3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
3JATB 1Z5VA 5J2UA 3JASB 4O2BB 3M8KA 3JARA 4ZOLA 4X1KA 2Q1YA 4DRXB 3JARB 4DXDA 5JH7B 4O2BA 4EB6B 4YJ3A 5C8YA 5EIBC 5J2UB 2BTQA 5JCOA 4TV8A 5LYJB 5EIBD 2RHOA 4O4HA 3UT5B 4M8IA 4I50B 5CA1A 4FFBB 1TUBA 5BMVA 4EI8A 5LA6A 3N2GA 5KX5A 3WGMA 3HKBA 5LXTB 4O2AB 3RYIA 5KX5B 5EYPA 1W5EA 4F6RB 5CA1B 5IJ0A 1JFFB 3E22B 4KWEA 5LP6C 4WBNB 4HNAA 5FNVB 3HKDB 4O4IB 3V3TA 4ZI7A 2BTQB 5GONB 4X1KB 4DRXA 5GONA 1W5BA 5LOVA 4U3JA 4U39A 4ZI7B 3VO9A 3RYHB 3HKDA 4O4IA 4O4JB 3WGNA 4HNAB 5FNVA 4O4LB 2Q1XA 1FFXA 4LNUB 4TV9A 5M7EA 5IJ0B 4IIJA 1W581 5IJ9A 5EYPB 5JVDB 3HKBB 3JAKA 1W5AA 3N2GB 5KMGB 1TUBB 5CA0A 4I50A 3ZIDA 4X1YA 5MN5A 1OFUA 4O4HB 1TVKA 4TUYA 3UT5A 2RHLA 3VOAA 4TUYB 2VXYA 4IHJB 5LP6B 4X1YB 3R4VA 1RQ2A 5IYZA 4XCQA 2R6R1 3C8LA 4B46A 4EB6A 5JH7A 2BTOA 4ZOLB 3JALA 4EI9A 4YJ2B 3JASA 4ZHQB 2RHJA 4I55A 3VOBA 1W5FA 3WGLA 4I55B 2RHHA 2VAPA 3RYHA 1FSZA 4U3JB 3VPAA 3JALB 2GVIA 1W59A 5JCOC 5J2TA 1SA0B 3HKCA 3N2KB 5IYZB 2VAMA 4IHJA 5EZYA 3JAWA 1TVKB 3JAWB 1JFFA 3E22A 4I4TA 4F6RA 2XKAA 5ITZA 4O2AA 3RYIB 5JVDA 5KMGA 4X1IA 5CB4B 5MN6A 4FFBA 4IIJB 4TV9B 3ZBPA 1Z5WA 4X20B 2XKBA 3RYCA 3WGJA 3HKEA 4EI7A 4TV8B 4O4JA 3HKEB 3RYCB 4X20A 3RB8A 4YJ3B 5C8YB 1RLUA 5LOVB 4ZHQA 1RQ7A 4YJ2A 3CB2A 4X1IB 5CB4A 3VO8A 5ITZB 3JATA 4I4TB 5LP6A 5MN4A 4WBNA 3ZBQA 3RYFB 4E6EA 2R751 5EZYB 2VAWA 5CA0B 3N2KA 1SA0A 3HKCB 5JQGB 5J2TB 3JAKB 5LXTA 5LA6B 5JQGA 5IJ9B 5BMVB 3M89A 3WGKA 4B45A 1FFXB 4LNUA 3RYFA 4O4LA 5LYJA
chains in the Genus database with same CATH superfamily
4UULA 4B2PA 2V58A 4ZVVA 3ST7A 1MG0A 1QOQB 5BUSA 3LRPA 1JHOA 3GUZA 4JP8A 1CQIB 1FBTA 4E15A 2C07A 4AZ3B 4RKRA 4RCVA 1E92A 5IF3A 1EFDN 1Q8RA 3Q0TA 4S0XA 1TUGA 3PC4A 1EYZA 4ZYVA 3UJCA 4UPVA 3KR9A 1LDNA 3PKJA 2NO0A 4GQIA 5FPQA 2QU8A 4P92A 2FGKA 2FSFA 4WXHA 2XT6A 3GPIA 2G5TA 3MYRA 1Q91A 3HJGA 4F45A 5B58C 5TQJA 3DHEA 2A9PA 5AI4A 2RGUA 3L92A 1M74A 4FLEA 4M37A 1BQEA 4MQ4A 2WIFA 4NOKA 2FEWB 2FFRA 4MUGA 3BFJA 1N32B 4EB0A 2F48A 2X7JA 5EHNA 3SNHA 1MFZA 2OYRA 5I9LA 1JEOA 3ZTYA 1ZR4A 1UODA 3HC7A 1SKUA 5I7HA 3L1IA 5AT1A 4MW5A 4MVJG 2I7VA 3H17A 3V42A 3CX6A 2ERXA 3TRKA 4DLYA 2QZ9A 4O33A 4CR7A 3FKQA 3OZEA 4O5OA 4ND6A 2OSVA 3UMCA 4R9UC 1Y1QA 3HCPA 2P4UA 3LGXA 1DKQA 4QTZA 4YTEA 4KO1S 3WGUA 4BO6A 3KTOA 3VR0A 3EHEA 4DTIA 3BIOA 2D8AA 2L42A 1TQ2A 3TRDA 5CB8A 3TYXA 3WZMA 1Z07A 4LAFA 4MRNA 2PU7A 1OFUA 3MINA 5E3JA 5K3CA 1GU7A 3RUHA 4X41A 1FRVA 1HYBA 3M3DA 4TZZA 1DWUA 2II6A 1IBLB 3R0PA 1E7QA 4P31A 4J7UA 3H9EO 3F96A 2I7XA 4KFSA 3SZ3A 3UJBA 1T1JA 2NV0A 4OXRA 1L7RA 3EIQA 3PICA 4JI3B 3CTMA 5ICSA 2RBGA 3WKBA 2YMQA 4GGOA 3KJQA 5A03A 4LVUA 1GDDA 4Q93A 5JDCA 1JU4A 1TCCA 3A6LA 3IP9A 3WL5A 2YWRA 1O95A 4IDOA 3V97A 4OKNA 4MNTA 4QDZA 2LCAA 5DI3B 2WVHA 2XF8A 4MUJA 4A26A 2ZRIA 3TZQA 2YWJA 2C88A 3PG5A 2FWBA 3KEGA 3DOJA 3CZAA 1MA3A 5JI3E 2QPTA 2KPOA 1TVKB 1BNCA 2IOFK 3UCXA 3E22A 1PGQA 4C89A 4N5LA 1L4UA 2WTAA 3F67A 1TTPB 1M2VA 1S0UA 4K9KA 3FCOA 1Z0IA 3KSDO 5F1PA 3I64A 5DFAA 1PW5A 1ZEJA 5I9SA 1XCMA 4BFVA 1KJZA 4OI0A 4NCNA 1Z37A 1U8UA 3GHZA 3K2IA 4H9GA 1A88A 4QECA 5IVKA 4P98A 2Q45A 1PEAA 2EBFX 1C9JA 1VL6A 4KYTA 1T4MA 2FFHA 4Z9XA 2LNDA 3ACDA 5KNDH 1TFRA 5EKDA 1JEJA 1XQVA 4QREA 2ASVA 5A4IS 5CFZA 5GV8A 5JJBA 4P0QB 1QAHA 4IDNA 2QUKA 4LGMA 1RU3A 4NMLA 2XUJA 2PR7A 1PKEA 1DMRA 3JD3A 2OFFA 3ZV5A 1T8WA 2WINI 3VQTA 1KK3A 1FX0A 4UE2A 1YE8A 4WGFA 4DLAA 1Z3CA 5BSHA 2X4GA 2ZTMA 5AVXA 3QUWA 3LSTA 5F9FA 1NN5A 4FX2A 4J1SA 4CTOA 1BG6A 5KEIA 2P35A 4RJTA 621PA 1NOKA 1GLGA 1YJ8A 3QE9Y 2BKAA 4B3BA 5IZ4A 4QDTA 2OAP1 3EYAA 1IOVA 2ZJ5A 4AJ4A 3L8EA 3H6KA 1E62A 3KTFA 4JLUA 2G07A 3GUVA 3E9YA 4PPGA 1I6WA 3IUBA 3H5RA 3UGQA 4ER6A 1NN0A 3RF7A 2P2CA 4Z9AA 4YAUA 3CR7A 1C3VA 1L4MA 1X14A 4P3PA 2OQVA 4D7AA 4G4SP 1W5EA 3VU9A 1G8SA 1VPDA 2AF3C 3WLMA 4U00A 3UHPA 3L6OO 4B3FX 1GG5A 3NT2A 5HF5A 2A6PA 2ZI9A 4JOQA 4QGBA 5G4LA 1YRQA 3PDHA 5A3SA 3HE3A 1SPBS 3RWBA 4DUGD 4B0PA 3CBGA 3GFQA 3GJ0A 5C1OA 1EWVA 2QRPA 3QVLA 5JW6A 4QRDA 2P9JA 1PBNA 5H68A 1G9SA 2G0AA 3JYHA 1PS9A 3ZK8A 5M7EA 2GM3A 2X9NA 1H4SA 4ENWA 4FX5A 2UYNB 2VK8A 2IIQA 5CEJA 4FBLA 3HKBB 1JR4A 5DLEA 4E3WA 1MB4A 1J2YA 3C1UA 1H0SA 3EF0A 1L9KA 4H0NA 3QI7A 3QXHA 4R6WA 2YXEA 4U2BA 3G8DA 3NWBA 2VXYA 1CDEA 1UM9A 4JLVA 5U1PA 4IEIA 3D3WA 4ZCMA 1P0FA 1OLUA 2VYNA 3DKRA 4Y9RA 5D3MB 4ZVSA 3T9BA 3TFOA 1HY3A 4O0LA 2AI1A 1KTVA 1CSEE 2A67A 2EFDB 2C92A 2HJRA 4QOIA 2PCLA 1II0A 3Q4GA 3GLGA 2OO5A 3ZH2A 3OJEA 1SR8A 4LV6A 4HEHA 4UVDA 5EXEA 3PWSA 2GEKA 2OCKA 1U11A 2V6BA 1LSSA 1ZBDA 2P2ZA 2QL9A 4PFJA 5HZHA 1KQNA 4G89A 4DADA 3K6KA 5D3MA 5LOVF 4FB4A 3CVOA 1ADYA 1DBSA 3UY4A 1IBRA 3LY9A 2Y93A 4LBVA 3BGOS 2GPBA 1RKBA 5F5LA 1KO4A 1F14A 4ZO4A 1E4VA 3WNQA 1D4FA 2AKYA 1HWYA 1R8XA 4CTMA 4QZVA 2ZVPX 5I6DA 3WPXA 1SXJE 3TB4A 4BOYA 1QO7A 4HLCA 2IUYA 4TV8B 1AV6A 3ROXA 1D6SA 5A9SB 1MO5A 3A3OA 4Q1VA 4TTAA 2JGMA 4XLLA 2OILA 5DMXA 1DV2A 1YA4A 4FYMA 5HM8A 4GKKB 3WV4A 4JVMA 1UPTA 1KAOA 3I32A 3GLIA 2B0CA 4UASA 5DN6A 4UREA 3PJRA 1E3MA 1KP2A 3THWB 1OH8A 3KVNA 4NSNA 1V16A 1PDWA 2ON6A 1XLWA 5IDYA 5TC4A 3TUZC 2HS0A 1PHPA 4RENA 2FK8A 2XDQB 5KAPA 3Q87B 2O3QA 1HDOA 3UN1A 4MPDA 1KI4A 2WF5A 1GQOA 2EBWA 2FN4A 1JLKA 2P11A 3RGWS 2JGLA 1TKAA 2ZJ7A 1JE0A 3GZ4A 3L1HA 3UO8B 4ME6A 3J7TA 2GKOA 2Y1CA 4UE3S 4TZKA 3W6ZA 3QWIA 2D7JA 3ROMA 3N5CA 2JATA 3ASYA 1S2LA 2WTEA 3Q8WA 1FRZA 3PQDA 3QFSA 1T3TA 2GEJA 4Q47A 5I45A 5KZMB 4QOHA 1A50B 1CUVA 2GCIA 4MW0A 3K6SB 1TU0A 4Q5IA 3RUIA 2D13A 1CVRA 1RA4A 1EDEA 3B9RA 1GL7A 3W79A 1U3FA 1YR2A 4U9HS 2FSVA 5K51A 1UINA 1J2RA 2Z2JA 1Z7YA 3T1QA 1VXOA 4BTVA 4YBRA 5COAA 5KNDD 3WNBA 1VOTA 1NM5C 2POCA 1EUDB 1XRPA 4B7AA 1GAXA 3LCVB 4RTNA 1F06A 1L6RA 3OEHD 3H5TA 4U02A 3W5HA 4NEGA 5TB5A 1CZNA 2AJDA 1IHPA 1L5FA 3H9GA 2REOA 2BGMA 2ZI7A 3F1LA 4KV9A 3RD5A 3LYHA 4DSTA 4RTLA 1OTXA 1A2BA 1RYDA 3AEUA 4NJEB 1QWSA 3NTUA 1NBHA 3RBVA 1UBTS 1QR6A 2PWBA 3DP7A 1RXUA 3RIXA 4G8JA 4BVJA 1SWWA 2F1HA 1JHZA 4EYOA 1ADGA 2C82A 3UWPA 4XA8A 3UPTA 4JJEA 2XBUA 3KOMA 3MNFA 1TMKA 1R5JA 2JAPA 1KDYA 4B5KA 4JB3A 3CQ9A 3SJ7A 4YP0A 5FTJA 1H2BA 3IAM1 2JLZA 4F84A 3T52A 2IHJA 2AF4C 3KQWA 3W90A 2IUSA 3I5YA 1QNLA 4HJRA 2CL7X 5DCUA 4L4ZA 4Y6RA 5IHPA 4KZPA 5IYZA 1WULS 1KNKA 1NMXA 2ZIEA 4UNSA 1CIJA 1R8YA 1PSWA 5KYNA 3BMOB 2BFWA 2AE1A 2PD6A 1T34A 4OQQA 4RA6B 3TAXA 3UCFA 4CLEA 2AFHA 1VPVA 5IMSA 3C1AA 3DF7A 2C9MA 4F4FA 3MJEA 2IZ7A 3NEAA 2GZAA 1NFQA 3B1XA 4FZVA 2QW1A 4HRVA 4JWKA 4QXAA 3T5CA 3LIPA 4LWPA 2JS7A 2GVIA 2B8TA 1W59A 4QNRA 4O1IA 1RT9A 2A5JA 4YUVA 2Z6UA 1JHUA 4WBNF 2IHBA 1P7VA 1P62B 3QTLA 3T5GA 4WFKA 4DAEA 3ZVNA 4XD7D 1IMJA 2A9VA 3WKEA 4X5OA 3VR3A 5JYEA 3T1YB 2PJUA 1C3OB 4YPOA 4JR1A 1YIJF 2JLVA 1QLJA 1SG6A 1SC1A 1XOIA 1R18A 2WJIA 2XADA 3E03A 1JXAA 1R6VA 4ZCSA 4FDLA 1ODIA 1CNEA 5IU6A 1QP8A 5DNAA 2PGLA 4RVCA 4DAOA 2ZSDA 3MFYA 2H8CA 1KA9H 1M6YA 5ICCA 2OXCA 4WOCA 2VUUA 3AR9A 1DDIA 3ILSA 4FHGA 5EQTA 5BRJA 3HXTA 3ZU6A 2DQKA 4EUSA 5EINA 2P0EA 3CNQS 1OX6A 3E58A 5DEIA 1IPHA 1KPHA 4DC1A 4RAOA 1W87A 4OGFA 2IUFA 2YIJA 4MGIR 3C7KA 1ULTA 1GR0A 1TYBE 1ZD2P 1A77A 4QWWA 5LB2A 5P21A 5DMHA 4TTRA 1LK5A 4ALLA 4DG5A 2BGUA 4A0RA 3W5AA 1FX0B 3GJ3A 1E94E 4OJNA 5AVWA 1EAYA 4YUXA 2DPGA 1JVBA 1D4AA 1WO8A 4MH0R 5J43A 1SVOA 4LYYA 3VJRA 1U6IA 5KVSA 1I7PA 1Q21A 3JQ6A 2ZJ6A 3DT9A 1HMPA 1UH5A 1F0KA 2H06A 5EPEA 1P31A 1W88B 1UBFA 2C77A 2HU7A 2UUOA 1S3SA 3EMBA 1DIHA 3MTBA 4HD8A 3C8UA 1NF2A 1OW3B 4UTRA 5JAPA 3F3YA 1E1RA 3GRAA 4BBAA 1XXHB 2VHTA 1K0FA 1BGVA 3L4EA 3V4FA 1E64A 2H4WA 1JKFA 1Y37A 3MINB 3OKCA 2BFDB 4PX5A 1N2CE 3HJNA 5FPSA 2ET6A 2ZS9A 3QMWA 3KJHA 2IUUA 3DOCA 2GNAA 5E9QA 2B6HA 1JG3A 2FUG6 3S1AA 4OJYA 1YI8A 4J4BA 4EW1A 3V3TA 1ZSYA 1EXVA 2AC2A 2P4SA 2QD3A 2WMDA 2VFAA 1INLA 3K4PA 4P36A 4N5MA 3AR7A 2P3OA 5I9MA 2WSYB 1ISRA 5NULA 3ZHRA 4CI0B 1JDNA 4B79A 1DMSA 4D3ZA 1FXUA 2FTKE 2XUPA 4MYTA 5IDVA 4CMAA 3ELYA 2VZEA 4NAHA 1M6VA 3H7IA 3GW8A 2ZVQX 5LKAA 1YRWA 4K9LA 3DHWC 2CZGA 4FNOA 1S4MA 3DBRB 1VG9B 4CQMB 1RI2A 3UOWA 2JKYA 1X7OA 1DC3A 1SUSA 3D0KA 3G9UA 3JYQA 1KFKB 3OJOA 3BK2A 4GR4A 1RQ2A 1VHWA 3H6GA 3U4AA 1UQTA 4B46A 1BGXT 1XROA 1DZ3A 1YQUA 2QZSA 1TIBA 3ASUA 3GFBA 6AT1A 8GPBA 3ANTA 4XWOA 4E2FA 5B5SA 3C6KA 2RHJA 2UZHA 4MQEB 3K5PA 2FMFA 3DYBA 1G0OA 4GLLA 3I9V1 2YQZA 1EU1A 1LQ2A 5DK4A 1SOVA 4WCFA 2WUVA 5LDDC 3ZGZA 4K9PA 4LQLA 4QTTB 1VCMA 4L7QA 3CUKA 5DNWA 2HKIA 4BVQA 2W6NA 3BKWA 4WXRA 1JI3A 1NSFA 2HP0B 2VOJA 3I23A 1XNJA 3HMQA 3TRHA 5F21A 5B3AA 1QC5B 3WKCA 4R3WA 1L7OA 2B7CA 5JCJA 2W2VA 5A5GA 1GNRA 4UMDA 5JVDA 3E27A 4HZIA 4MKFA 3QM1A 4JK3A 4QFDA 4X6YA 2ID9A 2G7ZA 3MMPA 3ZXUB 1WD7A 4ZK6A 4GXRA 1GITA 1QXSA 1YA6A 3I6YA 3CGWA 5DV9A 3JWHA 4KSCA 4QM6A 1CT9A 2GD0A 1PL7A 3EQ7A 3SK0A 4CG1A 5CB4F 3ZOKA 1H6AA 1ISPA 3MUFA 5FUBA 1QFSA 3AVWA 4MV1A 2Q5JA 3CB2A 4QUJA 1NHWA 4EKDA 1X1EA 3U3DA 3IC5A 1KDVA 3RREA 1C7RA 2O0KA 5JCJD 3GZJA 3HWRA 2POQX 4DW8A 1EXDA 3UW1A 1GVNB 1PZFA 1XTSA 4H4EA 5BNWA 1J2UA 1MR3F 1GCUA 2ZWOA 4FUTA 2Y6VA 4ZOEA 3KR2A 1WBBA 3EQZA 1JT9A 1XTZA 5A06A 2V7QD 3P9KA 5K0JA 3N2LA 2A57A 3ZD8A 4E13A 2IWRA 4S1OA 4J29A 1QP0A 4FQ5A 3R7AA 4GUAA 1HG0A 4M7OA 2D2XA 2CLLB 4B9EA 3S81A 2PUFA 1VP9A 1ECBA 4ZRMA 5JYDA 3DNPA 4J16A 1NV8A 1T0PA 3C4VA 1K5PA 4GBED 3UK1A 1KNJA 1IG3A 1RXYA 5EWJB 4CKEA 2HXSA 4YCNA 4KN6A 1IBMB 2ZRHA 2OM6A 2B4AA 4FFVA 4B2LA 1PG2A 4F9FA 1VBKA 3CVVA 4YT2A 4KK3A 2CCKA 2OCDA 4FMDB 3SC2B 3OP1A 3MEQA 3E7WA 1W2WB 4HN2A 4QPDA 5FWNA 1F0YA 5HKKD 1RC1A 3OCXA 3AVQA 3BE5A 2GBLA 1W0CA 3HZRA 3QWHA 4Q7JB 3SQMA 1T2DA 1XP8A 3FX2A 4A6PA 4IRUB 2FB9A 1I51A 4MRMB 2DAPA 4W1RA 1Q16A 4YQZA 1RVV1 2H3EA 1N5JA 3S2YA 4QARA 4QAJA 5GONA 2HQBA 2NOAA 3UJAA 2O8FA 3BH7A 4XRGA 2PKQP 3BSWA 2F8LA 1XQ6A 2Z57A 5LQRA 4DOMA 2R79A 2A1UA 5EQDA 2CXNA 1M7BA 1VE9A 2ZDGA 3FOAA 3AUUA 4YGXB 5AICA 3TAUA 1JTFA 2GN1A 3IS3A 5CX1A 1WMEA 2CW5A 1J2JA 1O1YA 3IHWA 4YI5A 3CIOA 4GPBA 1MRNA 4OOEA 3FMPB 2AQ8A 1VMAA 2ZRNA 4MVYA 1MABB 1T5OA 4MRAA 4EGCB 1QHFA 3KJIA 4M46A 2UYCA 1I4LD 2B9EA 1T6YA 1WX1A 1VP3A 1ETHA 2J3DA 1KO8A 1MA0A 1R0BA 5EI5A 1QZUA 4CL0A 4DDHA 4ZGWA 3CUSA 2YINC 3C1OA 1MENA 4AJEA 5A3VA 3EIHA 1IZ7A 4AM8A 3ETCA 2CNOA 3KJNA 2QP3A 4R2JA 2BGLA 3GH3A 3QU5A 5CPFA 5HUJA 2F4VB 3TINA 4C0XA 1L8OA 4PRLA 4H3KB 2V55B 4ZAXA 2HMYB 4LOHA 1K6MA 4OHFA 1KR2A 4R84A 5HMLA 3WQBA 4CTNA 4CMEA 1USVA 3G5MA 3HFGA 2QL6A 4UBMA 3S2SA 3L1KA 2C0QA 3A1CA 2WPDD 4BZQA 1WOYA 1QLWA 1K08A 1TQ4A 1W6UA 3ANXA 3B3JA 5EAIA 4AICA 4E4RA 1Q11A 1IEXA 1NLUA 1FUEA 4X7BA 2O20A 4J0JA 1ZSVA 2R7AA 3JTEA 4G4WA 1M67A 1YI1A 2O57A 1U1GA 3CLVA 3K5WA 4OBEA 3O1LA 2E4XA 1D0IA 1UM8A 2GQ0A 4UJ3A 3VU3A 4ENVA 3QSYA 3ZCXA 1V96A 2H1LA 3Q5GA 1G5QA 4EARA 5K0CA 4H7IA 5FOSA 3QXJA 3Q1LA 2XB6A 3VI6A 1N0VC 3IEIA 3LSYA 1K5GA 3NP7A 4IUYA 1XF1A 4LCBA 4MVXA 4H7FA 4NYMQ 3X2FA 3OZGA 5IK2D 3DMYA 1XPJA 2OHFA 3BC1A 2NVOA 3TTYA 3PC6A 3C3JA 4OYRA 4X00A 1RHRA 4G88A 1VSBA 3UKOA 1MRSA 5K4GA 2ZR0A 3NEJA 1P2DA 4LE2A 1GO0A 5DYNA 5JRDS 2HHAA 2PLRA 4XAQA 2R97A 3LI2A 1NONA 3OFJA 2AFHE 4GWKA 4JDUA 3TDMA 1TLTA 3AJ9A 4KDEA 2WA1A 4M1QA 4O2BB 1L4EA 4PZAA 3KHNA 3WYFA 3ZW7A 2CN1A 2BGJA 2V0GA 1OSNA 1A82A 1ZA2A 3CC2F 5BY2A 3Q3CA 2A4KA 2J3HA 4JY7A 4UUQA 2W11A 1MX1A 3OQ1A 4KXWA 2NLOA 2V6FA 3B5EA 3AIKA 4YCDA 3SVTA 1XPRA 4JYAB 1JPVA 5CA1A 2W8BA 5K09A 4REQA 4A8JB 2JRCA 5ALMA 1O87A 1DBRA 1HA3A 1IPAA 1SCJA 4QBHA 1M2OB 3WLSA 3V7EA 1OPRA 2YUIA 1CYEA 3FG9A 4OBBA 4NU6A 3T4XA 521PA 4R9SA 4LDAA 3N2ZB 3RROA 3A9VA 5JFOA 3D1VA 4X6LA 4KR2A 1FDRA 3TLGA 5FRDA 4FK8A 3RSQA 4BXOA 4JJ4A 1MAUA 3GB9A 2UUCB 1UC4B 1ECFA 3DAFA 2ZT6A 2IC5A 5I4KA 1WLYA 1VHDA 3CNNA 5EXXA 5EHXA 2F9ZC 3QIAA 1RJFA 2EFGA 3AUXA 5HS4A 3KQVA 3W6OA 1ESMA 4NBWA 4B3XA 5JJCA 3P2MA 1XMQB 4NABA 1ZJ6A 2E21A 3BULA 1U1CA 4NS1A 3WYBA 1ZK4A 2K4MA 1QRRA 1H7MA 3DVRX 2FMHA 1FY2A 2YWBA 4OHRA 2ATXA 4UTNA 1PQYA 1RZVA 2FN9A 3OI7A 4GC5A 1I4EB 3A4IA 3TOSA 2IE8A 2H1WA 1NUSA 3C8LA 3O4VA 1J2EA 2ZM6B 2F17A 4D45A 1WG8A 3PXUA 1QYVA 1E2IA 3JQDA 4WFJA 1Y6ZA 3IT1A 3X1YA 1HYEA 4NKRA 5J4YA 2WQ7A 3G5AA 2IS4A 3IKMB 2HSEA 4JSTA 1O6FA 3LW7A 1N1MA 1SHTX 4J0DA 5E9JA 5IBRA 3WO0A 5C81A 1XNRB 3PGKA 4INZA 3WZLA 3T9EA 5TGZA 4DEYA 3C1TA 2I62A 1AGNA 4LYGA 3S7ZA 4N76A 1XL1A 1HDGO 1NXSA 1H94A 4IOMA 4X8LA 2X7HA 4FGLA 3NUGA 5JZSA 3K0AB 2QTLA 4JP1A 4OYLA 3LX4A 4M8NE 3UK0A 1Y89A 1BMTA 3GBPA 5E6RB 5E7MA 4A2CA 1JAZA 3W5JA 4M49A 4JKIA 3RANA 4JX8A 2WYVA 5IC6A 2IS6A 1EHYA 3HWX1 1JHYA 2W2TA 1Z5WA 1JPUA 1JQAA 1WQ3A 4RFSB 4RQUA 4TLDA 4U7TB 3HN6A 1YS6A 4ZT5A 3TRJA 3GARA 1WEHA 3MTEA 3IEVA 5FI0B 1HFEL 1VI5A 2CWDA 4MGEA 5I8WA 3IHTA 2GPYA 1JQDA 3OIDA 2XMPA 4P3KA 4YREA 1MOQA 2YWDA 3LOUA 1O2DA 5HIMA 2CXQA 4BMSA 3KZMA 3CCUF 1TC2A 2YHBA 3JY6A 1BDJA 1U0TA 3K9HA 1T5LA 3O91A 1DIRA 4JITA 4YBZA 3A70A 1NX9A 2I87A 1CS4C 1KAMA 4F72A 2H7YA 1JNXX 2G36A 3UGTA 5WRFA 2G9IA 4LOIA 3MMNA 1FFXB 4EA6A 3O9MA 4RK0A 2HPVA 2PGIA 4IDEA 3IUPA 4J76A 3KOOA 3T0GA 3HP7A 1NLFA 1TQHA 4L4SA 2Q2QA 2R60A 2WW8A 3GRYA 3TVYA 4G2NA 3SVZA 2FPSA 2I7TA 1EP1B 1E7SA 1FS6A 2EDCA 3MD9A 1L6IA 4MQLA 1HSOA 3OO1A 2HY7A 2E89A 3T5BA 3BH6A 3V2HA 3WIUA 4Z7QB 5JMWA 2PZLA 2RC5A 2Q62A 3DAYA 3VOTA 2NIPA 1EWQA 4XWAA 4EF6A 3GX1A 2X5KO 2UVDA 2X8AA 2R6AA 3LU1A 3PDWA 1H3EA 1D0VA 1J8QA 2F3PA 3CWZA 4HGOA 4K9DA 1UZAA 4KQJA 5JSYA 2K87A 3ACCA 1Y4ZA 4YAOA 2XB8A 3OJCA 5LP6C 4MI9A 3GEBA 2H8EA 4ITUA 4OJMX 4QEKA 3JWGA 4RPHA 5D5PA 3RUFA 3U48A 4EKIA 3VNVA 4BFYA 2F43B 4URZR 3UJ3X 1YONA 3CEHA 3COYA 2BSXA 2FWMX 5K1ZA 4BV9A 4WUVA 2VAXA 2RGNC 4RHCA 4P22A 3OOSA 3NNDA 3O84A 1IN1A 5DM2A 1H66A 3A4LA 1JMKC 3O2QB 4HO1X 1WB6A 1Q81H 3A04A 3H4MA 3K14A 3X1KA 1PR4A 4IXWA 3KBOA 4QSHA 2H11A 2ZBFA 5KOYA 2R9VA 3FGNA 1WDLA 3VU9B 9GPBA 3PC8A 1OV4A 4G0UA 1PBTA 1AKMA 3L9XA 4KEAA 4Y2GA 3TLCA 4TKUB 1NSTA 1ECJA 3OX1A 4BX9A 1G9XA 3EEQA 4YAEA 3SLKA 1EI9A 2JAUA 1AG9A 3PRJA 3VHXA 1R4NB 2JVJA 1UT5A 4IMIB 4M8SA 3URMA 4LXUA 1FP4B 1ZYUA 2CB9A 4LJ4A 5G02A 1IMOA 4Q3OA 5JFGA 4E6PA 1M76A 3QXXA 4NRDA 4BMOB 3OPQA 3RQSA 5AR1A 4TTVA 3FOBA 3RQIA 2DHRA 2WHRA 3O8RA 2RGYA 2FQWA 3F6EX 2O2IA 2ZYAA 1CZLA 1GNQA 2HUNA 3D81A 2ZRJA 1ULUA 1DX9A 1OT5A 1MJHA 2I71A 2J67A 3O8OA 3K6JA 3QKWA 4L27A 5K6AA 4QL3A 4RHYA 2WSIA 2V7PA 3P19A 2XMBA 2PMEA 3VZSA 2HSJA 3BRQA 2NZUG 4BDTA 5L4SA 4RV4A 3PQ7A 2PH1A 5L8VA 1U28C 2WG0A 3AWIA 1LI4A 1FU7A 1MC4A 2XVAA 4WCDA 3S8YA 4B87A 7REQA 3OAAA 4ZCLA 4N3AA 4WZBE 1U63A 3F0GA 1J9GA 3PFIA 4K0RA 2G88A 5D6NA 3IULA 2C84A 2G6BA 5BWOA 1O08A 3JW8A 1NVAA 3ND6A 2P6RA 3DTNA 1NVFA 2Q4TA 3EXHC 1B16A 2C3OA 3ORFA 3QU7A 2X6QA 1ZKMA 2WILA 4ETMA 3KFVA 3O5AA 2V9YA 1XRRA 3EASA 3F0DA 1XC7A 5LBUA 1CP3A 4CPDA 1RHQA 1ISIA 1OXTA 2QORA 1J00A 5FV7A 5KOIA 1T6XA 4XTRA 2RH8A 1XZMA 1TO1E 1D6MA 1P61B 3QQ5A 4MQFA 1PWXA 4PZZA 4DR7B 1NVMB 4ZJUA 1T5SA 5BNZA 1NPTO 5I4CA 4XYGA 1BN6A 2G5GX 2WM2A 3PT9A 5JS2A 4L4UA 3STHA 3BK1A 3D6TB 2CFCA 3O9ZA 4R40B 2VDWB 1NRIA 3AM1A 4I46A 1T4CA 2LCQA 4R68A 1GNVA 1PP4A 1W48A 3G0BA 1TE2A 1JKJA 4O2BF 1F8FA 2Z2KA 5T57A 5IZCA 3DBIA 1QGAA 1NFRA 4P4NA 4CG3A 5ADWA 4MV0A 4HBGA 4Z5XA 1UKEA 2P6OA 3CVJA 1G38A 4RL4A 4N8EA 5KX5A 2H0QA 3IALA 1SIWA 1ZIPA 3LUFA 4EMBA 4EZEA 3TUJC 5KJFA 4OXIA 4CI9A 2RE8A 2FPIA 1TMOA 3IERA 1ZPDA 3IJPA 4QBIA 2H85A 2QLBA 3CU5A 4HLUA 1U2GC 2O14A 1DKRA 1XAGA 3HUUA 3IKFA 3DS8A 4G1CA 2X0EA 3WIEA 3BD8A 1C3JA 5ALYA 1J9ZA 4WFIA 1AD2A 1A8PA 1L5OA 1X7GA 2ZWPA 3VH3A 3VDRA 3P2IA 5HTKA 4C07A 4QDKA 1BKYA 4PSUA 5DHUA 5I7FA 4OB8A 1FFYA 3I04M 4O4JB 2YC2C 5C9ZA 5M34A 3DO8A 1EFCA 3KTAB 5TDHA 1U8XX 3CG4A 4Q1EA 4ZXPA 4ZYYA 4XWWA 4PZPA 2GXAA 1QG6A 2Z1FA 2AJTA 2G6TA 2V45A 4P7KA 3EH2A 3U7QB 4PQGA 2GPJA 3N2GB 1R6TA 2F1RA 1H8EA 4INAA 2O5RA 3PEEA 2JCXA 4FIDA 4MVJI 1QORA 5MN5A 1XB2A 1YA8A 2Y1OA 3JQAD 4HAYA 4MVJD 4WI1A 4LE0A 2G8NA 5NLLA 3T41A 3WHLA 4ZDIA 3FDIA 2ONKA 3DDNA 4DBVO 1XRLA 3TECE 1C2TA 1MO4A 1P5RA 4EY8A 1QTQA 4M7RA 1CHDA 1E4OA 4WN3A 3S2ZA 4PSCA 3L8GA 3ZK7A 1E4EB 2ZS8A 3LWNA 3WZ2A 1CRWG 1VHJA 1JHRA 4E2YA 4L51A 2FJPA 4TL9A 1V43A 3H99A 4I55B 2A3NA 2J08A 1G7SA 3M4YA 4AU1A 2X8JB 2L19A 1FBNA 1HUQA 3P52A 1UPAA 4HWRA 4L5IA 5ITVA 3VPDA 4G81A 2PRZA 1CERA 4I2NA 2BT4A 4XGIA 1CUXA 2VSQA 5E4YA 4JC4A 5EJ2A 3T3MB 1D4OA 2WZQA 3IUYA 5I4IA 4KQHA 4LOAA 3ZWCA 1EUDA 4AXXA 1ZVQA 4QE3A 5K0SA 3VR5A 2KLHA 1M2FA 3ZNNA 4RD2A 3TB6A 3QE3A 4CUZA 2J9ZB 3QPAA 3WNCA 3CR8A 4HMPA 2FPXA 1IVYA 4X85A 1OLSA 2IYVA 1Z4JA 3QBJA 3WJPA 1BHJA 3QEMB 1CRPA 1WQ1R 2G04A 4L8WB 1HFJA 3MELA 1TTHA 1MB0A 4J9VA 1NBEA 3F49S 5IJWA 5HA5A 3G8YA 1V7CA 3RJ9A 5CB4A 1VLZA 2XYQA 4LXHA 1NFFA 4AC9A 4NE9A 3RARA 3RC3A 5KYYA 2HREA 3SBOA 2JGRA 3ETGA 4GMGA 4EUFA 3ZCSA 1U81A 2XEXA 4OHUA 3PHBE 1M33A 2EFHB 1QH9A 1QGZA 3LS2A 4OTZA 1T5BA 1GAQA 2Y6UA 3QMMA 1QP7A 3MFQA 1PEYA 4K1LA 4Q05A 3X1JA 3THYA 1PKXA 2P1ZA 4QDUA 4B2YA 3LMEA 3JQPA 4W9NA 2J07A 4XKJA 3NKVA 2XUZA 2PJDA 3K2QA 2WA2A 3ZE9A 5ICEA 2CVOA 4MDFA 1JSLA 5J2UA 1IM2A 3DAGA 1RRMA 2AV6A 1N2ZA 1YJCA 4ZJYA 1O4WA 4C5AA 2JH8A 1JU3A 2GUGA 4YAJA 4AULA 4X6UA 4BT4A 1VPLA 2RHDA 3B9QA 3HL4A 3DR5A 4MV6A 2EW8A 4NMWA 3VJLA 4E1AA 5JS6A 3EEOA 1PV1A 3DQQA 1PNRA 4FLFA 1OILA 4N3NA 1RWVA 1XVLA 2VJPA 4IDCA 1HTTA 4YJKA 2OGZA 2VZ0A 3Q40A 3CF4A 3T06B 1RTKA 3FHTA 2BM0A 1N7HA 1DX4A 1TK9A 2WM3A 3E23A 4ONEA 1X1AA 1NMQA 4IF6A 4MGKR 4ML3A 3ROKA 4AJKA 1MV5A 4DUYB 2G76A 4RHFA 3N05A 3FGPA 1KMHB 3G0CA 4AJ9A 4CMBA 4IY1A 4TKVB 1AUPA 1BA3A 2FXIA 4EGAA 1UMKA 1Q2UA 2VVTA 3W7AA 1RXVA 1EE1A 1VHLA 2IEDA 5CHYA 2SKDA 3SSOA 1Z0FA 1X7YA 4JZKA 5L9AA 2C7GA 3ZW9A 1SZJG 2J9FA 3C9RA 3FPEA 1PL6A 3ZZ0A 3P2OA 3VR6A 1M90H 3OLXA 121PA 2B20A 2HWKA 4ON9A 2VATA 2VNSA 4OU4A 1ACJA 3AJAA 4EHFA 4OK6A 3SF8A 1FP2A 1PQUA 1K9SA 1W36D 2EBUA 3DLAA 2BBOA 1T4BA 1QYRA 2PT6A 2QYSA 2ZWAA 3EIXA 2IXEA 4I6GA 5DNDA 3SXUB 3PX2A 3ZJYA 1KNQA 4EB6A 4HKTA 1JFSA 2G71A 3W5UA 3DBHA 3LP6A 1BHQ1 4DJDC 2DX7A 4YT5A 1RLGA 2O8CB 1P1RA 4S35A 2IDMA 1HDEA 1K68A 3I6IA 1JBEA 2IKSA 4JNKA 2CJYA 3O6VA 2GLTA 1B0ZA 1EX6A 3EODA 3HSYA 3MF4A 1X1SA 4HZUA 1KYZA 2EIXA 3CSDA 5FPHA 4TTIA 1LZKA 1XJQA 1T5TA 1IEQA 3K1JA 3KD3A 5A0VA 3WLEA 2M2IA 1I7QB 3TSOA 1IHDA 3JYLA 1YQEA 1FQKA 1UJ6A 1ZGGA 1JFFA 3F6BX 2CT8A 1DL5A 1LLUA 2P6UA 4PHCA 3VO1A 2JIDA 3VJKA 4X1IA 4GBGA 4BIIA 2VPPA 3BBPA 2FSSA 3PPVA 3OTWA 2CFIA 3L7LA 3KRTA 4HTFB 4ENUA 1JYEA 5DIZA 3EXEA 3GV0A 1GU0A 1Q1QA 2PQ0A 1P3JA 2Q6VA 1O97D 1RPNA 1GTMA 4FEAA 1FLVA 3PNYA 3UK7A 3RADC 2NT3A 4X20A 2WU3A 4KWIA 4RMGA 1TVMA 4ZALA 3RT7A 3UBMA 1UAYA 1YBHA 2PUCA 3PLAE 5JRJA 4I36A 4U2GA 4P5DA 2DPXA 1SUWA 5HJ7A 4CUJA 4NAVA 3D3WB 4ZVOA 5EN4A 5KVQA 4ES6A 1XNQB 4Y9DA 2PMWB 1D5WA 3HEAA 3L3BA 1X87A 5F73A 1W44A 3L0PA 3PFHA 4RF3A 4CQMA 5CFLA 4BN5A 4E2XA 3E7PA 5HFJA 3CHYA 1KY4A 2XB4A 3DNMA 3CLUD 2NNLD 3U31A 4QJ3A 3HK2A 2P5UA 1NRJB 5JCPA 4KL8S 1N2GA 4D96A 5JRZA 1G6HA 2W48A 3KNZA 3UFXA 1A5BB 1E7WA 3JWIA 1WHSB 3KE9A 3P9IA 1A1SA 2CGEA 2WU1A 1FF9A 1VBFA 3JQ8A 1BD3A 4YRRA 3BZBA 1HM5A 2WAOA 1C3XA 3OZAA 4HDAA 1NN1A 5CYFA 1Y5IA 1YVPA 4P58A 5DCWA 2V96A 2PEZA 1GUAA 1CJKC 1YQQA 2ATIA 2Q4RA 5DM70 4JYZA 3A9UA 4ND1A 4KPYA 5CT4A 4V0NA 4IO1A 3V48A 4FM9A 3IIMA 2QP4A 3GBVA 2UVQA 2XQFA 1A5ZA 1T9CA 4Z1OA 1H3FA 5AK5A 4MMZB 4BGDA 2ZFUA 2YFYA 4Q02A 2IPNA 3N86A 4N40A 5AHWA 1WNTA 2P27A 2PGJA 2FNAA 3AOGA 5CCXA 3FHLA 4BLVA 1KZYC 1ZWLA 4IIYA 3TW8A 4H1UA 5A05A 4YO7A 3PC3A 2O1SA 1W3EX 3GCDA 4HQLA 3IOYA 3TNLA 4MICA 1YS9A 5HF6A 3VDXA 3T7CA 1H22A 1PWYE 1FC0A 3GAZA 3NHLA 4UFOA 1V7ZA 1R5NA 1KOFA 4PO3X 4TV9A 2OAEA 4QYTA 3ZZNA 4F91B 1ONPA 2QTHA 4BAZA 3DW1X 4IXMA 1QVGF 3OPMA 1KK0A 1FFBA 2X77A 3KXKA 4KPFC 5BQ5A 4B76A 2DECA 3LXXA 3OE7D 1S2OA 4N8SA 1P73A 3ESAA 4R2WA 3ZDDA 1PEKE 1M1XB 3R7LA 4QXOA 1DFHA 2QL5A 3WAKA 5LQDA 3B52X 4B4WA 2X42A 2R6R1 2YWEA 2O7QA 1KMCA 5KTMA 3M0EA 2IJGX 1AGPA 2OB2A 1VMEA 3G5LA 4OGLA 3ZIAA 5K3AA 3A1TA 2OXRA 2IV7A 5FUXA 3NOXA 5KOJA 1EGQA 2IZ6A 4O1HA 1DO0A 4DPKA 1YJWF 1ORRA 1YBMA 5DHQA 1YASA 4BVAA 4YT4A 5CCBA 3IVMA 1L5LA 2X0FA 1K9VF 1O6BA 1RXCA 2P9YA 3DL4A 4LPSA 3MT8A 4M9UA 2PNJA 2O59A 1O96A 2B0JA 3ZVLA 4C0WA 4YRKA 3K0KA 5DOZA 4L16A 5DLDA 4U1RA 3NBKA 1C30A 3R7DA 2IEBA 1TJYA 4NG4A 3ROEA 5G1OA 4X64B 4C2AA 4C4YA 2W43A 1OQAA 1Z15A 4XJVA 2LDXA 2O5VA 4LSWA 4QPNA 2GD6A 2JFXA 5LLSA 3KM0A 1DKUA 1K97A 2CHFA 1UXIA 1QYIA 1LGYA 3N59A 3V3KA 1J23A 3BMQA 4EI7A 4IVNA 5K45A 5KJ6A 4BQOA 5TEVA 4ZHVA 4NBKA 1R0WA 1GKKA 3RWMB 4II2A 4BGUA 4C6TB 1U8AA 2ZJOA 1Z25A 2XJ9A 3TIIA 5TPZA 1JGTA 2IPMA 5SY9A 2WMYA 4MQUA 4K28A 4KMSA 1IY1A 4AUEA 5EG5A 1ENZA 3AM5A 3FYDA 5L3ZA 2NXEA 4NULA 1O9HA 2MSDB 3ANSA 2YIVX 7YASA 3LQRA 3EPHA 1MAVA 5F23A 2GZHA 4AI6A 1ADJA 3DLPX 3STTA 3WHKA 4DLXA 5JPDA 2GM4A 2RK3A 3BEOA 4DT1A 1V3UA 4AP9A 5KNDA 3AF5A 2H92A 4V03A 2AUNA 5FB3A 2VWGA 2JBWA 3B12A 1TKRA 4JGIA 4P3YA 3LWRC 1GV1A 2Z58A 3PFFA 3EA0A 3U26A 1U9CA 2QJFA 1Y1RA 2OGTA 1VI2A 1SC9A 1FVXA 1ISSA 4GOXA 1UBUS 2BMEA 4K2HA 4N12A 2FPMA 5E9WA 2O3UA 4KQEA 4L73A 4NC9A 4YI3A 1NVBA 3NJ8A 1K7EB 5D8DA 5GQSA 3C3XA 1U65A 2DJIA 3KHTA 5GAJA 3GGCA 4J90A 4UE6A 1P2FA 3CCFA 1ODEA 1Y4UA 1QFXA 5HDQA 2OV4A 2BZ0A 2BGIA 4I6JA 3ZWVA 1THGA 2DUWA 4V3CA 1GCGA 4CLOB 4Z1MD 5HOQA 1TLFA 3WPWA 1HDIA 1WDWB 3LCJA 3L79A 4YUAA 4C8GA 2ZSAA 1SXJB 1WUYA 2AOTA 2COEA 1WXEA 3TPZA 1OHHD 1GX1A 2AOUA 3LQ1A 4JV5B 2P75A 3ET4A 3E9DA 4JLPA 3K12A 2OLKA 4BZXA 4CKCA 4N48A 2DRIA 3FHOA 4TQ9A 5L3RA 2OXFA 3R9XB 3VMFB 1V1RA 4QU5A 4M2LA 1WU7A 3REGA 3ZOZA 3SR4A 5B3LA 1CEYA 3N6RA 2P8SA 2GJ4A 3U3JA 3WJ1A 2I3AA 5FBRB 4EYQA 1B23P 4WA8A 3ER6A 1SO8A 3H2IA 5H16A 3NWOA 3GVPA 4BUCA 4XM2A 1NLZA 3LMKA 1SCDA 4IAOA 4C6SA 1RQXA 1RI5A 1S2IA 3ZUPA 1VCHA 3L2OB 2QN6A 3NHJA 4KXFB 2C29D 2IXFA 3RRZA 1Z5OA 4AO8A 2CUKA 3CJRA 3MHPA 2WU4A 1X7WB 1YUNA 4KQIA 2ERCA 4JC5A 5CW2A 2QVLA 4QXPA 1Z29A 2F62A 5SV2A 3ANLA 5LFAA 4H3HB 2NMVA 2IODA 3Q88A 4OO3A 3QG1A 5ALOA 3LZ6A 3TR5A 1UZLA 2XVYA 1U4NA 4HNHA 4OP3A 3ZLUA 5GPBA 3S0YA 1AXEA 3L6EA 1O9BA 3D7KA 3NALA 5IXJA 3H8WA 3KDSE 1MAWA 1VA4A 1W0JA 3E70C 3P71T 5KDOA 1JJ2F 4KPEC 4W63A 2YY6A 5DISB 1II8A 4PZUA 4BO1A 2FWJA 3TKAA 1KEEB 2CY0A 5DM60 5CA0F 1H1LA 3AGPA 1MEEA 2RDMA 5SYNA 1Y3CE 3BRWD 3NDRA 3MOGA 3ZJVA 4NV1A 1Q7EA 3C24A 4QODA 4BLPA 3HDYA 2JZOA 3FPCA 2AG1A 3I53A 3KLBA 3M84A 4RIIA 3KQHA 3G0GA 2QJTA 3GGPA 2BE7A 4QULA 3NO4A 3VI3B 1D9ZA 3L5KA 4WADA 4PSKA 4GBMA 3RVLA 3ZHQA 3P0EA 3ZZMA 1GL9B 1OJ7A 3KXLA 4MW2A 4Z4EA 1A71A 3ENZA 4C1NA 4HWTA 2KX7A 4YRNA 1IDN1 1H4TA 1HK7A 1YTLA 1M1YB 1ZS9A 2J4DA 3N58A 2CSLA 5BT9A 1OY1A 1JZTA 2YDYA 1DRUA 2G9NA 5EHIA 1UC5B 4DIFA 1J20A 2DR3A 3FYUA 3B60A 4K03A 5IUKC 3ZWPA 1KEKA 4PG5A 2FPKA 5KQGA 3E9EA 1E6CA 3SAJA 4WXYB 2JHGA 2WTXA 1YZ3A 3MAGA 3K4QA 3GLTA 5IVIA 3TAHA 3OZSA 1BE1A 3DV0A 1XEWX 4LQDA 3CKMA 3AO0B 1X7XA 2MSNA 1DAMA 3VSCA 4RTOA 2HQRA 1JR2A 2JLAA 4G1UC 4WV3A 3ZZ1A 2Z6QA 5HMMA 2ZPUA 4MS4B 2WEKA 3PAFA 1PLLA 4P33A 1KE2A 3VTZA 2ZTVA 2Q2NA 3FNGA 3PQ2A 3SF0A 1QK3A 2WHQA 4LYDA 5TGTA 2RHMA 3S68A 3KZKA 4NCXA 1BFKA 3TQSA 2C59A 2A1UB 3LA8A 3P97A 1ZKDA 4UEOA 1BS2A 4OMUA 1DT3A 1O6GA 5DGIA 2P9HA 3BIFA 5ALKA 1C9KA 4NCJA 1L7NA 2WVAA 1ZD3A 2XD9A 2V5UA 2XNJA 5AKLA 1QDLB 3QUQA 1IH8A 1RPZA 2YYYA 3AILA 4ZI7B 2IUTA 3LHSA 5FL7D 5IM4A 1P0MA 2AG5A 3C39A 4LQ4A 4QDXA 3LIIA 3ROQA 5A2GA 2B2NA 4UXJA 1GTRA 3BYQA 4PPNA 2FGYA 5T64A 1EDOA 3EXHA 3R1IA 4TLCA 1MT3A 2QSUA 4FJ1A 1BWQA 1CDZA 2E4ZA 4OQLA 4B31A 3EFBA 3BCSA 3TCXB 1XBIA 3N0XA 4Q21A 3B36A 3WLFA 2REQB 5THKA 2ZRCA 3BDIA 3DMFA 3BIWA 3KALA 2QYTA 3PUJA 1GCAA 2PV0A 3EULA 3R6WA 1J5XA 1TNDA 2ZRGA 5ALHA 2RI1A 5EWLA 2QE7D 4C4PA 1JECA 3PWTA 3LDFA 5A4JA 3CISA 1XAJA 5T4FA 3RAGA 1G1MA 3I12A 1ECPA 1PF7E 1WW8A 1YR8A 1DCTA 4LF6B 1FXWA 3V8EA 2EWVA 2PBLA 1TEXA 2H2HA 4X8HA 2Q9BA 5HCUA 3SKVA 4RQBA 1Y82A 1A9YA 3AB7A 3F9RA 3QF7A 4Y6GB 3CH5A 1RKXA 3R7NA 1GL6A 1KP9A 2VQSA 2ZBEA 4AKGA 1NVEA 3LZCA 3IKJA 2YBEA 4IBOA 1UBOS 4KIJA 3UV7A 4YJFA 1SHZA 4ENRA 1AKVA 3T3PB 1U3UA 4MZDA 1SJ9A 4R0MA 2VRCA 1VIDA 1E79D 5T3UA 1J7HA 3ZWDA 3ZU5A 1ZM7A 3KKLA 3RC9A 4GL2A 4EEZA 4XIJA 3KC2A 2HJSA 1ZH0A 1SOUA 1JSZA 1Q1EA 1ZGCA 3HV2A 3OTIA 3HKEA 1FDIA 1FSGA 1CYDA 1U8ZA 4YMVA 5JY1A 1YRLA 4LRSB 3MRSA 2ZXUA 4AY5A 3KQLA 4Y30A 5GJCA 5JOQA 4TWIA 5BNTA 1OFGA 4OMFG 4TSRA 3L4SO 5C8VA 1Y7LA 4UEQA 1GG9A 1PD0A 1T4DA 4RQTA 2FRXA 4AKTA 3KXIA 2DERA 2WWRA 2GZDA 5D85A 3S5UA 1UIMA 1P2SA 2JIOA 3I0ZA 3WB9A 1J6UA 4JBNA 3AERB 4Z1MA 2V9PA 2IP4A 1SU7A 2YJTD 4Q7KA 3U6BA 3B53X 3HJAA 3M1LA 3RFTA 2JLWA 5EO3A 1GGKA 2Y0DA 2A78A 2VPIA 2D2FA 3AU8A 3IOMA 2JDID 3N2YA 1K7YA 3N7TA 5GONF 4Q1DA 4F38A 2W2QA 3M1IA 2R65A 1B2LA 3NC1C 3OTHA 2AMJA 4X95A 2ZI4A 4YR7A 1CY6A 3ICPA 3IAHA 3RVJA 1Z6AA 2GCEA 3R7WA 1UMDA 3PI7A 3UT6A 4K8OA 3LRTA 1QHNA 2O2HA 4DRXB 1X86B 4KR3A 3N3AC 5HRUA 4RADA 5FUMA 4NIMA 2GPWA 2MQEA 3RS4A 1WBDA 3LVQE 4K0KB 2DFVA 5LYJB 4XGNA 1YK0A 3OM1A 1ELOA 1A4XA 4M0EA 4RVHA 3V4SA 4IFIA 4FW9A 3BERA 3EFOB 2YOFA 4EI8A 1J5EB 3N2GA 3CCQF 4ECAA 4B48A 3CINA 1FFHA 1U5BB 3HJWC 4G5RA 1I3NA 2YWFA 3GGGA 3SC2A 1HEYA 3TR6A 2CUNA 4O3MA 3Q0IA 4S2UA 5SYMA 4F4UA 1YJ9F 1G64A 1IC6A 2FYTA 3UTDA 1HF3A 4RZ2A 4WK0B 2E4VA 3I0NA 4JEIA 1O57A 2ZJBA 2IIPA 4DLNA 2XW6A 1KXJA 3BX1A 1U90A 2FJUA 2GEUA 1KI6B 3VRHA 5THQA 1D5CA 2W98A 2GZ3A 4HF7A 4MZXA 2H4YA 3MB8A 3MS2A 2NTYC 1U1FA 4OLFA 4DRYA 2QG6A 5E9AA 1XJ0A 3BGWA 3SYKA 1OXMA 2TYSB 5A3JA 2QENA 3GLUA 4OB6A 4KFUA 1PR1A 3QPDA 4ZU1X 4IIXA 3TNFA 4BUZA 2X6RA 1SCBA 4M88A 4TUYB 4FI3C 4W8HA 3E9MA 1B41A 3KCQA 2ZIVB 1MVOA 1P0QA 2BTUA 2OCAA 3NIDB 3CPHA 1Z2OX 2VH1A 4YJ2B 5AJZA 4UAGA 3RBZA 5FV4A 2YTZA 4FDVA 2QW0X 4YJHB 4PYNA 1F51E 4U3JB 3IBYA 5TLSA 3FR7A 4EY3A 4CEIA 1UWLA 1NG9A 4DQVA 1SCKA 4NZMA 1GRVA 1C14A 4DLZA 1X19A 4O3FA 2VPWA 4N01A 3B13B 3L6UA 3KLPX 3LPLA 3RPEA 1RWOA 1WBJB 2M6KA 1XQ1A 3VO2A 1A3CA 5JBIA 2C5BA 1FNKA 1E9FA 2NUTB 4KPUA 3OH8A 2ALEA 2V9CA 3AETA 1M1NB 3N8GA 3V7FA 4EJ2A 5FWYA 3N76A 1X94A 3OCYA 2DPMA 3MJSA 2GHQA 3FVQA 2PUHA 5JNUA 4D9CA 2C2OA 2R6GA 4EO7A 1TT5B 4B6RA 2NN3C 1SVUA 3P5BA 1LQUA 1NQUA 2YHIB 1RFLA 2QI9F 3ONDA 5DHRA 4F86A 2RMKA 3WLNA 2NZVG 1UFOA 2OG1A 1RQ7A 4OP2A 4B4UA 2Q5OA 4U2EA 1JIXA 1VIAA 4UAJA 5IXSA 2K6GA 2V5AA 3AETB 3O8DA 5T6BA 3D6VA 4GM0A 1L2TA 5DXAA 4KHZA 1D7AA 3QKSA 3CEPB 3PA8A 1N2BA 5IWCA 3DVAB 3F8WA 1H93A 2F7SA 4N49A 3QVSA 4WERA 5E8JA 3V7NA 2D06A 2ICAA 1FJXA 2D7CA 1LI7A 1Z12A 2OPBA 2J7PA 2QW8A 2IQ5A 3LQ2A 2FX2A 5KWEA 2JLQA 4K2AA 2W00A 1EGAA 5HF9A 5KC9A 2N48A 2J3MA 3OC6A 2DTXA 4LNHA 4WJZA 1P74A 1Q1BA 4WESB 5PGMA 2IHTA 5AI8A 1RQPA 4REMA 5CNIA 3FOFC 2EV9A 2EFCB 3LWOC 4KXNA 4TKLA 4AZ3A 4PF1A 1LSOA 2HTFA 3FLMA 2GSDA 2UYQA 3WXMA 4MVJM 4IJMA 4ZGBA 1C1DB 1BO6A 1NAHA 2QTGA 2VHJA 4OQEA 3EVEA 3LWDA 1VBNA 4ALJA 1K7SN 5AKYA 3CCMF 1OXBB 3HPRA 4B3TB 5EXPA 2GDZA 4BL5A 4BTEA 1WV1A 5I48A 4HN9A 1O95C 1X13A 3ORYA 4NZPA 4U9UA 1WSAA 1Q0SA 2YYAA 4FR2A 4MKRA 3HKDB 5JNVA 3AGKA 4QYXA 1NUQA 3QPCA 4LSMA 4WEQA 4TZ6A 3BEDA 3SZGA 4DM7A 1TX4B 1V5IA 2XR1A 5IPFA 2PO7A 1FFCA 4CM4B 4B3GA 2BP7A 2JDIA 3AX6A 2DKNA 4KC0A 2JJ8A 4M9QA 4I08A 4P08A 3ZDAA 2DQYA 1CRQA 2NV2B 3E3NA 1BU5A 4HLDA 5EE3A 1UDCA 3GOHA 1O7JA 2N1BA 3QV2A 3AP1A 3NYWA 4OJKA 4JUDX 4QPCA 5BMVF 1QANA 1QAOA 1L4FA 1QG2A 3TX6A 3IVXA 4AK9A 1U9YA 3K0AA 1XKQA 3DBLB 5IMBA 5DH9A 2RAPA 1C1HA 2O6LA 2Y05A 3NIGB 4MA5A 4TVBA 5J40A 2JIQA 3NYQA 3PS9A 4B7ZA 2DWCA 3JRNA 3A1DA 4PS1A 3H5AA 1WWKA 5K3DA 1CQPA 4LPKA 4UBLA 3DDCA 2NW6A 4RTMA 4PS0A 1TT7A 1LLCA 1KPGA 2BC9A 3JRXA 3EUEA 3RLIA 5E3HA 1DDOA 3TQRA 4GW3A 3FZQA 3VUFA 5TRTA 2B61A 2JKVA 3LT2A 2PUVA 2ZW9A 4A8JC 4NU5A 3R4CA 3NVIB 3KKPA 4HGNA 4Y67A 2ZIUB 3U3RA 3B78A 2N9UA 1WIWA 4OHPA 4M22A 4KP7A 1NXWA 2CFRA 2VT2A 4LY6A 4AZSA 2QRZA 1T24A 4BQEA 1N8RH 1B26A 1CJTC 2PSFA 3EZGA 4ZYUA 3KJJA 4N3BA 5D3QA 4XX1A 3TWOA 3HS3A 4FPXA 3WNDA 4B6EA 3I9KA 2I3DA 2ZE8A 3HAXD 2W4QA 1P4GA 2C7QA 3HYRA 3PP8A 1XMXA 4QIHA 3E20B 1LNZA 1JBQA 2X6TA 3DQPA 2YY7A 1KQSF 1DBIA 1EEXB 4QOGA 1U3LA 4E5SA 1HEIA 3LLSA 3UYKA 2XWSA 1U5CA 1XLTC 4ZO6A 3HY3A 3ME5A 1BCSB 4JI4B 1SQ5A 2BUCA 1XLVA 2JIBA 3CZ5A 3IMFA 4GKAA 1EINA 4TSFA 4CM7A 2GNPA 2ASEA 3RE1A 1RPJA 4O2RA 3IR6A 4B81A 1GQRA 1HDYA 1RTTA 3ZWBA 3H13A 4GVXA 4YRBA 1CPYA 3NDPA 3CO0S 5AKGA 1P1IA 3V4VB 2IL1A 1YGYA 2R6HA 3NCTA 2CNNA 2R1VB 4Z53A 4BQIA 4WCVA 4NENB 1GSAA 3E6AA 2V3CC 4E2WA 1QTRA 5JI2E 1MU0A 3C5CA 4M83A 5EZ5A 1RBMA 2CYCA 1M66A 4X3CA 3TNJA 1T6ZA 3X43A 4DCMA 2XOEA 3M8KA 4ZOLA 2OP1A 1E1CA 3I9NA 3LD9A 4HPXB 4BQFA 3UGJA 1M75A 1U8FO 3VR3D 4CGYA 2Q8QA 2ECPA 3IEKA 5HZGA 1WMDA 3CLTC 4RCZA 2R00A 3HA3A 2W2MA 1GR1A 4D3DA 1SXQA 1L8AA 5AWFC 2M6SA 1IXZA 1RLTA 4M8IA 2NPIA 2RG1A 3IQHX 3OE7A 3PQFA 4J03A 1ZVVA 3WLJA 2HIHA 3OWHA 3TMYA 1I2AA 3QEAZ 2E5FA 2C8LA 1NT4A 3ABIA 5C8DA 2HDNB 2XQJA 4XFDA 3EF3A 4RSGA 3OWXA 1YSCA 3F6YA 4P8RA 1DIAA 4TS1A 4TKZA 4ZI7A 2P4QA 2GBPA 3ROZA 4G4IA 3U9SA 2CLDX 1Q3KA 1M2EA 3AHCA 3ERCA 2VYVD 3LKZA 4QU9A 1KK1A 1RDFA 1JAIA 2Z2XA 3GG9A 1OXUA 3OQPA 4IV8A 5AQEA 4MRVA 3PXGA 4PBSA 2DULA 4PQRA 4B4KA 4BZPA 1NW8A 5DNYB 5H0IA 5H5JA 3M6MD 4AT1A 1CJSA 3G82C 1JIQA 2YL2A 2VWQA 4IQ8A 4EAQA 1QF6A 3SG0A 1RLOA 3CC7F 3KJZA 5FTMA 3O2SB 3MN1A 3C70A 4EF4A 2JRLA 1QQBA 2Z08A 4GG1A 1LBSA 2IIBA 3FNBA 5T4BA 2NO5A 2YOHA 4FCWA 1U8YA 4JOSA 3T9DA 1L1EA 4I50A 5IM5A 3NFRA 3LT5A 2X0KA 1DG1G 3JXEA 4PPFA 3TQTA 1VKNA 3KU4A 2F3SA 2IXDA 2FP4A 4N9QA 2WAXA 3AF4A 3EBPA 4R0NA 2VBIA 3NM6B 3TKLA 2XGOA 3DDZX 3Q7IA 3U7QA 2PX3A 1F5SA 3NRJA 2MSWA 3EVZA 2QR2A 1JIKA 2XVZA 3PNPA 4YMHA 1CLEA 1MORA 1AMNA 3RTAA 3SZMA 3FTPA 2ZRFA 1G42A 2VDMB 1Z08A 4US2R 3I04A 4YV0A 2UXBB 4RZUA 5J5VA 5TJHA 1YCDA 4YJ2F 2F67A 5LL6P 5EE0A 1AKYA 1JLSA 3DWGA 4QXRA 1ZWZA 3REQA 1AC5A 3U0BA 4MWDA 3K2BA 4CKBB 2EEZA 1S8FA 5JSZA 1NQXA 1ZJJA 3EQ2A 3I2HA 5KBYA 2XIJA 4A6XA 1X7ZB 2INGX 5CYGA 2C54A 1E9SA 2B8EA 4R8RA 5EY5B 5TGDA 2UUAB 1E3DA 1NRXA 1QFMA 4IV0A 1E1NA 2PSSA 1L4NA 5EA2A 5BSRA 1NVKA 3I8OA 3RG8A 2IBTA 3R9XA 1XT6A 2JFPA 4NX2A 5G4VC 1XZFA 1GSHA 3GP5A 2B8NA 2FZLA 1LBHA 5F5NA 3ZBPA 1QX3A 1ONBA 3Q3IA 5IJAA 1AQJA 2CXTA 1AUXA 3SOPA 1A9XB 4CHTA 1PDOA 3EGXB 1L0BA 1OX4B 2C8JA 4BPRA 5BYJA 1VG1A 2A58A 3KZVA 1QS0B 1Z0SA 3JCZA 1WSDA 2H7CA 4QYIB 4C0AC 4KXMA 4D1YA 2CYAA 1WCV1 1QWOA 3TVTA 4ZYTA 3KOYA 4DNOA 4J0FA 4YACA 2I55A 3WK5A 4P86A 4Q12A 3SD7A 5ELMA 4WOPA 3WSVA 1NA5A 1I2ZA 4UFNA 4J7AA 1QIMA 5L7TA 3DYVA 4Y2HA 3W2IA 3M6AA 1LBQA 1XIVA 4D02A 2WWGA 3DUFB 1DZIA 5EPOA 2FOLA 3ELBA 1E79A 4FT2A 4JBYA 4WINA 5EOVA 4BFWA 5JMPA 5T4HA 4LS3A 4AP6A 5KREA 5KSYA 5GJBA 1PR9A 3ZP7A 1JX6A 3IRVA 4FEYA 4KRGA 2BFOA 5JUWA 2ZROA 4DV7B 1KZ1A 3G8AA 3BXZA 4NR0A 4LISA 4OBWA 2NVUB 1U6KA 3VYVA 4UQLA 3ZEIA 1Y6GA 5F9HA 5F7OA 4TYMA 3JARB 4R8SA 6LDHA 3ZE6A 5DBHX 3IELA 1SD1A 1DC8A 3KL4A 4DQLA 1HH4A 3KUUA 3FUUA 4BJ3A 1DELA 2VPQA 1DTEA 5JY6A 2I22A 2X5OA 1M83A 1LH0A 2E49A 3QLEA 3LHIA 4JX9A 4RGYA 3SIPA 5IABA 5MFZA 1SCUB 1GZ4A 4O08A 1OYVA 5G0SA 2C42A 1JHAA 3WP1B 3ISVA 3ZDEA 3E4DA 1HR0B 4NPHA 1V6CA 4I14A 3F6MA 3DFMA 2VT3A 4HGZA 5BUCA 1HSZA 1OFUX 1VJCA 4IMRA 4Y2VA 4CKXA 1A2OA 3NAQA 1YCFA 3N75A 1XD9A 4YMWA 2A0XA 4O4IB 1C4KA 1H48A 5AXDA 4EZBA 1K4YA 2F8MA 2AR7A 4KMOA 2Q0XA 5ECWA 4FQ8A 2ZI5A 4UU7A 4KE7A 5A9RA 3K8QA 4LBWA 4WE3A 4UCFA 5BW6B 2ZYIA 3NHYA 4U39A 3E9ZA 2V0NA 1JWAB 4FHCA 5EUMA 3OAAD 3NHMA 2YXZA 4C4SA 1FLNA 3S8EA 3AHJA 5FOTA 3TJRA 3NVKI 2VDUE 1BHO1 4G4VA 1NL3A 2FRVA 2IOHA 5FADA 4WY5A 3KK0A 5KJEA 5TPWB 3QF4B 2D4HA 3R24A 4HV4A 4RE5A 2ZE5A 3M81A 1NJ1A 2IBMA 4FZ5A 4CQJA 4YLYA 1C0LA 2AJLI 2B9VA 4R54A 1DTWA 1IM5A 2Q5HA 4B6QA 2PTHA 4ESVA 4PBTA 2YWXA 5COBA 3KVVA 4DWOA 2WTMA 1IY8A 4ZODA 3FIJA 3HZZA 1VA5A 4MI6A 4M99A 1NYQA 3T0IA 3GU3A 1T3HA 1WUJS 2RIRA 3AQ4A 1HFKA 1ODCA 3KEQA 5CK5A 3SYMA 1NOIA 2HBYA 3C85A 3LQYA 3KAJA 1NYRA 1YRHA 1Z5PA 2CBGA 3O8QA 3PFWO 4FIZA 2Q21A 4K9OA 1NDUA 1W5TA 1WXXA 1U0OC 1WXIA 2MIIA 2VYVA 3BXEA 1KDRA 3OONA 4HYEA 3RVNA 2B78A 3T35A 4NFSA 1R1DA 3N7UA 1SZPA 4GI1A 4H0CA 4J0HA 4JCOA 4L0CA 4LDJA 3WGGA 2CVHA 1RKQA 2ZRMA 2XE7A 5LMNB 1ZM3A 3AEKA 3KAKA 2W6PA 1LEHA 1LB1B 1BDIA 3U4CA 2J3EA 2LBTA 1JHMA 2QX6A 1HDZA 3W3AD 4JMPA 1NATA 1OWPA 4BT6A 5F7JA 2AG0A 3GRKA 3GO4A 4K81B 4OMCA 1MJGM 1U9IC 4WLOA 3L6BA 3NDJA 2FR1A 1TJ4A 3PC7A 4HXFB 1T36B 2IEGA 2UZ0A 1DFIA 4JSRA 1M1ZA 3EB9A 3RB8A 3QELA 4ZHQA 1X2BA 2Q6KA 1TK3A 1H05A 3D64A 1PNTA 3I5XA 1FDOA 1DU4A 4TGLA 3R5TA 4QXQA 4ZP1A 1TF2A 4J6EA 4OV6B 3P9NA 4UEJA 5ALXA 3VC7A 3NRBA 3O85A 1SB9A 4Q3DA 3KSAC 1EFAA 4II3A 3UENA 4X60A 1B73A 5CA0B 2J3QA 4GI5A 4H4DA 3RH0A 1J8FA 1U1DA 3OU7A 1DPGA 1K6EA 1QHIA 2BDEA 3G4SF 4YP7A 3TLXA 1OLXA 1R12A 4NMHA 4NMMA 2W90A 3VTKA 3ZCUA 3YASA 4DR5B 5TE9A 2TRSB 1G8JA 4JU8A 2V1XA 1MJ5A 2PVCA 5AD1A 2WTNA 4PHTA 1DEOA 1X9IA 1Z5VA 3WAJA 4GP6A 4UAVA 2EKPA 2Y0CA 2ONYA 4QXMA 1DAEA 4RSMA 5FF9A 2UXDB 2GEBA 1OGYA 1TL7C 2ZUVA 4FT4A 1YBFA 5A7FA 1R64A 2BEKA 4UVHA 4OL0A 2GX6A 3NV9A 5JSUA 1WDMA 1FQOA 2XH8A 1DHRA 3CZPA 2IPAB 1BN7A 3GEGA 1EP9A 5H82A 4D3XA 5DSXA 5BSMA 9ABPA 2BEWA 4XQ0A 2J85A 3CUTA 4U63A 1I0ZA 4TTPA 1ZVJA 1QGDA 3CZQA 2HCRA 3KVOA 4MHSA 1YL6A 3V1UA 2GLUA 5ED0A 4E03A 4ZOLF 1K75A 4NYIR 4Q9NA 1RJWA 4XOUA 3G2OA 4AKSA 5KVVA 1Q74A 3MTAA 2FPPA 4KGXA 4RYDA 4HXEB 2A9RA 5DGTA 5H9VA 1I2BA 1GZ5A 1VRWA 1WR8A 2JAOA 2W8ZA 5T5QA 3WK7A 4D8XA 4DNQA 2QY6A 3A4NA 3MS7A 2VUIB 4ZMRA 1JPJA 4D26A 5DW0A 3ZV7A 4RTJA 2J0SA 3V4LA 1JWBB 3ANNA 1VQKF 2CNBA 2WV9A 4MUIA 3UJDA 2EL7A 3T1TA 2ZAUA 1QMPA 2Q0QA 4RACA 1GGNA 3BHJA 3CPWF 1S72F 1CDOA 1VQ1A 4HTFA 4GD3Q 3TXXA 3UUFA 2ZE7A 3WJ7A 6YASA 5JHHB 3ZN2A 1JY8A 2I4OA 4UM7A 1WLSA 4GOLD 4V2IA 5IUNC 3IDAA 3OHSX 4RSHA 4HS4A 2YVUA 4L85A 1OIXA 3QHDA 1DNPA 2HN9A 2JGNA 4BVTA 5LB4A 2SBTA 4GVLA 5K6AC 2GHTA 1JHVA 3O92A 3H2BA 3OIUA 4DA6A 4EQ6B 2I29A 2UYGA 2VJKA 4JT4A 2ZRPA 1PSDA 4MUXA 1S1CA 4TROA 3SKYA 3AK4A 1CUBA 2G77B 1N6RA 2KI5A 4RMJA 2KGWA 2I34A 2J3JA 5IJXA 3WQHA 1AH2A 3BFXA 3CCCA 4M36A 5J4KA 3Q8MA 1MOPA 1N4DA 3SHWA 1HQCA 4QJBA 3R44A 4DLPA 4EMSA 1AKUA 1XHEA 5AHOA 5K2MA 2APJA 2GVNA 5CX4A 5BW8A 3DC7A 3DOHA 2RI6A 3SS9X 4R8VA 3KDPA 1AQYA 4LJAA 1N5KA 2EX4A 4Q15A 3N2KB 1T2VA 1Z0UA 2VZLA 4HVCA 1GGEA 2CFSA 3C14C 4KVFA 4DG9A 3KKZA 2BLNA 3WJQA 4DCNA 3UB4A 3V4DA 5DBGA 3D6FA 1TQ6A 3ITEA 4GOKA 3EVAA 3ED1A 1NNSA 4BCCA 2XWJI 4C22A 3G0HA 4LX0A 3RTDA 1BMFA 1ZGJA 3AJ8A 3FVWA 3D7MA 3LWZA 1GEGA 1NJ6A 2H7VA 1H2FA 2E2WA 2EX0A 5BYKA 3FWPA 3L0YA 4KYIB 1RHKA 4XASA 3N39C 4WNAB 2QMHA 2YV1A 2XDYA 1VSTA 2Q3CA 3D8TA 3O82A 3R0JA 4MUEA 5CM2Z 1VFNA 4B8WA 1VMDA 3E7FA 3CTPA 3ER8A 3GLFA 4LF9B 1DAGA 4RM2A 5DXFA 3ANMA 3AYXB 3CVUA 4I55F 1YFLA 1F7UA 1XDDA 3KE1A 2O7VA 4LSGA 2KMLA 3G6KA 1Z28A 1E2GA 2ATVA 2BDUA 2Z4RA 3T3EA 2EP8A 5A7HA 6Q21A 3CKKA 4RELA 1AO3A 4UDYX 1K2WA 3HI4A 4UHCA 3Q10A 2HFJA 3WXBA 1Y6JA 1MFPA 2FJ0A 3LM8A 3ZHBA 2H29A 1W1UA 3CX7A 3HHEA 4XB1A 4ZDWA 4U7FA 4DMMA 4LZPA 4KLZA 4JXJA 3BTSA 3HZHA 1Y9AA 2P2NA 4GI7A 3G9XA 4HQKA 5JPIA 4HRAA 1U99A 4NUTA 1Y3IA 2REXB 4JUIA 5BRAA 3FZYA 1LJUA 4MKGA 1DAFA 4J16C 3CZRA 3S0WA 2XODA 4L7VA 4OH7A 4E08A 4KXLA 2A7XA 5ITWA 2ZJ1A 5L6MB 1M8PA 5F52A 1GXSB 4F9GA 3VYRB 2O8BA 3WP0A 1NI3A 2XMRA 1EVJA 1T15A 2DMRA 2HZ7A 1G5HA 1Z0KA 2P4EA 4I1OA 4P38A 4WZAA 2I9KA 2KYRA 3GLIE 4GDFA 4W1PA 1Z5NA 3DE0X 1JDBB 2OZEA 5C5CA 4BTLA 3ZI4A 1DBFA 2OK7A 2PPLA 3HU1A 5BSTA 5CIYA 2BMFA 4HN4B 3MRTA 4E09A 1NZFA 3DGEC 2OK8A 1T4GA 4F71A 2B5VA 3G5TA 5LC1A 1ORTA 3BS4A 4KJXA 2ODQA 1HNWB 4Z4QA 3G2IA 4HYQA 3ICCA 2ZUWA 3PNSA 4RDHA 2HF8A 5CHEA 5DSTA 2VRNA 1E0JA 4ZOBA 2G83A 1W0KD 2VSNA 4DC0A 7AT1A 3IAS6 1C9EA 2W71A 1VQ6F 4JQZA 5ARBA 3HJTA 1ZDMA 2YY5A 1JSRA 4L9SA 4Q03A 5BOSA 2I6UA 4OM8A 1AKEA 3GJZA 1EM8B 4XEHA 5H02A 4BVKA 1NNEA 1NURA 1VLMA 5AKJA 3ON5A 4D4HA 4FWBA 5CPBA 2X0NA 3L06A 1NI5A 4QGAA 4LF4B 4ZV4A 5B4TA 2CXUA 1P60A 3KQOA 3P4YA 2H08A 1KZHA 1MEJA 3NTLA 1NV9A 2QP9X 2ZYVX 4HAOA 4IXTA 4NZOA 4QGFA 2W6MA 4JJFA 4DS3A 4LK3A 3GUHA 1KFBB 2X8BA 2OHVA 2P41A 1RFGE 2J8ZA 4IQGA 4HVLA 2YVKA 3EA5A 1IEVA 3TSAA 1RLIA 3SU8A 10MHA 2C5HA 2JJYA 3BXXA 2D3WA 3F0TA 1ZI6A 2BFFB 1WDKA 2WWTA 3RCBA 2H07A 4RC9A 1E1DA 1L7QA 3Q2IA 2NGRA 5ITZA 2FWNA 1FRQA 3GCGA 3HB1A 4GZMA 5EIHA 3M1AA 5CB4B 2YMLA 1DADA 4UAUA 5F3DA 2I2BA 2IV3A 1NU6A 5EEGA 4YQYA 4CUKA 4C76A 4V0RA 4K3UA 3EVCA 1Z82A 4M6WA 4N3CA 4QD3A 2A9QA 5EQJB 3WBJA 4F2GA 5KVAA 1IJEA 2H1OA 1PXWA 1AKNA 1M8JA 1YVRA 2WG1A 1ZL0A 1E0SA 3TD4A 2P69A 1I1NA 2VC2B 3KFLA 3QUTA 2C7RA 7MHTA 3F0EA 5JZVA 5K01A 16PKA 5FA6A 5M29A 1T8RA 5ECYA 4AMUA 3GCXA 4UDOA 5L45A 1P0CA 2AXPA 2IF0A 3GXOA 3V4PB 5C1BA 2CJWA 1G5RA 4W6QA 5E1OA 2Q2WA 2AR9A 3COZA 4UBNA 3SXJA 4RH0A 5EZYB 5IH7A 5K6TA 5BXYA 1BJKA 4S1VA 1UWCA 3RI3A 1V1RB 3D4LA 2JNBA 2QXTA 1M8KA 3DKIA 4ZHQF 5AOCA 2FWRA 1U2QA 3IQZA 5ERYA 1PUXA 1DIGA 1JJVA 3IJEB 3VYSC 4C0SA 1NP6A 5F2OA 1FRNA 3GDHA 4LZNA 1DPFA 2V5VA 1PYDA 5BRNA 2PX2A 1AQLA 3MTJA 3OY7A 1I14A 3ZJ5A 2HP3A 4BN4A 4BO0A 3LQQA 3KIPA 3QELB 4PYLA 1I7DA 3K1AA 2X0DA 2X9GA 1FYWA 2HI0A 5FPPA 3Q3HA 3WYAA 1XU7A 2QV7A 3O31A 1RVDA 3BMXA 4RULA 4BLWA 5CFMA 2OC4A 3ENKA 3H9UA 1VHTA 1B00A 4IEEA 5DM1A 1A95A 1H1TA 3UWSA 5LXTB 4JBWA 3WKAA 1HE4A 1KSFX 1J24A 4B34A 3RU3A 1A96A 2FHPA 3AEKB 3WQQA 5IJ0A 1H1DA 1MQSA 1QIEA 3DFFA 4FMPA 1RC8A 1AZLA 1SZDA 1JMVA 2R7KA 2QROA 1KYQA 4NBSA 4TPKA 5IFLA 4KREA 2CUZA 2HUPA 3CO5A 3F8TA 1CJVC 3QK7A 2AG6A 4FMCF 3V1KA 4EO9A 5FAKA 1P77A 2C2XA 4S3MA 4F6LA 2I3GA 2ZB7A 1ZXLA 3QEOA 1ODFA 3MMSA 2YFQA 4UCWA 2ZRAA 1BHSA 1VKHA 5FTWA 1W5BA 1NT2A 2R6FA 4X91A 3A32A 1T9HA 2RD2A 1NKTA 1JFLA 4R8LA 2FOIA 2JJ2A 3JYNA 3RAEC 4RY0A 3GEPA 1IAQA 2ZOVA 1PQWA 4WBSA 4TXHA 4CL8A 5ESDA 3VR6D 5DCYA 2QE7A 4GKVA 4QLOA 5CA0A 4IL5A 4RD3A 5GM1A 3GVIA 3C9UA 4HAVA 4PYMA 4Y2RA 4LBYA 4PQEA 4GXQA 2O8DA 4FFLA 1X7DA 4H31A 5I5EA 3GEHA 1L1FA 4NFLA 2OORC 1W75A 4I50F 4PG7A 4LX8A 2VQ6A 5IVHA 2GN0A 3UK2A 2BR5A 5KHOC 1AUVA 4L5BA 3U44A 4JR0A 5BN4B 5EMHA 3WNZA 4ZHQB 2QXUA 1E3JA 1NNLA 5B64A 4PG4A 1Q0TA 3NHSA 4P3NA 2O2EA 2VUSA 4QBKA 1FP1D 1GUFA 2AG8A 3P7MA 1PYOA 2QZZA 1CVIA 1S8NA 1V2GA 3A9TA 3E9RA 1VDZA 3OKAA 3IP1A 1GPDG 1OI2A 2FG6C 4EHIA 2R11A 1X77A 1JJIA 3I55F 3QYPA 3EGIA 4GZ6A 4F5DA 4LCKA 1M10A 1CV2A 4NOMA 2BHTA 3NHFA 1U2DA 1GNLA 1Z4MA 4G8CA 4IJ5A 2C9DA 4PC7A 3PLRA 2BGGA 3V7QA 3MCVA 1XVTA 3Q98A 5BUZA 3K6RA 3OCJA 3DOFA 4EVQA 3P9ZA 4B32A 2ZAMA 2QR3A 1NBWB 1NXPA 2AHOA 4LJYA 1ZQ9A 4ZAYA 1GPJA 5EVCA 4C08A 2Y0EA 3HJFA 4FD3A 4EKNB 1XGKA 3CCJF 2B83A 2P6MA 1R4MA 1USIA 4J49A 4MVWA 1SXJC 2HT6A 5BOVA 2D3TA 2CMGA 3D4IA 4RXUA 1OGIA 2WVGA 3WYNA 3ZVMA 4XRRA 1T5HX 1V1MB 2WYIA 1L8LA 4Q3AA 5FJJA 2F2TA 3ZWNA 5C2JB 4MYHA 4PCVA 1J06A 5C0OE 1L5NA 4MVJH 2WKSA 3AF6A 1VQ8F 1Y9JA 4XJTA 3LCRA 4XVRA 4HB0A 2ZBDA 1V35A 3I1FA 4B73A 1PD1A 1L4GA 1C9MA 1QVVA 2OTLF 1U2GA 1TFUA 4I8IA 1GZSA 2HADA 5J58A 4C8EA 1MC1A 1W52X 1SIUA 2I5PO 3I4CA 4BP1A 2Q5QA 4CMCA 4DSZA 1QZTA 2GCNA 1MJGA 4H7JA 4DIMA 3FPKA 4NONA 1FMCA 1ZLXA 2G0TA 2RGGA 5UKDA 1HEUA 1PS8A 5IBPA 5F7XA 5IZCC 3I28A 4M86A 1C7ZA 5HCNA 4CU2A 3AIIA 5C34B 1ZGZA 4HQRA 4ZCRA 1ZZEA 1K2VN 1M34E 2XE4A 1AX9A 2SHKA 1S9HA 4ZU3A 1QV7A 4BEWA 2P2DA 4H27A 4FHFA 1ISMA 1F38A 2B99A 3SR0A 4H59A 4UUAA 1UOOA 4UNQA 2J1LA 2O07A 4UNPA 1MPXA 3WLRA 3ZGVA 5HKAA 5IXYA 2GS9A 2R8EA 4Y2TA 1QZZA 3WWZA 3C9TA 4ZDJA 3JQAA 3PWKA 3H2JA 3WOHA 4EEXA 4PXYA 1JA9A 2XQGA 4HAUA 4WHMA 5TSDA 3TPCA 1BQ3A 4KN5A 2GTPA 4NZYA 4PHFA 1ML4A 4IGIA 1EK6A 3WLTA 4OQYA 5KTOA 1JEYA 2GASA 1A76A 1ZD5A 2WC1A 2WJWA 3L8MA 5IAJA 3A4YA 4B47A 3WK9A 4J2OA 1PJ4A 2Q2OA 3R3WA 3U0OA 2QTVB 2GB4A 1ONOA 4ZQIA 4M9CA 1CXZA 1JEQB 2GCGA 3QZUA 4MVJA 2W6OA 1L7AA 3GDGA 4G5FA 3TW4A 1ZR2A 4CJXA 5ERGB 1W581 4V1CB 1SVMA 4TS3A 2GRJA 1UDAA 4NG5A 1YMUA 2A35A 2PWZA 3D8UA 5G53C 4E1BA 1U0GA 4HMQA 4RO0A 2FP4B 2FPWA 1KEUA 4XYMA 1ESZA 1RRVA 1TA9A 3SI7A 5KYGA 4X66B 5DKFA 1H2YA 1TD9A 2VJNA 3JZAA 5LZ2A 2P5SA 2R4QA 3HR8A 5K0BA 1Q57A 1E69A 4ZZ2A 3T3HA 3G2PA 4FKZA 4LF8B 1BXZA 3E2IA 3KOZA 2HPHA 3WO1A 5I7SA 1SZQA 5IAAA 4O29A 1ORHA 3W3AH 1U9ZA 1OX4A 1ISHA 2X2FA 2QXYA 1Q7BA 3ZWOA 5TT0A 3AU9A 4GI2A 4FMDF 1ID8A 1U80A 5EIOA 2XCRB 4Q7MB 4V3BA 2YDXA 2YRWA 3HB0A 3LG2A 1YZTA 2O0JA 3QBEA 3HGQA 3ADDA 3GIDA 3WBBA 3ZDYB 1QH1B 3HCWA 4AZVA 4KVGA 1ULSA 2DLNA 3W5VA 3ZR4B 2KBFA 3K9GA 2FSGA 3BD6A 4F5EA 1SOWA 2IYFA 1JU9A 2WHPA 3I76A 1RHUA 3D3JA 2CLOB 3IUEA 3MTGA 4PYQA 3BB4A 4PIVA 4RIEA 4EHHA 2DM6A 2CCJA 4ERXA 3IB6A 3GLSA 2J7KA 4BU1A 3OT1A 1YF3A 4XYBA 4CEHB 4XH9B 3Q3JB 1BTOA 1K06A 3K0FB 3LVRE 2OO7A 3O8LA 2GN2A 3DHVA 4JUCA 4YLEA 3JCMM 5I5GA 3DL0A 1YCGA 2AXNA 5D51S 3VM6A 5LBIA 3ON1A 4AQYB 1T13A 2PGAA 3HO6A 3PC8C 2CLKB 2RGNA 3L7CA 2YR0A 4C3VA 4PNHA 4D4LA 1GV0A 5HY0A 2VBFA 4D97A 5FI5A 1BMDA 1RI4A 3TBFA 1N2OA 2A0KA 1GKUB 3TZBA 1Q7YH 2J6HA 1MTZA 2AYXA 4H1TA 4EA7A 5KVCA 1YBAA 1OWNA 3N0VA 3DKKA 2BMWA 5CLLA 4D4GA 3RYFB 4F56A 1GXSA 3ZE0B 2PXXA 3DAOA 3ROGA 2B21A 1GKYA 2EZ4A 2FLWA 1W9MA 2FF5A 2OBXA 2XUIA 3Q7RA 1SXIA 3GA7A 2BGRA 2F64A 1W0KA 4RH1A 4URFA 5DM4A 1AQ6A 3WQRA 2DLCX 3OESA 3RYFA 4URHA 3HACA 1FNNA 3CZ9A 3V7UA 3EMVA 4U7JA 1H9AA 2E4AA 2PYDA 5B30A 3AXTA 3KOXA 1NC1A 1UJ5A 4MIKA 2OZLB 5IVDA 4B9AA 5BSEA 4TXLA 3ICQB 1VFPA 4BVEA 4PWTA 2I2CA 3DO5A 4C21A 1COWA 1E32A 3LFUA 2EG5A 2I4IA 2JC3A 3RAPR 4A6EA 1X25A 3GVHA