3HJWC 5GIOC 1N8RH 3N4ZA 3V7EA 3V7QA 1YJ9F 1IPAA 1E7KA 2LBXA 1H7MA 3CCQF 3IR9A 1W41A 3CMEF 1M1KH 2LBWA 2OHWA 1VQ9F 2KG4A 2BO1A 3LWOC 1VQNF 1K8AH 3CXCF 3I55F 4X3LA 3G4SF 1NMUB 4TZZA 5GINC 1YJWF 3NMUC 3CD6F 2KTUA 1Q7YH 1NJIH 3CCSF 3VMFB 1GZ0A 1RLGA 1PXWA 2QI2A 3LWPC 3NK6A 2VGNA 3CCUF 3MCAB 3CC7F 1S72F 2VGMA 1VQ8F 5EO3A 3LWRC 5FLXM 3FFMA 1M90H
chains in the Genus database with same CATH superfamily
4O4LB 2RHJA 3JASA 4LNUA 4TUYA 3RA6A 2N48A 4O2BA 3IKEA 2CVLA 4U39A 3C9UA 4TV9B 5DCVA 3F0DA 1ONIA 3EORA 3WGLA 3KHNA 1H48A 3I56F 4BVSA 3ZO8A 2RHHA 4C4WC 1XBIA 2OTLF 1VQMF 1CN7A 2Z1FA 3N2GB 3G71F 1W2BF 3ELCA 1TVKA 3LWVC 2PMPA 4TV8A 4NWOB 4LNUB 3CCMF 3CMAF 4TUYB 4O2BB 3E1YA 2OTMA 2JNBA 2WALA 4ZHWA 2HS0A 3JCMM 4BT5A 1KC8H 2ZVZA 4BT7A 5MN6A 5IJ0A 3LYBA 3F6MA 3VOAA 4B62A 1ODEA 1TVKB 2Q1XA 2UZHA 4X20B 5KX5B 1UI9A 3NK7A 1CLIA 4ZHQA 5EZYA 1YQNA 2CHTA 4RHAA 3DDNA 1YIJF 4X1YA 1X52A 4I4TA 3N4YA 4R40B 3GYQA 5FNVA 5ITZB 3F0FA 3HKBA 3VCZA 3QUWA 3V4DA 2HRUA 3HTNA 3WGNA 5LYJB 5GIOC 5HY1A 3HJWC 3WGJA 3MCQA 1XV2A 2RB9A 3C9TA 3N4ZA 4NQ3A 3I3FA 5EZYB 3S06A 1VQVA 2L26A 3JAKB 2LBXA 2UYPA 3TD4A 3CCQF 3ZP4A 3JALB 4BT2A 4BT4A 4G88A 3IEQA 3K2XA 2DT4A 3TD3A 3LWOC 3WGKA 1VHAA 2HX0A 3ZOPA 4X3LA 5IJ9B 5FNVB 3S0WA 2HS3A 1KNJA 3HKBB 3LDTA 4O4JA 2LBTA 3UT5A 4ZK7A 1PXWA 3LWPC 3WGMA 2Q1YA 3NK6A 2AMTA 4BVQA 4BVTA 5LOVB 5CA0A 5EIBC 5JVDA 5FLXM 3FFMA 5HY4A 4IHJA 1QVGF 1COMA 4C8IA 5FJ4C 2OTJF 1YHQF 1W581 4C8EA 3V3TA 1TUBA 4HNAB 3E20B 1GO0A 3CCEF 1Q82H 3O85A 3UT5B 4DXDA 2HVYD 4O4HB 3OW2F 1UFYA 4B5CA 3N2KA 3S0HA 1FFXB 2CSLA 4IIJA 5CA0B 5JH7A 5JVDB 4G4VA 3OBYA 1IV3A 3M84A 5LP6C 3CCLF 3JATB 4IHJB 5CB4A 3JVHA 1U43A 5LA6A 4ZI7A 1GX1A 2VAPA 5HP8A 1RA4A 4X1KA 3QTYA 4X1IA 4EI8A 3F0GA 3N2KB 3Q8HA 3HKCB 3HKDB 1VQKF 5HY0A 1FNJA 2HP0A 5LXTB 2FC3A 1K9MH 1CK2A 3IKFA 3CCVF 3AGKA 4U3JB 2HQSC 2I6RA 2W8BC 5CB4B 3HAXD 5LA6B 1VK3A 3JASB 3ESJA 5EAZA 5JCOA 2VAWA 3VIUA 1W40A 2QTPA 1JFFA 3K14A 3PLAC 4X1IB 4BT3A 4YJ3A 3LWQC 1OFUA 4FFBA 5B8FA 3ON1A 1Q86H 1VQ7F 1W55A 5CA1A 1W3EX 5G4UC 5IT9M 2OZBA 3RA5A 5EWRA 1IV4A 3RYHA 2ZOVA 2LCAA 4TV8B 3S0YA 3ERNA 1IPAA 3JARA 1YJ9F 1E7KA 1H7MA 4I50A 1VQ9F 4G4YA 1JFFB 1Z5WA 5EIBD 3MQWA 1XHOA 2BO1A 3I55F 3G4SF 3NMUC 4FFBB 2B33A 5GINC 1YJWF 4XCQA 3CYQA 4BT6A 2Z1UA 5CA1B 2G9IA 3C9SA 3M4SA 3FD6A 2RHLA 3VOBA 1R1MA 5IJ0B 5J2UA 2P6YA 1H47A 1W5BA 5LP6A 2VGNA 3CCUF 1XRGA 3JARB 4C82A 3RYCA 4ZHQB 4G4XA 4I50B 2HRYA 4I55A 4RQOA 5EO3A 1QU9A 1M90H 1U3PA 3IMPA 1X25A 1Q8RA 5HP7A 3FD5A 3LFOA 3QHDA 4C8GA 4X1YB 4F6RA 2CZWA 2BTQB 3KE1A 4EI9A 1DT9A 2CWJA 1RLUA 4I4TB 1KNKA 5JCOC 3P10A 3CPWF 5J2UB 3CYPB 1K73H 1X7OA 4LCKA 3B6NA 3RYFA 3U0OA 2IQQA 3FBAA 3KJJA 1FSZA 5IYZA 2ZVYA 3LMEA 5J2TA 4O4IA 3WPWA 1YJNF 3GTZA 4I55B 2HS4A 1VQ4F 1T0KB 3J7AR 4WBNA 4F6RB 1JN1A 5A2QM 1PF5A 1X7PA 1OAPA 1VQPF 3CCRF 5G4VC 1W5EA 2AIFA 4O4JB 3CB2A 3D54A 1YITF 4M8IA 5J2TB 5C8YA 2AIZP 4O4IB 5EYPA 3M1XA 3E22A 1VQOF 2KGWA 3BYQA 4X3MA 1YGYA 5BMVA 3ZP7A 1U3LA 4WBNB 2YYEA 3JAMM 5GIPC 3K0TA 1NQ3A 2Z1EA 4PWTA 3SIVA 3RYIA 1QAHA 3WJRA 3VYSC 3OONA 3K12A 2RHOA 3WXMB 1TUBB 3HKEA 1ZWZA 3VI6A 4TV9A 2CW4A 1RQ2A 2IAFA 2VAMA 1SDSA 2DYYA 5MN5A 1KQSF 5C8YB 3SIUA 2QA4F 1QD9A 2GVIA 5EYPB 3TD5A 5HY2A 1GO1A 2UYNA 3E22B 4IIJB 4E6EA 5JH7B 3V7QA 4C81A 3RYIB 3IR9A 3CMEF 4ZI7B 2R6R1 2H8CA 3HKEB 1FNKA 1T0AA 3WJPA 2KG4A 3FPIA 1VQNF 3CXCF 4ZHYB 4X1KB 5KMGA 4TZZA 2GZLA 4B46A 2PHNA 3CD6F 3MDOA 3WPXA 1DBFA 2BTOA 2UYNB 1GZ0A 5EB1B 3CCSF 2F9ZC 1RLGA 2HP0B 3P4EA 1SA0A 3MCAB 5HXUA 3CC7F 1S72F 2VGMA 1VQ8F 2ZODA 4X20A 5KX5A 3MBMA 2H6LA 1W57A 1SZQA 1W42A 2KTVA 3CC2F 5KMGB 2H8EA 5GONA 3P0ZA 3DC2A 4BY9D 4YJ3B 3S02A 1RQ7A 2R751 1KD1H 3L7QA 1Z5VA 3KJKA 3S03A 4B45A 3JAWA 2BTUA 4YJ2A 1J7HA 2Z01A 5ITZA 3NVIB 1SA0B 1QVFF 2I6DA 3RYHB 3F0EA 5HXZA 5LYJA 4NUTA 3D01A 1JY8A 3PAFA 3T80A 3CCJF 3JAKA 5GONB 2CHSA 3JALA 1Q81H 1JJ2F 2GLZA 2YXZA 4EB6A 4O2AA 2ZF8A 3R0PA 4BVRA 5IJ9A 3JAWB 4YJ2B 5AVMA 3C8LA 2VXYA 2EWCA 5GAPK 2FGYA 3VO8A 2NMUA 2K1SA 1W5AA 1W59A 5LP6B 3CC4F 3RYCB 1IV1A 3NVKE 3VYUC 3C9RA 5LOVA 3VTIC 3GHZA 3I7TA 4BW0B 3HWUA 3G6EF 1VQ6F 4EB6B 1JD1A 2MQEA 4O2AB 3CPQA 2Z1TA 1VQLF 3VYTC 1YI2F 5EB0A 3J80M 1VQ5F 5MN4A 4ZHVA 1W5FA 2ALEA 4ZOLA 3KIZA 3CG6A 4HNAA 3J81M 5GANK 1U40A 3IEWA 3RYFB 3OBWA 4O4HA 2QEXF 1VH8A 3RE3A 5IYZB 1FFXA 4ERHA 1N8RH 3V7EA 4DRXA 5JQGA 1W41A 1M1KH 4KWEA 2LBWA 2OHWA 1IV2A 3JATA 4O4LA 4ZOLB 1K8AH 3WJQA 4G4ZA 1NMUB 2IG8A 2V9YA 2KTUA 1Q7YH 1NJIH 2UYJA 3VMFB 2ZAUA 4G4WA 2QI2A 3HKCA 3HKDA 3D00A 2UYKA 5HWEA 5LXTA 4DRXB 5BMVB 5JQGB 4EI7A 3N2GA 4U3JA 3LWRC 2HP3A
chains in the Genus database with same CATH topology
1W42A 2KTVA 3CC2F 5HY4A 3RA6A 3LFOA 1QVGF 5FJ4C 2OTJF 1YHQF 2CZWA 3V3TA 4BY9D 4EI9A 5DCVA 1DT9A 3E20B 1GO0A 3CCEF 1KD1H 1Q82H 3CPWF 3O85A 2HVYD 3I56F 1K73H 1X7OA 4BVSA 4LCKA 3OW2F 4C4WC 3NVIB 1XBIA 2I6DA 1QVFF 2OTLF 1VQMF 1CN7A 3G71F 5HXZA 1YJNF 1W2BF 3LWVC 4NUTA 1VQ4F 1T0KB 3OBYA 3J7AR 3CCMF 3CCLF 3CMAF 3PAFA 3CCJF 1Q81H 3E1YA 1JJ2F 2JNBA 5A2QM 2GLZA 1X7PA 2WALA 3JCMM 1RA4A 1VQPF 4BVRA 3CCRF 1KC8H 5G4VC 2AIFA 5GAPK 4EI8A 2FGYA 1YITF 1VQKF 5HY0A 2FC3A 1K9MH 3CC4F 1CK2A 3CCVF 1VQOF 3AGKA 4X3MA 3NVKE 4BW0B 3HAXD 3NK7A 3G6EF 3JAMM 5GIPC 1VQ6F 3SIVA 3CPQA 1VQLF 1YI2F 3WXMB 1W40A 3J80M 1VQ5F 1ZWZA 3PLAC 2ALEA 3VI6A 1YIJF 3CG6A 1X52A 3LWQC 3N4YA 3J81M 1SDSA 5GANK 1KQSF 3GYQA 3SIUA 3ON1A 2QA4F 5HY2A 1Q86H 1VQ7F 1W3EX 3OBWA 1GO1A 2QEXF 5G4UC 2OZBA 5IT9M 3RA5A 5EWRA 3HJWC 5GIOC 5HY1A 1N8RH 3N4ZA 4NQ3A 3V7EA 3V7QA 1YJ9F 1IPAA 1E7KA 2LBXA 1H7MA 3CCQF 3IR9A 1W41A 3CMEF 1M1KH 2LBWA 2OHWA 1VQ9F 2KG4A 2BO1A 3LWOC 1VQNF 1K8AH 3CXCF 3I55F 4X3LA 3G4SF 1NMUB 4TZZA 5GINC 1YJWF 3NMUC 3CD6F 2KTUA 4XCQA 1Q7YH 1NJIH 3CCSF 3VMFB 1GZ0A 1RLGA 2F9ZC 1PXWA 2QI2A 3LWPC 3D00A 3NK6A 5HWEA 2VGNA 3CCUF 3MCAB 4BVQA 4BVTA 4EI7A 5HXUA 3CC7F 1S72F 2VGMA 1VQ8F 5EO3A 3LWRC 5FLXM 3FFMA 1M90H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W42 A;  2KTV A;  3CC2 F;  3RA6 A;  3LFO A;  1QVG F;  5FJ4 C;  2OTJ F;  1YHQ F;  2CZW A;  5DCV A;  4BY9 D;  1DT9 A;  3E20 B;  1GO0 A;  3CCE F;  1KD1 H;  1Q82 H;  3CPW F;  3O85 A;  2HVY D;  3I56 F;  1K73 H;  1X7O A;  4LCK A;  3OW2 F;  4C4W C;  3NVI B;  1XBI A;  2I6D A;  1QVF F;  2OTL F;  1VQM F;  1CN7 A;  3G71 F;  1YJN F;  1W2B F;  3LWV C;  4NUT A;  1VQ4 F;  1T0K B;  3OBY A;  3J7A R;  3CCM F;  3CCL F;  3CMA F;  3PAF A;  3CCJ F;  1Q81 H;  3E1Y A;  1JJ2 F;  2JNB A;  5A2Q M;  1X7P A;  2WAL A;  3JCM M;  1RA4 A;  1VQP F;  3CCR F;  1KC8 H;  5G4V C;  2AIF A;  5GAP K;  1YIT F;  1VQK F;  2FC3 A;  1K9M H;  3CC4 F;  1CK2 A;  3CCV F;  1VQO F;  3AGK A;  4X3M A;  3NVK E;  4BW0 B;  3HAX D;  3NK7 A;  3G6E F;  3JAM M;  5GIP C;  1VQ6 F;  3SIV A;  3CPQ A;  1VQL F;  1YI2 F;  3WXM B;  1W40 A;  3J80 M;  1VQ5 F;  1ZWZ A;  3PLA C;  2ALE A;  3VI6 A;  1YIJ F;  3CG6 A;  1X52 A;  3LWQ C;  3N4Y A;  3J81 M;  1SDS A;  5GAN K;  1KQS F;  3GYQ A;  3SIU A;  3ON1 A;  2QA4 F;  1Q86 H;  1VQ7 F;  1W3E X;  3OBW A;  1GO1 A;  2QEX F;  5G4U C;  2OZB A;  5IT9 M;  3RA5 A;  5EWR A;  3HJW C;  5GIO C;  1N8R H;  3N4Z A;  3V7E A;  3V7Q A;  1YJ9 F;  1IPA A;  1E7K A;  2LBX A;  1H7M A;  3CCQ F;  3IR9 A;  1W41 A;  3CME F;  1M1K H;  2LBW A;  2OHW A;  1VQ9 F;  2KG4 A;  2BO1 A;  3LWO C;  1VQN F;  1K8A H;  3CXC F;  3I55 F;  4X3L A;  3G4S F;  1NMU B;  4TZZ A;  5GIN C;  1YJW F;  3NMU C;  3CD6 F;  2KTU A;  1Q7Y H;  1NJI H;  3CCS F;  3VMF B;  1GZ0 A;  1RLG A;  1PXW A;  2QI2 A;  3LWP C;  3NK6 A;  2VGN A;  3CCU F;  3MCA B;  3CC7 F;  1S72 F;  2VGM A;  1VQ8 F;  5EO3 A;  3LWR C;  5FLX M;  3FFM A;  1M90 H; 
#chains in the Genus database with same CATH topology
 4O4L B;  2RHJ A;  3JAS A;  4LNU A;  4TUY A;  3RA6 A;  2N48 A;  4O2B A;  3IKE A;  2CVL A;  4U39 A;  3C9U A;  4TV9 B;  5DCV A;  3F0D A;  1ONI A;  3EOR A;  3WGL A;  3KHN A;  1H48 A;  3I56 F;  4BVS A;  3ZO8 A;  2RHH A;  4C4W C;  1XBI A;  2OTL F;  1VQM F;  1CN7 A;  2Z1F A;  3N2G B;  3G71 F;  1W2B F;  3ELC A;  1TVK A;  3LWV C;  2PMP A;  4TV8 A;  4NWO B;  4LNU B;  3CCM F;  3CMA F;  4TUY B;  4O2B B;  3E1Y A;  2OTM A;  2JNB A;  2WAL A;  4ZHW A;  2HS0 A;  3JCM M;  4BT5 A;  1KC8 H;  2ZVZ A;  4BT7 A;  5MN6 A;  5IJ0 A;  3LYB A;  3F6M A;  3VOA A;  4B62 A;  1ODE A;  1TVK B;  2Q1X A;  2UZH A;  4X20 B;  5KX5 B;  1UI9 A;  3NK7 A;  1CLI A;  4ZHQ A;  5EZY A;  1YQN A;  2CHT A;  4RHA A;  3DDN A;  1YIJ F;  4X1Y A;  1X52 A;  4I4T A;  3N4Y A;  4R40 B;  3GYQ A;  5FNV A;  5ITZ B;  3F0F A;  3HKB A;  3VCZ A;  3QUW A;  3V4D A;  2HRU A;  3HTN A;  3WGN A;  5LYJ B;  5GIO C;  5HY1 A;  3HJW C;  3WGJ A;  3MCQ A;  1XV2 A;  2RB9 A;  3C9T A;  3N4Z A;  4NQ3 A;  3I3F A;  5EZY B;  3S06 A;  1VQV A;  2L26 A;  3JAK B;  2LBX A;  2UYP A;  3TD4 A;  3CCQ F;  3ZP4 A;  3JAL B;  4BT2 A;  4BT4 A;  4G88 A;  3IEQ A;  3K2X A;  2DT4 A;  3TD3 A;  3LWO C;  3WGK A;  1VHA A;  2HX0 A;  3ZOP A;  4X3L A;  5IJ9 B;  5FNV B;  3S0W A;  2HS3 A;  1KNJ A;  3HKB B;  3LDT A;  4O4J A;  2LBT A;  3UT5 A;  4ZK7 A;  1PXW A;  3LWP C;  3WGM A;  2Q1Y A;  3NK6 A;  2AMT A;  4BVQ A;  4BVT A;  5LOV B;  5CA0 A;  5EIB C;  5JVD A;  5FLX M;  3FFM A;  5HY4 A;  4IHJ A;  1QVG F;  1COM A;  4C8I A;  5FJ4 C;  2OTJ F;  1YHQ F;  1W58 1;  4C8E A;  3V3T A;  1TUB A;  4HNA B;  3E20 B;  1GO0 A;  3CCE F;  1Q82 H;  3O85 A;  3UT5 B;  4DXD A;  2HVY D;  4O4H B;  3OW2 F;  1UFY A;  4B5C A;  3N2K A;  3S0H A;  1FFX B;  2CSL A;  4IIJ A;  5CA0 B;  5JH7 A;  5JVD B;  4G4V A;  3OBY A;  1IV3 A;  3M84 A;  5LP6 C;  3CCL F;  3JAT B;  4IHJ B;  5CB4 A;  3JVH A;  1U43 A;  5LA6 A;  4ZI7 A;  1GX1 A;  2VAP A;  5HP8 A;  1RA4 A;  4X1K A;  3QTY A;  4X1I A;  4EI8 A;  3F0G A;  3N2K B;  3Q8H A;  3HKC B;  3HKD B;  1VQK F;  5HY0 A;  1FNJ A;  2HP0 A;  5LXT B;  2FC3 A;  1K9M H;  1CK2 A;  3IKF A;  3CCV F;  3AGK A;  4U3J B;  2HQS C;  2I6R A;  2W8B C;  5CB4 B;  3HAX D;  5LA6 B;  1VK3 A;  3JAS B;  3ESJ A;  5EAZ A;  5JCO A;  2VAW A;  3VIU A;  1W40 A;  2QTP A;  1JFF A;  3K14 A;  3PLA C;  4X1I B;  4BT3 A;  4YJ3 A;  3LWQ C;  1OFU A;  4FFB A;  5B8F A;  3ON1 A;  1Q86 H;  1VQ7 F;  1W55 A;  5CA1 A;  1W3E X;  5G4U C;  5IT9 M;  2OZB A;  3RA5 A;  5EWR A;  1IV4 A;  3RYH A;  2ZOV A;  2LCA A;  4TV8 B;  3S0Y A;  3ERN A;  1IPA A;  3JAR A;  1YJ9 F;  1E7K A;  1H7M A;  4I50 A;  1VQ9 F;  4G4Y A;  1JFF B;  1Z5W A;  5EIB D;  3MQW A;  1XHO A;  2BO1 A;  3I55 F;  3G4S F;  3NMU C;  4FFB B;  2B33 A;  5GIN C;  1YJW F;  4XCQ A;  3CYQ A;  4BT6 A;  2Z1U A;  5CA1 B;  2G9I A;  3C9S A;  3M4S A;  3FD6 A;  2RHL A;  3VOB A;  1R1M A;  5IJ0 B;  5J2U A;  2P6Y A;  1H47 A;  1W5B A;  5LP6 A;  2VGN A;  3CCU F;  1XRG A;  3JAR B;  4C82 A;  3RYC A;  4ZHQ B;  4G4X A;  4I50 B;  2HRY A;  4I55 A;  4RQO A;  5EO3 A;  1QU9 A;  1M90 H;  1U3P A;  3IMP A;  1X25 A;  1Q8R A;  5HP7 A;  3FD5 A;  3LFO A;  3QHD A;  4C8G A;  4X1Y B;  4F6R A;  2CZW A;  2BTQ B;  3KE1 A;  4EI9 A;  1DT9 A;  2CWJ A;  1RLU A;  4I4T B;  1KNK A;  5JCO C;  3P10 A;  3CPW F;  5J2U B;  3CYP B;  1K73 H;  1X7O A;  4LCK A;  3B6N A;  3RYF A;  3U0O A;  2IQQ A;  3FBA A;  3KJJ A;  1FSZ A;  5IYZ A;  2ZVY A;  3LME A;  5J2T A;  4O4I A;  3WPW A;  1YJN F;  3GTZ A;  4I55 B;  2HS4 A;  1VQ4 F;  1T0K B;  3J7A R;  4WBN A;  4F6R B;  1JN1 A;  5A2Q M;  1PF5 A;  1X7P A;  1OAP A;  1VQP F;  3CCR F;  5G4V C;  1W5E A;  2AIF A;  4O4J B;  3CB2 A;  3D54 A;  1YIT F;  4M8I A;  5J2T B;  5C8Y A;  2AIZ P;  4O4I B;  5EYP A;  3M1X A;  3E22 A;  1VQO F;  2KGW A;  3BYQ A;  4X3M A;  1YGY A;  5BMV A;  3ZP7 A;  1U3L A;  4WBN B;  2YYE A;  3JAM M;  5GIP C;  3K0T A;  1NQ3 A;  2Z1E A;  4PWT A;  3SIV A;  3RYI A;  1QAH A;  3WJR A;  3VYS C;  3OON A;  3K12 A;  2RHO A;  3WXM B;  1TUB B;  3HKE A;  1ZWZ A;  3VI6 A;  4TV9 A;  2CW4 A;  1RQ2 A;  2IAF A;  2VAM A;  1SDS A;  2DYY A;  5MN5 A;  1KQS F;  5C8Y B;  3SIU A;  2QA4 F;  1QD9 A;  2GVI A;  5EYP B;  3TD5 A;  5HY2 A;  1GO1 A;  2UYN A;  3E22 B;  4IIJ B;  4E6E A;  5JH7 B;  3V7Q A;  4C81 A;  3RYI B;  3IR9 A;  3CME F;  4ZI7 B;  2R6R 1;  2H8C A;  3HKE B;  1FNK A;  1T0A A;  3WJP A;  2KG4 A;  3FPI A;  1VQN F;  3CXC F;  4ZHY B;  4X1K B;  5KMG A;  4TZZ A;  2GZL A;  4B46 A;  2PHN A;  3CD6 F;  3MDO A;  3WPX A;  1DBF A;  2BTO A;  2UYN B;  1GZ0 A;  5EB1 B;  3CCS F;  2F9Z C;  1RLG A;  2HP0 B;  3P4E A;  1SA0 A;  3MCA B;  5HXU A;  3CC7 F;  1S72 F;  2VGM A;  1VQ8 F;  2ZOD A;  4X20 A;  5KX5 A;  3MBM A;  2H6L A;  1W57 A;  1SZQ A;  1W42 A;  2KTV A;  3CC2 F;  5KMG B;  2H8E A;  5GON A;  3P0Z A;  3DC2 A;  4BY9 D;  4YJ3 B;  3S02 A;  1RQ7 A;  2R75 1;  1KD1 H;  3L7Q A;  1Z5V A;  3KJK A;  3S03 A;  4B45 A;  3JAW A;  2BTU A;  4YJ2 A;  1J7H A;  2Z01 A;  5ITZ A;  3NVI B;  1SA0 B;  1QVF F;  2I6D A;  3RYH B;  3F0E A;  5HXZ A;  5LYJ A;  4NUT A;  3D01 A;  1JY8 A;  3PAF A;  3T80 A;  3CCJ F;  3JAK A;  5GON B;  2CHS A;  3JAL A;  1Q81 H;  1JJ2 F;  2GLZ A;  2YXZ A;  4EB6 A;  4O2A A;  2ZF8 A;  3R0P A;  4BVR A;  5IJ9 A;  3JAW B;  4YJ2 B;  5AVM A;  3C8L A;  2VXY A;  2EWC A;  5GAP K;  2FGY A;  3VO8 A;  2NMU A;  2K1S A;  1W5A A;  1W59 A;  5LP6 B;  3CC4 F;  3RYC B;  1IV1 A;  3NVK E;  3VYU C;  3C9R A;  5LOV A;  3VTI C;  3GHZ A;  3I7T A;  4BW0 B;  3HWU A;  3G6E F;  1VQ6 F;  4EB6 B;  1JD1 A;  2MQE A;  4O2A B;  3CPQ A;  2Z1T A;  1VQL F;  3VYT C;  1YI2 F;  5EB0 A;  3J80 M;  1VQ5 F;  5MN4 A;  4ZHV A;  1W5F A;  2ALE A;  4ZOL A;  3KIZ A;  3CG6 A;  4HNA A;  3J81 M;  5GAN K;  1U40 A;  3IEW A;  3RYF B;  3OBW A;  4O4H A;  2QEX F;  1VH8 A;  3RE3 A;  5IYZ B;  1FFX A;  4ERH A;  1N8R H;  3V7E A;  4DRX A;  5JQG A;  1W41 A;  1M1K H;  4KWE A;  2LBW A;  2OHW A;  1IV2 A;  3JAT A;  4O4L A;  4ZOL B;  1K8A H;  3WJQ A;  4G4Z A;  1NMU B;  2IG8 A;  2V9Y A;  2KTU A;  1Q7Y H;  1NJI H;  2UYJ A;  3VMF B;  2ZAU A;  4G4W A;  2QI2 A;  3HKC A;  3HKD A;  3D00 A;  2UYK A;  5HWE A;  5LXT A;  4DRX B;  5BMV B;  5JQG B;  4EI7 A;  3N2G A;  4U3J A;  3LWR C;  2HP3 A; 
#chains in the Genus database with same CATH homology
 1W42 A;  2KTV A;  3CC2 F;  5HY4 A;  3RA6 A;  3LFO A;  1QVG F;  5FJ4 C;  2OTJ F;  1YHQ F;  2CZW A;  3V3T A;  4BY9 D;  4EI9 A;  5DCV A;  1DT9 A;  3E20 B;  1GO0 A;  3CCE F;  1KD1 H;  1Q82 H;  3CPW F;  3O85 A;  2HVY D;  3I56 F;  1K73 H;  1X7O A;  4BVS A;  4LCK A;  3OW2 F;  4C4W C;  3NVI B;  1XBI A;  2I6D A;  1QVF F;  2OTL F;  1VQM F;  1CN7 A;  3G71 F;  5HXZ A;  1YJN F;  1W2B F;  3LWV C;  4NUT A;  1VQ4 F;  1T0K B;  3OBY A;  3J7A R;  3CCM F;  3CCL F;  3CMA F;  3PAF A;  3CCJ F;  1Q81 H;  3E1Y A;  1JJ2 F;  2JNB A;  5A2Q M;  2GLZ A;  1X7P A;  2WAL A;  3JCM M;  1RA4 A;  1VQP F;  4BVR A;  3CCR F;  1KC8 H;  5G4V C;  2AIF A;  5GAP K;  4EI8 A;  2FGY A;  1YIT F;  1VQK F;  5HY0 A;  2FC3 A;  1K9M H;  3CC4 F;  1CK2 A;  3CCV F;  1VQO F;  3AGK A;  4X3M A;  3NVK E;  4BW0 B;  3HAX D;  3NK7 A;  3G6E F;  3JAM M;  5GIP C;  1VQ6 F;  3SIV A;  3CPQ A;  1VQL F;  1YI2 F;  3WXM B;  1W40 A;  3J80 M;  1VQ5 F;  1ZWZ A;  3PLA C;  2ALE A;  3VI6 A;  1YIJ F;  3CG6 A;  1X52 A;  3LWQ C;  3N4Y A;  3J81 M;  1SDS A;  5GAN K;  1KQS F;  3GYQ A;  3SIU A;  3ON1 A;  2QA4 F;  5HY2 A;  1Q86 H;  1VQ7 F;  1W3E X;  3OBW A;  1GO1 A;  2QEX F;  5G4U C;  2OZB A;  5IT9 M;  3RA5 A;  5EWR A;  3HJW C;  5GIO C;  5HY1 A;  1N8R H;  3N4Z A;  4NQ3 A;  3V7E A;  3V7Q A;  1YJ9 F;  1IPA A;  1E7K A;  2LBX A;  1H7M A;  3CCQ F;  3IR9 A;  1W41 A;  3CME F;  1M1K H;  2LBW A;  2OHW A;  1VQ9 F;  2KG4 A;  2BO1 A;  3LWO C;  1VQN F;  1K8A H;  3CXC F;  3I55 F;  4X3L A;  3G4S F;  1NMU B;  4TZZ A;  5GIN C;  1YJW F;  3NMU C;  3CD6 F;  2KTU A;  4XCQ A;  1Q7Y H;  1NJI H;  3CCS F;  3VMF B;  1GZ0 A;  1RLG A;  2F9Z C;  1PXW A;  2QI2 A;  3LWP C;  3D00 A;  3NK6 A;  5HWE A;  2VGN A;  3CCU F;  3MCA B;  4BVQ A;  4BVT A;  4EI7 A;  5HXU A;  3CC7 F;  1S72 F;  2VGM A;  1VQ8 F;  5EO3 A;  3LWR C;  5FLX M;  3FFM A;  1M90 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...