3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
1FFXA 4XCQA 1TVKA 3UT5B 3WGMA 3HKBA 4X1IB 5GONA 4I4TB 5CB4A 4O4LB 5EIBD 2VAMA 3E22B 1W5EA 4YJ2B 4ZOLB 4O2BB 4EB6B 3JATB 4I55B 4F6RA 5LP6A 1TUBB 5M7EA 4TUYA 5IJ0B 1JFFB 3RYFB 3HKDB 3M89A 1Z5WA 5LP6C 2VXYA 4ZI7B 2Q1YA 4IHJB 1RQ7A 5EYPB 3RYIB 4I50A 5J2TA 2XKAA 5LXTB 4HNAA 2Q1XA 5IYZB 3VO9A 2RHJA 3JARA 4O4IB 3JAKA 5EZYA 5LYJB 4O2AB 5LA6A 5ITZA 5KMGA 5JH7A 4IIJA 5MN6A 5EIBC 5MN4A 2RHHA 2BTOA 4DRXA 5JQGA 3JASA 1OFUA 3C8LA 5IJ9A 4X1IA 4I4TA 3R4VA 4O4LA 3HKCB 3ZBPA 3E22A 5FNVB 2XKBA 3RYCA 3HKEB 4YJ2A 4ZOLA 5JVDB 2BTQB 1SA0B 4O2BA 3JATA 4I55A 3VO8A 4B46A 4EB6A 5CA1B 3JAWB 5LOVA 4X20B 4O4HB 3ZBQA 3RB8A 5IJ0A 3RYHB 3N2KB 1JFFA 3RYFA 3HKDA 4TV9B 2R6R1 4B45A 4ZI7A 1W5FA 1W5BA 3N2GB 3HKBB 2VAWA 5EYPA 3RYIA 5CB4B 4FFBB 4YJ3B 5LXTA 5CA0A 5IYZA 4LNUB 4WBNB 2RHLA 2RHOA 4O4IA 5J2UB 4O2AA 1W581 2R751 4O4JB 1RLUA 1W59A 3UT5A 4EI9A 5KX5B 5BMVB 1Z5VA 4EI7A 2GVIA 3JALB 4TV8B 4X1KB 5J2TB 3CB2A 4I50B 3HKCA 5FNVA 3VOBA 5JVDA 2BTQA 5C8YB 3WGKA 5CA1A 1TUBA 3JAWA 4X1YB 5JQGB 4U3JB 5JCOA 4ZHQB 3RYHA 1FFXB 3V3TA 1TVKB 3N2KA 4IHJA 4TV9A 5GONB 5MN5A 3N2GA 3VOAA 5JCOC 1W5AA 4FFBA 4YJ3A 5LYJA 3WGJA 4DXDA 4LNUA 4WBNA 3RYCB 4F6RB 3VPAA 5KMGB 5J2UA 5LP6B 4U39A 5LOVB 4TUYB 4O4JA 1FSZA 2VAPA 4M8IA 3WGLA 4EI8A 3WGNA 5KX5A 5BMVA 3ZIDA 3JALA 5IJ9B 4TV8A 4HNAB 3HKEA 4X1KA 3JARB 1SA0A 4E6EA 3JAKB 4KWEA 5EZYB 5CA0B 4X20A 1RQ2A 5LA6B 5ITZB 4IIJB 4O4HA 5C8YA 5JH7B 4DRXB 4X1YA 3M8KA 3JASB 4U3JA 4ZHQA
chains in the Genus database with same CATH superfamily
1UOQA 5AJUA 3UY4A 5A9RA 4ESVA 1DAOA 1GM5A 3ZY2A 3DDHA 4L22A 1IOLA 2QZPA 2G88A 2W8BC 1PJTA 2OTCA 2COKA 3SR3A 3GCWA 3QMMA 1G8HA 4M1SA 3U3ZA 4A0QA 1N2JA 1FP2A 4E1VA 5JRZA 3CC7F 3FNGA 3N2YA 3I39X 3PNKA 4KR9A 3AM1A 3H18A 3PITA 1R8JA 2QPLA 2QLBA 3NW9A 2JIOA 3LUHA 3WSWA 2YWGA 1NIJA 4MUJA 3N2EA 1VGVA 5D3KA 3ZU2A 3THRA 5F1OA 3Q9SA 2RHRA 3W7BA 2Y71A 3ZLVA 2FN3A 2PA0A 4EW1A 4TTQA 3DQQA 3UMJA 2DKNA 4UNIA 1GD1O 3VR6A 3RK0A 1G59A 1XTVA 4LTDA 4OQNA 5D3MA 4L1KA 2FRVA 2V96A 3KXIA 2UXBB 2YX1A 3PX2A 4MV5A 3G9ZA 1S2OA 1GUZA 4W8OA 3AF1A 1U8EA 2QVCA 5EAIA 1D5WA 1RCUA 2TMYA 4ND8A 2ERYA 4QPJC 2XVMA 2QX6A 3D6FA 2ZI3A 2BGLA 1NJ5A 3KQMA 4HDKA 2D1SA 2UYNA 1F2UB 2GK6A 2NV0A 3R23A 3DZCA 1WE2A 3H6GA 821PA 4DHEA 4OSOA 5I8WA 2J4CA 2PRKA 1CUWA 4REQB 2Q8QA 1ZNXA 3E1GA 3K9FC 1HA3A 1G1AA 1A2KC 2D7JA 4OM8A 1F20A 2Y0DA 4ZAXA 4OL0A 4FYPA 1DRWA 4WBNF 1FXWA 3G9TA 1UFRA 3MWJA 4PSAA 4HTFA 4DQ0A 3KUXA 3ND7A 4K9LA 4CEJA 2IZOA 3ZGVA 3ZUGA 4L4XA 5KDOA 3H2JA 4LCEA 4IXDA 2H4YA 1XDDA 4ND1A 3MWDA 2EBFX 1L4BA 2HQ1A 2Z8XA 4BP1A 3IAM1 1MJFA 1X7GA 2V58A 3KFVA 3NUZA 4KOAA 5CDYA 4UVDA 1GPLA 4NCXA 3G6EF 3TLKA 1R8XA 3C5EA 3EGDA 3TL2A 3O8BA 4X3MA 1GPAA 2PO5A 3JQGA 1QGUA 4LZNA 4GP6A 3WQHA 4DLKA 1AQLA 5K09A 3CTPA 2Z2IA 1MOQA 2XXBA 1HL3A 4L5AA 2I71A 5DTEA 3W5IA 5ALUA 5K1ZA 4A9AA 1C1HA 3L8ZA 3ZCQA 4PC3A 3UMCA 3HJNA 4OP1A 3P94A 4JLBA 2BISA 2RE8A 4FB4A 3N0VA 4V38A 5B2EA 1QH1A 5CFNA 2AE1A 1R6BX 3I55F 1C0EA 4YXFA 3EULA 4RZHA 3I92A 2DFTA 1TADA 2ZULA 3QE2A 1SZCA 3OOHA 4AS1A 3BUSA 1EHIA 2CFRA 4EJSB 5KB3A 4I6GA 3RC2A 3FNQA 2XODA 4CF5A 3ZE9A 3ZVMA 2VPQA 2R5NA 4I1YA 1IYZA 3LUGA 4BNHA 4DMFA 2AX3A 3IEIA 3CH4B 1DCTA 5J2TF 5B30A 1N5JA 1L5SA 4UW9A 1IIRA 4CTKA 1RQGA 3HFSA 2VNKA 4U0JA 5K45A 5BVHB 3IT1A 2ZJ2A 1XK6A 4BEBA 2ZOVA 2FEPA 4BTVA 5U4XA 1G291 1EI9A 4H7HA 1HQKA 1NGSA 1FNCA 4URYR 9MHTA 2NPOA 3CYPB 3LKBA 2WIGA 4I9HA 1ZXXA 3UUGA 5KYXB 1UXOA 4CMGA 3AKZA 2Y9MB 1NVEA 1SZQA 2XIQA 2IOFA 2Q4BA 1GTVA 2BBWA 4DJJA 5TGZA 1JUDA 1OC2A 1J8MF 2YUTA 2ALJA 2PL9A 4HDAA 5AJWA 3ZCRA 1CHDA 2IYAA 4CIAA 1NFQA 2DYYA 3RYFB 2A9PA 4HY3A 3D3WA 2QAJA 4NPCA 1I2MA 1E9DA 1LX7A 4WNAA 1WZNA 3DPIA 3KPJA 3TSWA 1N2IA 3CG6A 6YASA 2ZJ5A 1A82A 1GGFA 3C3WA 4URFA 3SGLA 1SCKA 5T6MA 5B1EA 1RJDA 3IBGA 4QREA 1I51A 1P60A 5A0FA 1T2EA 1KVQA 4DXAA 3X1KA 2N0SA 5BSMA 1DUIA 4JJ7A 4QDKA 2JI9A 1V2HE 1NC1A 2WZQA 5FR1A 3T7CA 2J5QA 1IY0A 1ODEA 4X6LA 3TZ6A 2GLXA 3OQOA 2GLZA 1UPBA 1Z35A 2Y92A 3ROPA 4QDXA 3QEAZ 4MO9A 3WL7A 4M1MA 3WR5A 3A26A 4KFTA 1V5WA 2DH5A 3HB9A 4NCBA 5JO9A 5HM8A 1DOAA 3N6XA 4N18A 1G0OA 3AB7A 2ZRMA 2WSSA 1VCMA 1ZOOA 1ESEA 1JDPA 1O94D 2ZCUA 4WN9B 3E8MA 3W2HA 4B9AA 1N32B 3LQ4A 3QKSA 2H7CA 3CRRA 3IMGA 5HUQA 2FFAA 2GVDC 2ZIWB 3KUCA 4JROA 5CM8B 1L7NA 1UXIA 2ZB8A 4YWHA 1E89A 4KN8A 5LJLA 2EZTA 3PEVA 4R1UA 1HMPA 3GQBA 1HG1A 4IOJA 2CFSA 4J3JA 2BO1A 3LH5A 2DUJA 4I1SA 5DMHA 5C1OA 3FSGD 4DM3A 1DOHA 1OH6A 4OQZA 2PKQO 2ANCA 2ES4A 4Y0NA 3SSAA 3TAXA 3DULA 4CR6A 2VJPA 3EY4A 1KXJA 4MTLA 3EOBI 1Z8DA 1AB6A 4GC5A 5D85A 3FKSD 5EIHA 2E1RA 4GGOA 4OK5A 2JC3A 4U8GA 4Y2GA 3CPEA 2GYVA 2BTQA 1VG9B 2FN4A 1J23A 1DEAA 2FWIA 3H16A 1XUOA 2FLKA 3KRTA 5EIWA 1RRPA 1C7IA 1F4PA 1I13A 3Q8LA 4C4WC 1AKWA 4MV0A 4EL0A 2WABA 3KOMA 4P3OA 2EJVA 3QY0A 1DE0A 1G8YA 4MH0R 5FOWA 1JWLA 1L7XA 3PFHA 3LUAA 1J0XO 2V6FA 4MRNA 4NNOA 4Q3EA 5GV8A 1A5TA 4E5UA 3IIIA 4FJ0A 4R9SA 2PBFA 2VZ8A 4DDHA 3OC6A 4N7JA 3D8TA 1N92A 1YL7A 1JIIA 5C5CA 4M21A 1CVLA 5KNLA 3AP2A 7MDHA 1DV2A 4UVIA 4QPDA 4PBTA 3TRFA 1Q1ZA 4OI0A 2JIQA 3W34A 1N7IA 1UP7A 1YRLA 3PPIA 2BELA 4LZPA 1H94A 2AMJA 5D2CA 1OTHA 1JHPA 1ENZA 3VSDA 2PKCA 2JB9A 2QR5A 1C7EA 3A9SA 3C6ZA 3ESZA 3FDFA 4NJOA 2JF0A 1IXKA 4UMFA 2HF9A 4DM4A 2A35A 3FOEC 2OZBA 2ZE6A 3BA1A 3Q87B 3VNQA 3UT5B 1T2DA 3T5DA 4I4TB 1JIJA 1CJVC 2CCGA 3ECAA 3H99A 3MTGA 4XRGA 2HHHB 2ZR8A 5KYUB 1OB5A 1OH5A 1U1CA 2A33A 3AH8A 4ZQHA 3TXXA 3UG6A 5GJCA 3ZHSA 5CMLA 4Y98A 1Y7PA 4MLDA 1KQ3A 1T5IA 3AETA 1WX1A 1H9CA 2QJRA 1OV4A 2X7JA 4C5AA 1NMZA 3VDXA 1XRGA 3DLPX 3Q8WA 1P91A 3EWNA 3HYNA 3Q2OA 4WW0A 5I7WA 2J3LA 3RS7A 5BVGB 5TR9A 3LZ6A 5TMBA 4JJIA 5FLXM 1CJKC 1HE3A 5FWAA 2PX0A 2Z2JA 1ADJA 1UC8A 2O0KA 1KK1A 4YP1A 1GAQA 2E7ZA 2DWQA 3CPSA 4XGRA 3GVCA 1AQYA 2NMUA 1K7XB 1D6NA 1RI5A 2FFQA 2YW2A 3B2QA 1J24A 3DZDA 3HNRA 4IVRA 4Y6LA 5AM5A 1HT1E 2ZUFA 1F14A 1QZUA 4HYEA 2HBQA 1ZN9A 2PU7A 3NVMB 3QPAA 4HX5A 5HCIA 4B6PA 4UTNA 1JW9B 3L1KA 3OEWA 4M0FA 5H82A 1PW5A 1RBZA 3K70C 3FIUA 5CTJA 2BGWA 4MUHA 1XVVA 2ORYA 1VHLA 1IEWA 2HGZA 4XARA 2OTLF 2XUHA 2CSLA 2WFLB 3LW8A 4N6OA 4DQVA 4ZT6A 4LDAA 5G4KA 5T41A 4BQFA 3KHSA 3VVLA 3RH0A 4EUEA 3PA6A 4V02A 3BDVA 5EJAA 3NM6B 1YZUA 4OH7A 1OYVA 2I1LA 3QPUA 3ZHUA 4LF7B 4YLYA 4CMIA 4L9WA 4RADA 1QR6A 2GO1A 3ZE2B 3COPA 3PGVA 1YB4A 3A4MA 4L7QA 4MKXA 1HFEL 1IEVA 4Z1MA 4TKMA 3L0BA 4OKSA 4OXKA 1OZ0A 3BS4A 1IVYA 2G7ZA 1DKUA 3MHPA 1DRKA 4NCNA 4I8IA 3E3AA 1IBLB 3LL7A 1IPEA 1JWBB 4LOIA 4RTQA 1EJBA 4O4HF 2FH5B 3EBLA 4P0PB 1CB7A 4IX1A 3JAWA 1FSFA 3PUZA 2FQYA 3IBSA 1CEXA 5CD9A 1CQIB 1OZHA 3IVXA 3ZCSA 1XMSA 2G1UA 3F0TA 1EUZA 4BNMA 5BUSA 1TVKB 3CVYA 4Z53A 5TQ0B 2AG1A 4JBGA 5EI5A 4JI2B 4EX7A 2MU1A 1TB4A 4J1NA 1QP4A 2OAEA 4OQMA 3QTYA 4XAQA 3CEAA 3SJCA 4KUGA 1H6CA 1ONPA 2LP4Y 1YB2A 4NABA 1XTBA 1K7EB 4E5DA 5A3QA 1XYYA 4LWPA 1SXPA 2VHQA 2CLEB 2ZJ1A 2Q4TA 2X19A 4GYKA 2GM5A 2IVZA 5KWEA 2IXTA 4DN6A 1MU0A 4M8KA 2CLOB 4W5WA 4Q3CA 2C99A 1UZUA 3BXZA 4DLUA 5A6VA 4RANA 4DUGA 3STYA 2QBYA 4WFKA 3TRIA 3LKDA 3I1IA 1JB1A 3T3PB 5L40A 3TNYA 4BFUA 2ZG6A 4M99A 1T0HB 2PZMA 5BR1A 5CH3A 2A5JA 5BWMA 2BJVA 4MP6A 5SZHB 4KWIA 5LWQA 2JLZA 3K0KA 1DU4A 3O2JA 4US0R 3DWIA 4A15A 2R86A 3KEGA 4XQ0A 4RM3A 4Z9FA 3ZHBA 1FDIA 3OHPA 5KNCD 2LTAA 4IO1A 4FTWA 3Q3IA 1F9AA 2IV7A 2ZVJA 4YRJA 1N9KA 1XO1A 2P2NA 1AUVA 4NPAA 3DWFA 1CJSA 2G17A 2W2TA 3LDTA 3SR0A 4KQEA 3VUEA 1U02A 1AB5A 2WFAA 3TW4A 5F9HA 3AZPA 2UUAB 2CL0X 2I6SA 4H3KB 2QPAA 1PZMA 4LBZA 3NLLA 2B1RA 3BDAA 4B44A 1UJMA 2X4GA 3R5XA 5JR3A 1W2WB 1YR2A 1Z16A 3ME5A 2ODPA 4YMWA 4AO8A 4HLCA 4CF7A 1FB5A 3F9RA 5DLQC 2M1ZA 2GEFA 4NFSA 4RHFA 4ERNA 1JHAA 4TMVA 3UQZA 3QEJA 5G1NA 3HA2A 3JZMA 4MUAA 2WKSA 5HUJA 4UHDA 3F4LA 3ZWMA 3L8HA 3DE1X 4ENTA 3E2PA 1N9ZA 2IU4A 5AW6A 2DYKA 3L1IA 4EW6A 1OREA 1E7SA 3W1VA 1WJGA 4RSHA 5L3QA 1RHKA 3W9UA 1Z56C 5DISB 4ZCSA 4D9HA 1I7PA 3KXLA 4RXTA 1Z2NX 4PYJA 1D2EA 2UYOA 3EVBA 4IUBS 1EM8A 1N8TA 4HV4A 5KTMA 3TW0A 2PZGA 3EGCA 2FZKA 2C8VA 2Q5IA 5H3LA 4FOLA 3DOUA 3P7MA 3DBIA 3UB2A 2CFIA 3C1TA 1LI7A 3IR9A 1K6XA 4JYAB 3TJZA 3THXB 1J7KA 3HNOA 1CZNA 4EF6A 1OKKD 4IUCS 1QE5A 1UWKA 2RI6A 2WWHA 2GAIA 1E5DA 4Q9NA 6LDHA 4F04A 2V6IA 4HK4A 1ARZA 2XE4A 3HBLA 4JQYA 4YPVA 5A5EA 1RHRA 4ILEA 4ZWNA 3SYNA 1QJCA 5K3DA 1KE2A 2CVPA 1BJTA 4QPZA 4PYMA 4HWGA 3MQ4A 3WNQA 1TRKA 1P3Y1 5HY0A 3L6DA 1XMXA 4KQXA 4KBGA 4RK5A 4QYSA 2XUZA 2P2DA 3KXDA 1G98A 3U6KA 2NIPA 2O57A 3ODPA 4V1CB 3SVLA 4HLUA 1E2PA 3KX2A 1LQTA 1ULHA 1BXZA 2GHRA 4U3JB 3AUTA 3O4GA 1KQGA 3AGPA 1DIBA 3ZHXA 4OGFA 1W6RA 3A37A 1T9AA 1DFHA 2YJGA 1QGDA 2J32A 1OR8A 2HJWA 4HQ6A 3M0EA 4N3CA 4QXOA 2CMFA 4PZUA 2CMHA 3GA5A 1WQ3A 2QE6A 2FSGA 3TW8B 1NPYA 3VYRB 3NBYC 4XQEA 4JIGA 5KHOC 3EYWA 1FRNA 1LXCA 3DL7A 3A31A 3V8NA 3WP0A 1JF8A 4K6MA 4D45A 3PLAC 2Y1CA 2EFJA 2W6OA 1GITA 4UCWA 2BUBA 2QRLA 4ZVMA 2JI6A 1X80B 3JD1A 4L5YA 5SY6A 2O2HA 1UR5A 4EHAA 1ZVKA 2YWJA 4N03A 1KMCA 3EGEA 1Z06A 4GBJA 1YJ5A 1N1MA 2P0AA 1B41A 3NVAA 4INAA 3V1LA 2NX2A 5C4IA 4QGSA 1ST2A 5CEFA 3CNOA 2WJAA 3TSZA 4QBFA 3BWEA 3K0FA 2QWXA 3D4LA 3CMMA 4MVJE 3ASUA 3L43A 2C8JA 4KBYA 4WACA 5EWLA 3VC2A 1AA6A 4IJWA 2X5XA 1R9NA 2HDHA 3GR6A 1ZGHA 1KERA 1PNQA 3EFOB 5SICE 5TV2A 3VZPA 5FV4A 4OM7A 4IDCA 2ZCJA 4A4DA 4WVFA 1KZGB 4HWKA 4O0LA 3L5KA 2WTBA 4FDTA 5BSRA 3TLGB 1A9OA 3JQQA 2ZI9A 2DJ5A 2XNDA 1D2NA 1XXHB 5EP4A 4M9SA 5JAIA 2YDXA 1M0WA 3IHLA 4WD3A 1E2KA 2FJUA 4NYMQ 4V0KA 5JXIA 1ONBA 4F84A 1YJ8A 1ZAKA 3CO0S 3VQTA 3WHPA 3QHDA 3EDOA 4Z7QB 3SIUA 2QTBA 3R0QA 1Q86H 4LQLA 4JXZA 5TQ2A 3DP9A 5LXTB 4HAIA 3G2HA 4DY4A 1B43A 2IPOA 2REQA 1GZSA 1KI7A 3ZXSA 2C2GA 3NVKI 1I3OA 4L3OA 1FTQA 1Z6YA 4BFWA 1YIAA 4Q9LA 3DLTA 1IN7A 1FYXA 3KJFA 4KXVA 4G5RA 4G0OA 1UQRA 3LY9A 2YZKA 3GLKA 4H1TA 2UUBB 3IELA 1EAYA 1GNLA 2FQQA 3TTTA 1NSYA 4RM2A 1ZNYA 4TVSA 2WP8J 1NUHA 1WMBA 3NHSA 4YQFA 5CBKA 1I4TD 3CO5A 2VXCA 1JBEA 2KYRA 3V32A 1QVRA 2YASA 4CM9A 5F7XA 3VR3D 1OI4A 5FUXA 2FW6A 1XCPA 3E7FA 5KYVA 1NM5A 2EKDA 2R47A 5CDGA 3ROZA 1HLFA 4J0JA 1JVBA 3ELWA 4UD2A 3PG5A 2YBDA 4W6QA 4B6RA 4DT1A 5H81A 4O6VA 4O4IA 3I5XA 3K2XA 2IZ6A 3KLPX 1IBSA 5DNCA 2GJAA 1HX7A 1GZ6A 1IAQA 5AKXA 1SAYA 2BF4A 3UT5A 2REXB 3KE1A 1TF2A 2QYOA 3GY0A 4TM7A 4G25A 3CM0A 1O9HA 2J9YB 221PA 1CSEE 1E2DA 3DC7A 4MEAA 4FMDB 4LK2A 2OBFA 4EG6A 2YINC 5BYBA 2ZP1A 4OFZA 4YALA 5F1PA 4EDHA 2C5AA 4EG3A 5BQXA 3OLWA 1UZLA 1VCIA 4P1ZA 3ITKA 4Q9KA 1T5HX 4Y9DA 4XFDA 4ZT5A 4UU1A 1O95D 2WPDA 1P7YA 4IPTA 4RV9A 5LBIA 1L5OA 3FZQA 3SE7A 3ZBUA 2I6TA 1CF2O 4TYMA 4P80A 3OCZA 4R2XA 4CV3A 2ZVQX 3UTCA 5DX1A 3S2ZA 4PZ9A 3AOEC 3DDZX 4J49A 1YASA 3BZWA 4D9MA 5KDDA 1XRPA 3GJRA 1U1IA 3P9PA 3LYUA 3BKWA 4KRGA 1L4GA 1QH9A 1A98A 4EGSA 1G20A 2R8ZA 3AHEA 4E7OA 3U4QB 3SS7X 3WGNA 3GA7A 2JHPA 3MAAC 3RRZA 4N3GA 1YJBA 4PZDA 4IY1A 5ERGB 2MJLA 2VSYA 4AJHA 4MQ4A 3AI1A 4N0MA 4WESB 5HIAA 1QO0A 3N8GA 5LD2B 1UMDA 1PSWA 4G0WA 4GP9A 1WPRA 1YZHA 4KAJA 4U7JA 3PPWA 1MEOA 2UYKA 2IHKA 4G09A 3OM0A 1F0NA 2F8MA 1YJNF 3CWZA 4DJDC 2EHJA 2GHQA 2Z58A 2JH3A 3QBEA 5FD8A 3LPLA 5TEWA 1D1TA 2IHUA 5TVKA 3KQHA 1SK8A 4LMBA 4R83A 3S29A 1VH8A 1POWA 4RIFA 4ZYZA 1UBCA 5L9AA 1DPFA 1TQ4A 4KC0A 5BSGA 5K9ZA 5CNKA 3DQZA 2HK9A 3ZDBA 4F97A 1X19A 1KPHA 1PX0A 1AZSC 4LY0A 4QUIA 3NBMA 1N2CB 4CKCA 3ISJA 3IEQA 1RBYA 3WGIA 2FQ1A 3CURA 1ZRNA 4A27A 3UA4A 4B7XA 1FX0A 3MWLA 4KX3A 3C9UA 3QW2A 5AM0A 4DGQA 5CVTA 4ZHWA 1G6HA 1WKVA 4M0EA 4Y1RB 1W0KD 1G38A 2ZWPA 2CGEA 5H80A 3C8UA 4R0MA 1SKMA 3QUSA 2W6CX 3T5PA 3QXSA 3O8CA 3ACBA 5P8WA 2GFHA 2HCRA 2GK3A 4UEJA 3AJDA 1OBFO 4TTSA 2V5UA 3ICEA 1HOXA 1OWMA 2CDCA 1IONA 4M38A 1YK0A 4Q9DA 3OZUA 3PTLA 2H6LA 3RSGA 4KU4A 4BNNA 1WMDA 1AVTA 4INPA 3MJVA 3E7DA 3E7PA 4U7TB 1KY3A 1TF5A 1XZFA 1DC8A 3DWGA 3EZ6A 4GXTA 4BMYA 1T10A 2IPAB 4G0YA 3FMPB 1XTUA 5DHSA 2PSSA 1BX0A 5K0SA 4BNTA 2I1WA 1MR3F 4C9BA 4L72A 5B4UA 5AVJA 2XEXA 4B3IA 3R40A 4BDTA 2ZRCA 4BRZA 2YY5A 1T1RA 1QVVA 2C2ZA 1PL6A 1VKJA 3G85A 5FPQA 1PWHA 4U0KA 4RSRA 3TXAA 4PLZA 2GXQA 1M1YE 2VSOA 1CVIA 3BRCA 4Y2QA 1COWA 3V1UA 4PBSA 4ZOQI 1GPJA 4G41A 4QM7A 2GVZC 3CZCA 4LHXA 4V0QA 1ZUWA 3HPRA 3P0JA 4KCGA 4KIWA 4NJMB 4C78A 5GWXA 1Z4MA 4ZQBA 1RYEA 2C2MA 3ZEIA 2Q21A 2M6LA 1EMDA 2CFOA 2FEKA 2GEVA 4X92A 2WSYB 4XCXA 3N07A 1XL1A 4NP6A 3T0FA 2YIJA 5LMCA 1GU7A 1S2NA 2AFIE 4KR0A 1O54A 1ISIA 1U1EA 2XD4A 3KNZA 2PUHA 2OV8A 2Y4NA 1LTKA 3IBYA 4RQOA 2BJWA 1MQAA 2PMEA 4E31A 5CLJA 1L1FA 1PTJA 2WF8A 4E30A 4RZUA 4ERXA 1VMEA 1Q57A 3E1YA 3F5DA 3LVRE 1AN0A 1W5AA 3S5UA 2HN9A 1COMA 2JLXA 2GDZA 4UU8A 4WZBA 4YUVA 3O3OB 1EDZA 3Q3HA 4G4WA 2ZWVA 1KA9H 4Z0TA 1WB9A 3QV1A 3I64A 2GEJA 3HDYA 1RYHA 2UYCA 5THQA 1A8QA 3CX3A 5JY6A 3FNHA 5KWSA 3CCUF 5DLEA 1K8XB 4DDKA 1T0KB 2HJ9A 3IDZA 5C32A 4MITA 1XZHA 5B7NA 1PZXA 4ASUD 3HJCA 4IG4A 2E89A 2HRZA 4ON9A 4C0AC 4OHOA 3JQEA 1GO0A 1Y8RB 5DEOA 1DG1G 4FYIA 4E11A 5L3SB 2V0CA 4GOKA 3O8LA 4QXRA 1NXQA 1QNFA 3AESA 3CLVA 3RT7A 2NNLD 4XEUA 1QQTA 1GQYA 1NRWA 4FKZA 2WY2D 4A1OA 2XCTB 2B0CA 1SVOA 3MD9A 1U8ZA 3AIKA 1H0KA 4YH1A 3U49A 4L76A 2G1KA 3QQ5A 4LE2A 5HBGA 4BVKA 5LZ4A 4FMCF 3ZHTA 2BCGY 4KXWA 2IODA 4MKHA 5IJAA 2GD6A 1IK4A 2VHZA 2UYQA 3CF0A 3V42A 2OO5A 4BVLA 3JU3A 2DTXA 1JG1A 2WU1A 3F74A 4QGHA 3TIXB 2C4UA 3ZU4A 3EDMA 4DLNA 4QBHA 4O02B 4XEHA 1ZNZA 3JSXA 4HZUB 1U0JA 1JAXA 4TL6A 5HZMA 1LWNA 2E87A 1E7KA 2FJ0A 1ECPA 3A6HA 3RGGA 4D0NA 4FQ5A 1KEWA 4E3ZA 1ILEA 1H48A 1RU3A 2QLTA 3KKEA 4FX5A 4UEOA 1KOGA 3OM8A 1XPJA 2PAAA 1D9XA 1O03A 1JXAA 3RVBA 3USCS 3QE0A 2Q3BA 3U3KA 5JISA 1NW3A 5TC4A 1X1RA 3A6KA 4M1KA 4QGGA 1O08A 4RPGA 3RT1A 5FTWA 1TQDA 3HWSA 4I4IA 3RR2A 2WB4A 1NU8A 5FADA 2GX6A 2PWBA 2XHZA 3C5CA 4WOCA 4OUKX 1RYDA 1Z28A 3WJPA 2PT9A 3F7MA 2QT9A 3VR5A 4YAJA 4HN4B 5DBFA 3VR6D 5FBQB 2CMGA 2GT1A 2JK1A 4H17A 3DMFA 4M9CA 4XD7A 4E33A 3N86A 2FMFA 1MABA 4ZVLA 5I4KA 4FWTA 2WM9B 4KMRA 3A4YA 3F7TA 5K4GA 2VDLB 3IX7A 1Q92A 4I2NA 2I8LA 2ZRQA 5PNTA 3KS9A 4KAXA 1J9EA 1IFXA 2OCYC 1ZY2A 3C5WP 4TXJA 4H59A 3SY8A 3T52A 4B2LA 4YRBA 1N4DA 3V9PA 4IDFA 3WRVA 1XRQA 2W4QA 2BZSA 3EGVA 1WUKS 3DW3X 3H04A 1W0JD 3AVUA 4R51A 1W7AA 3VR4A 2REOA 1HURA 4ZCTA 2O8EA 3CRVA 1DOZA 1K08A 1ORRA 2MYUA 4HDRB 2GZ1A 1C0LA 2CBGA 1KPIA 2OG1A 3IP3A 3NBQA 3ZE8A 1EIWA 5IT5A 4CM4B 1OBHA 1J0EA 1U6KA 5H9WA 5K8TA 1MJHA 4HFMA 2W6MA 1A9XB 1F0YA 1T9BA 4B34A 4MOWA 4NIMA 1Z33A 3MMSA 1FQOA 4MROA 9LDTA 3QLEA 3UQYS 3T5AA 1MEEA 4V0MA 2VP4A 3GUYA 5DI3A 5PGMA 1W93A 4BB0A 2XT0A 2CW4A 4OHRA 4HH1A 2QT1A 4AMZA 4DDWA 4M54A 1JQLB 2EFHB 3ZYCA 1T36B 4E4TA 4HAUA 4FFBA 3K70B 2C03A 3UENA 4P35A 3EXEA 3AF5A 3FF4A 4CQMD 1CZRA 4DPMA 1TM7E 1M2NA 2TSYB 2H85A 5JQWA 2Z0MA 1PLJA 4OK6A 3A70A 4QDTA 4O4JA 3KTDA 3UK7A 1EZZA 2PQMA 3T5BA 3DTNA 4F5YA 2VJLA 3OPQA 4Q7EA 1TIKA 3LFHA 2XOKD 5KYYB 1JQKA 1QM5A 2X40A 1O87A 3BWDD 1OLUA 2FN7A 3NATA 3RSZA 1YVPA 1AGRA 4MPPA 3KHKA 2NM0A 4YNBA 1XZGA 2CHSA 1KJJA 3FFXA 2Q5CA 1XZQA 4K81B 2G0AA 3BMXA 5BT8A 3HYTA 1Q82H 3KR0A 4J0HA 2J9RA 1I2BA 2W8BA 1SCIA 2BM9A 3HDJA 3MC1A 5HFNA 1ONSA 1BXGA 4HNGA 1JSXA 1P6QA 3WP1B 2R0QC 1RYNA 3BICA 4DV7B 1ZIYA 3C24A 3H11B 1E9BA 1YUMA 2B0JA 2XCLA 1IY1A 2HJSA 2RAPA 5CH5A 3JQPA 3MLBA 4ZU1X 3REQA 2AYYA 4ETWA 1WTAA 4J4HA 3OQBA 1YCFA 2JJ2A 2Z9DA 3BSSA 3CE6A 4DYVA 5FOSA 3NGLA 5IT9A 1C9NA 1GZ7A 4UQOA 5HBRA 2BKLA 3IH5A 1NNI1 3KE8A 4Q1FA 4HRYA 2AI3A 1LLDA 4PYOA 5K3SA 2DKFA 3AC0A 1ZPDA 4KR2A 1IQ0A 2EERA 3ZE7A 1CK4A 1DB3A 1KI4A 1Q74A 4IH4A 4JYBA 4Q66C 3TIFA 2EJCA 4RLQA 4EA8A 4EITA 1L4UA 1ZI9A 1TGYA 4OCZA 3HY4A 1XP8A 2H63A 1P72A 4C22A 2JAOA 2W42A 1ZUNA 1SWWA 4GR4A 4YVFA 2XB2A 2OCIA 8ATCA 3DUFA 4C2AA 1RAHA 2BN4A 4QGFA 4MWZA 1P44A 2AD1A 2P0YA 4G4SO 1L1RA 1OSNA 2J9FB 4HH0A 2Z3VA 1SOUA 3WGUA 3MHTA 1CZKA 1H9BA 3O5AA 3AF3A 4EYOA 4A5OA 1E7RA 1EKXA 3EK2A 1SUEA 1FC0A 1UAYA 3G89A 1TFRA 2FW1A 3SEAA 4WE3A 3U4QA 1PXWA 1OX5A 4JC4A 2JGLA 4PLHA 3V4RA 2YJ5A 2V1UA 1SHKA 1ZO8A 1OQAA 4XCVA 2H29A 1RXIA 1ZWKA 3GGSA 4JH0A 1QF9A 3EYAA 4O8CA 1IMJA 2ZSAA 1ZW6A 5CXUA 13PKA 4WBNB 4N54A 1JT2A 2AOXA 3TDKA 1K88A 1GGNA 3WLHA 5JXJA 3G9XA 2O6HA 3D4PA 4R54A 3CMAF 1GNSA 4AF7A 1KZ6A 1HZJA 4TOIA 3OQPA 4WOJA 2OQVA 2FSSA 3DHEA 2GARA 2NQ2C 1Y6ZA 5EKXA 2A1TR 2JFVA 5BMVF 5B7QA 1BVUA 1YDMA 3AUFA 1H3NA 5KJFA 4JSTA 3JALB 1IDN1 1QFZA 1NLFA 4MV7A 1E3WA 4QL3A 2WTUA 4J4TA 3FA2A 4HLQB 3W2FA 2XMBA 1O0CA 4E13A 3L02A 5ADHA 3UV7A 4EIWA 4GVLA 4JASB 4HQOA 2OENG 1XFDA 3T3IA 3F71A 3LLVA 5GY7A 4HBZA 1PJ4A 3TD2A 3UWKA 4EB3A 1RHUA 1P5JA 3BCHA 4RVHA 1QZZA 1P75A 1WCYA 2GXSA 5HF9A 1E6CA 4XE5A 2ONCA 4DA9A 2JJ1A 2P65A 1I3LA 1IY8A 1MIOB 1NFFA 3HTNA 3M81A 3QJYA 2FQXA 4R5HA 4JEUA 3IR6A 4EK9A 5A62A 1DKLA 1R37A 4XWOA 1K63A 4ZVNA 5JJCA 4R40B 2CFCA 1H4TA 2EKLA 2HMWA 2VBCA 2JVJA 3BX1A 4UNSA 3SK0A 4BQOA 1SEPA 1C81A 3ZEAA 5HVNA 2YJTD 3THWB 4Z4IA 2DUWA 5DBEX 5KX5A 3GPLA 4GOMD 3RFXA 4XD2A 4GLOA 2LCFA 4GXRA 1SKYB 2GBLA 5B53A 4RHAA 4EZBA 5JNVA 1RP7A 1KO8A 2B94A 3C6XA 4XJVA 1Z7WA 1OPXA 4IINA 1OVGA 2XUFA 4KXUA 1T3LA 3BGIA 1ESDA 4BW0B 1M7HA 3U4HA 4IW3B 1Q1EA 1U81A 5DMXA 1P9LA 2EFEB 3HI4A 3HXTA 1JQ3A 2LRHA 2UVQA 4XWWA 3LKVA 2JFXA 3OTHA 3ANMA 1TT5B 1E1KA 5CR9A 1TK9A 4XA8A 2BM0A 3O73A 4YJ2F 5DLYA 1CLEA 3W6OA 4CLRA 2FMIA 1YHZA 2D06A 2Q1WA 1OI7A 1L2TA 2E82A 1R5BA 2ZAUA 1L3BA 2DSNA 4CYMA 5F73A 1P61B 3KV3O 2FW0A 4FINA 3RHZA 5HZGA 1PV4A 2ZPAA 3UGQA 4N5HX 5ERXA 1SBTA 2O54A 5DT2A 3I58A 2C20A 2QMZA 2W48A 2CHFA 4DSTA 1PFGA 2W8ZA 5FWYB 3WK4A 2LKDA 4CHGA 3LLUA 4CLDA 1HT0A 1Z2EA 1G5RA 3BKXA 4PW0A 1VOTA 1ZRMA 1OASA 3O9ZA 2RB9A 1RCFA 2H16A 4QJ5A 2C9BA 2PLAA 1OI3A 4XFKA 4ZEWA 3AERA 1ISHA 5FFFA 2FMUA 2XE6A 3PFWO 2G25A 5F64A 3WX0A 4BV8A 5BNZA 2AR9A 3LQYA 4G63A 3FDXA 1I6WA 1NATA 1ZOLA 1A0OA 2OO7A 1VIVA 1M1XB 3KAKA 3RRJA 4TPKA 1ISSA 4TRNA 1NW6A 4O8ZA 2AFHB 3ED1A 2E0IA 2WU8A 4FFMA 4MQUA 3TXYA 1PEAA 2P77A 4CXMA 1X1QA 4B5LA 5EHZA 3IR5A 4LOHA 1AV6A 3HKBB 2HGSA 1S3FA 4LXIA 4NZMA 4XQGA 4BKRA 4QPPA 1IZ0A 5KNDA 1JHQA 4OLHA 3HVKA 3SP1A 5BV7A 1J00A 2X3YA 2FHPA 2EEZA 1VSBA 3U44B 2YY7A 4M8SA 1WMFA 5F5XA 3TECE 1NZDA 1BAPA 2NPIA 2WJJA 3TJMA 3ZIAD 4WH0A 2FPXA 2DY1A 4HSEA 4WSOA 4UUOA 1JKMA 4YGXB 4EI7A 2H57A 2OV2A 3G79A 3RARA 2YOHA 4ZYWA 4UNQA 3HACA 5LMZA 5FNVA 4CQMB 3PNQA 4CKEB 4C07A 1ZMTA 4C8GA 4OHMA 5BSKA 2I55A 1DAFA 4DZTA 3ZDQA 1N8SA 5T6BA 2DPGA 1O96A 1YZFA 2BGIA 2PZBA 1FJ2A 1RXYA 3O8OB 4RHCA 3D01A 1SVIA 4RGVA 3SSOA 4YRGA 2GO7A 3EWAA 3WY9A 1SY7A 4M0UA 5G0UA 4N5LA 2BUAA 5ENDA 4NCAA 4YJ3A 4YBZA 4LNUA 2O2GA 4Q12A 1H2EA 3AXSA 5JJKA 1MH9A 4YY3B 1EX6A 1T4BA 3FPIA 1WD7A 1A9YA 4ZIRA 1M7BA 1J33A 1V3UA 2PUTA 2YFHA 2MINB 1U80A 3LW7A 4RX1A 5JJIA 2FMHA 5AVWA 3KZXA 2QZ9A 1YQWA 2VNHA 3G2IA 5FOXA 3I72A 5L3VA 4IZOA 1LW7A 4Q4LA 1PR0A 1Z8HA 3AI7A 1Z74A 2BP7A 3A1DA 5EAZA 2GCIA 4JI0B 1NOIA 2X13A 4BQNA 2WSBA 2N47A 3Q2KA 3LGSA 4IYJA 2H51A 2I4IA 2F4NA 2QMOA 1C1DB 1O89A 1Q3TA 2RHBA 1DAKA 1L5RA 3IBCA 4DRZA 1FLAA 5BQ5A 5CH8A 1OBVA 4FVTA 1JQDA 3OIUA 2PXXA 1J39A 3SZGA 2PPLA 5DV9A 1Z4OA 2Q6KA 3ANNA 5JALA 4L6IA 4ZU3A 1F8FA 1O6BA 4BFLA 1W36B 5IJ0B 2OZLB 1H69A 3SEQA 2MSCB 4QBIA 4OJMX 3B13B 4HH3C 5BPHA 4TZTA 2F2TA 1GX1A 3COWA 2QTCA 3P0EA 5DCWA 4CTJA 4RD3A 1VP9A 1OFTA 1SIUA 5LQSA 5KC8A 2VT6A 1DAGA 4Z4HA 3VHRA 4IJ5A 3U19A 3U37A 2AN9A 3WKBA 2EHDA 5AI5A 5EIBC 1SXJC 2VRBA 4RV4A 4IDAA 4WNYA 4X7MA 5ELXA 5K6AA 2FOXA 4NCKA 5EKSA 1CJBA 5IG2A 5HJ7A 5IWCA 1RR6A 4ZYVA 4B32A 3BVPA 3IUBA 3PWZA 5I7OA 5LZ9A 1QG0A 2C31A 5E1BA 2G09A 3QU5A 2H1FA 1N6LA 2OXIA 3TSCA 3VO8A 5AW1A 1W4CA 3I4LA 3G49A 1EFCA 2UZ1A 4K9KA 5LBTA 2BEUA 2C4WA 4Y6QA 1DADA 3FRHA 5GP1A 5ALDA 4F4HA 2C92A 4LECA 3PJRA 1SUSA 3I34X 1N5OX 3GRZA 4BLTA 4B3RB 8OHMA 3VO2A 3DB2A 4Y8VA 1T6ZA 3RTBA 3UGKA 5KYYA 3N2GB 4RPJA 1TD1A 4PS1A 2XBUA 4TMWA 1QDUA 2G9UA 3OFND 4NBLA 1NF9A 4LGCA 4WL0A 3I9OA 3TG8A 2K4MA 1M33A 1LK7A 1NR5A 2VWPA 3CLTC 2GLUA 3FPEA 4JGBA 3DT6A 4ZHVA 2NU9A 2B82A 3O1IC 4KE6A 4U7PB 3G5AA 3HSSA 4FHGA 2ABWA 1YQXA 2VHCA 1JLHA 3CC8A 4PG5A 4UUMA 3T54A 1DHRA 1G17A 4G85A 3JRXA 1XROA 4LZOA 4K7JA 4H0FA 3RSLA 4F8JA 4CMEC 1X42A 3B6ZA 4LJ8A 3PVCA 3EORA 5B1IA 2C9ZA 1UQUA 1V7CA 3KTOA 3PRHA 4ZQIA 3QMWA 4OL9A 1WW8A 2VPWA 3EXG2 4ZV4A 3ZU3A 2LBWA 4YXWD 2QRNA 3O2QB 1JG4A 4QFBA 4S1NA 5HFAA 3F0DA 1HTTA 2D1QA 3DL0A 5ED4A 3HJWC 2QK4A 1SKUA 1WVMA 2BGMA 3ANXA 3TCXB 3SG0A 3G0DA 4EFLA 2QAIA 3TBHA 2H11A 5ALNA 4PG8A 5HZKA 2JBHA 1SH7A 1U31A 3GDWA 1LK0A 3A1NA 3PC8C 5DNEA 2L42A 2DULA 1MX1A 2J31A 3LWZA 3E61A 3HHPA 4P93A 1R4AA 1PT6A 4LK3A 4EG1A 4KYIB 1JG6A 2F43A 3BWVA 2L82A 1ISFA 4MWSA 2PSJA 2QX9A 3RIHA 1IUKA 4EMUA 5IN4A 3IOYA 1TQ8A 4GRAA 1B6TA 3O94A 5G2OA 5EZ6B 3UHPA 3ZY4A 4E5VA 4UNRA 1J22A 1VLMA 2B61A 1I1QB 2Y1DA 3ESYA 2XADA 4AWBA 1RE0A 3H6KA 3I04A 3Q0IA 3QWFA 4ENQA 4BMDA 1IB0A 3FCSB 4LI3X 4AK9A 1GKLA 3S2FA 4EY6A 3N0TA 4EHIA 5HQTA 3DZHA 3VGPA 4JLAA 3UHFA 1JECA 4HQKA 5AKKA 1I01A 1AXGA 3LXRA 5HRAA 4GDMA 4HS9A 3R3HA 3KDPA 2QLLA 1DJLA 3ORYA 4YWJA 5ERYA 3E58A 1Z4LA 3F6BX 2DBZA 2RAUA 2BFCB 4Y7CA 2YZMA 3D6HA 3K6SB 3GYQA 4JUDX 2JFNA 3IRUA 4XTRA 4Z7OB 1QX4A 4OBWA 4AJIA 3LXXA 4CKYA 1XCGB 4D6YA 1NBIA 1H4VB 2ZSHA 1B0ZA 1C9MA 4PRLA 4QQRA 3RVJA 2RHJA 2FPIA 4NEHB 3GLFA 1MFPA 3EXIB 3ZPXA 3RU2A 3FZGA 1X3LA 2YS6A 5ES3A 1JG7A 4RQBA 4YFVA 1WRBA 3VGJA 3RROA 1PCXA 1EE2A 2RHCA 1SBCA 5KYKA 2MSEB 3DEZA 4O1IA 4UFOA 4EJ2A 4BVHA 4BVJA 4AZ3B 3S6JA 4PXYA 5CBPB 4M83A 1UMBB 4MGHA 3RCBA 2CHQA 2BKVA 2TYSB 1QO7A 2BFEA 3LVBA 1U90A 5JATA 1MZVA 1OILA 1MIHA 3DCJA 1XYVA 2XW6A 4MS3B 2IC5A 2X0KA 3I61A 5KNBA 2ZVPX 4YCNA 4FZJA 1K3TA 1GNPA 2W2XA 3E35A 3CEHA 3HUUA 5MGBA 1E2IA 3BGSA 2ZREA 4FI3F 4HJRA 1L7QA 4H7EA 3IT2A 2BFWA 4D9KA 3R7WA 4TGLA 4C21A 4CM9D 3SZMA 3DLHA 2C3YA 4AF6A 2DVMA 3WHKA 3S2EA 4A7PA 2H65A 1GZ4A 2ZPUA 3A06A 2L26A 3FWKA 3EZGA 1W40A 4LJSA 4HFRA 4ZALA 5JHGB 2GFIA 4TV8F 4XUGB 4TZ6A 1GA6A 3I09A 5FBHA 4PQGA 1S7CA 1CNEA 2H2FA 4V24A 2IW1A 2HQOA 5B5SA 1G21E 2J9GA 2J33A 4NBVA 4RDIA 4ZOBA 2FZ4A 1OI2A 1G19A 4D3ZA 1TZKA 3FHJA 4X94A 2IH2A 1T8SA 2A0YA 3VVMA 2PT7A 1BGVA 2KQUA 1JH9A 4BVTA 3AMVA 4ZHQF 5ITWA 1KRXA 2JW5A 1T5LA 1C0KA 1XAHA 2XUPA 3AG5A 1F4LA 1ZH4A 4Q21A 2Z6VA 3M4XA 1NJIH 3CKLA 5JCOC 3CUSA 5KI6A 2V54A 3YASA 2ZZMA 3EA4A 1T0AA 2VFAA 3FVVA 5CDHA 1H2WA 5AUOB 5J4VA 4BQQA 5GADl 4RA6B 3GL9A 5CW2A 2GTHA 2PN1A 1KE1A 1N5LA 2F62A 1Q7BA 2NQ8A 3TLJA 4AXBA 4C4TA 5E7MA 1J25A 3QX9A 4WOKA 5FOTA 1UBFA 2PU5A 4O2LA 1JE1A 1FFDA 1BJRE 2AK3A 3OOJA 3PPXA 3SI7A 2XUJA 3CS3A 3DBLA 2R6CA 4BPRA 4ZDJA 3RUFA 1KWGA 3BHIA 2O1EA 1CF9A 1YMUA 4MO2A 3RLIA 2YWHA 4FYYA 3P2IA 4C05A 3QH4A 2WHPB 3UPDA 4C7MA 3CIFA 1XHLA 1LZKA 2AKAB 1UBUS 2CDBA 2CLIB 2JZCA 2VUTA 5C18A 2BWJA 4MB2A 3C97A 5FBVB 3HKBA 3COZA 2GETA 5CVEA 3P2JA 3TX6A 1QO0D 4C2BA 3TL6A 4ODIA 3F8SA 4HL6A 2WMDA 1Z82A 1B00A 3T1HB 3L92A 3D02A 4GL4A 4B3MB 4C1BA 4LRXA 4Z7JA 1D2HA 3W2GA 4DQLA 4EVQA 4JI8B 1UOPA 3H3JA 3LFUA 3B2EA 4PFSA 4XKJA 4B3BA 2EJTA 1T0BA 5KTYA 1DKPA 3ZWPA 2AXEA 4WK4B 4G9EA 3UMMA 4UTPA 1L7DA 1US8A 3ESAA 5A4MS 1E9SA 1MJGA 1VJRA 2PE5A 4JLPA 1GRVA 1BKDR 3ACDA 4JOBA 5BRJA 4NZOA 3OJWA 4QJBA 4KI0A 1X9HA 3OWOA 2A9JA 5IYZF 3T3NA 1BDIA 1J90A 2C3PA 3GT3A 3R1IA 4ZVPA 5A7FA 1IXSB 1KEKA 3EF0A 2QRJA 3IESA 4ISBA 3HYCA 3GJYA 1IOVA 3T4UA 4IIVA 3B1YA 1YOVB 3REOA 1TM3E 4EPTA 4R9RA 3LF2A 5KNDH 1RXVA 3PHHA 4YRLA 3PENA 3KOWA 2GOYA 3QIVA 4Z9BA 5CCBA 1SM4A 4Z0HO 3AP1A 2Z6QA 2DHQA 2VHJA 5EPEA 5TPZA 4BBZA 1H2XA 1GAXA 3BGWA 4A82A 3RPEA 3PUIA 3SQDA 5GZ6A 2VRCD 3E1KA 4LDPA 1J8DA 1N3YA 1XKQA 2CK3D 3ERNA 2QTWB 4PWZA 2W2QA 2HK8A 3S68A 1GZ5A 1WXDA 1TUEA 3C39A 3D8BA 2X0RA 4TXLA 4FHCA 1O9BA 1FFCA 1ZVJA 4YMIA 2W11A 1QJ4A 3C6KA 4C6RA 3H8VA 3AEYA 3KJQA 4R9UC 4DE5A 3AL2A 4B81A 1O6ZA 4BE9A 2PG3A 1K4MA 4P3XA 1JBQA 1C1DA 2AE2A 2VK8A 4ZD6A 3A04A 3T7KA 4EZEA 4K9DA 5J5VA 2XGGA 4QLAA 2PZLA 1Q21A 1H6DA 3PXAA 4BJ6A 1TU0A 3S2IA 1EQ2A 4IIEA 1XJ0A 1S01A 4CEHA 4URWR 4BUJA 2MHCA 4FDMA 4C4OA 4D25A 4BVFA 3DZIA 2A4MA 4ZAFA 4MI9A 3DLCA 2BEKA 2GJ9A 2AJCA 5KQRA 2H54A 3PLRA 4IJ6A 3L8YA 4KFCA 5D7BA 4JI6B 1SCNE 3G0GA 2WM8A 10MHA 4I5FA 2P8SA 3D6NB 1XZAA 3F7NA 1CRLA 2OBMA 3A6LA 3DUWA 3AOEA 2Q9UA 1M76A 1FEZA 1GPMA 3G2PA 1V1JA 3K5PA 3U3DA 1BDJA 4U9UA 5CLIA 5G0TA 2ZJ4A 5FUWA 3CCSF 2OY0A 2NO1A 3PRJA 1PI3A 1T9HA 1NWHA 2ZBQA 3UYKA 1WM1A 4AJNA 2Y99A 1AUXA 4IGFA 2BFAA 3ZS8A 1JXQA 3L4SO 1R6UA 4G86A 4U63A 3E20B 2P2GA 3TVDA 4L4ZA 1XU9A 1I80A 4Z99A 5AK0A 1QTNA 1G4HA 3I73A 3AF6A 5EZYF 2AC4A 2B8NA 1UK8A 1QKIA 4IUYA 2N75A 3DE6X 3NDIA 1E77A 2LBPA 1FVXA 2X9LA 1Y3DE 5NLLA 1NPTO 5GGYA 2BFBA 4EEKA 3ENVA 1T35A 2DE0X 1QIIA 2UVDA 1G63A 2WU0A 3O95A 4X1IB 1KI8A 1VKRA 1XQWA 2JBAB 5DNYB 1JR3D 3U39A 1DLIA 1WZEA 1TTTA 2PA3A 3DZKA 1XIVA 1GSOA 4RHUA 5AJVB 1XMQB 2HW8A 5LB4A 4Q3NA 4D8YA 4QRDA 5F77A 3J7TA 1U2RA 2WWXA 4W9MC 3ZU6A 2V3WA 3SQLA 3DBRB 2XVAA 3HLYA 3WNZA 1AIPA 2DP4E 4BBPA 3BWXA 3RVLA 5KYWB 1M5RA 2VDVE 4H18A 3K12A 1QXSA 3JQFC 4F92B 1SPXA 2OOKA 4JLOA 1THTA 2CFTA 2XOEA 3H9JA 4MWBA 3E9DA 4MW9A 3RYTC 2DECA 4ZVRA 4DL9A 4DRXA 4GICA 4PIMA 3LBAA 3PB3A 5A04A 1SD1A 5GANK 1R4NA 2ZLBA 3LQ2A 1M6EX 5AW5A 3LP8A 3E27A 1GPH1 5IT0A 3S81A 2VVTA 1J8YF 4DNFA 3BL6A 4KXMA 3DO8A 1KFKB 1GGHA 3KLNA 3KSRA 1ZNWA 2ZRLA 4Z49A 1SCAA 3FF1A 4B5KA 2VJMA 8AT1A 1RA4A 5GGXA 1MXHA 2HA4A 2FOIA 2GN8A 1V7QA 4HGYA 4LJRA 1EU1A 2B4RO 2N48A 5JMPA 1W34A 2H4XA 1YT5A 1X1AA 1DX4A 2PZFA 3P9QA 5A4IS 3QWAA 1GIAA 3Q5DA 4IBOA 5C8DA 4NX2A 3CW9A 1OXVA 4QYIB 4G0VA 3VA7A 1XJCA 3IDFA 1A4XA 2VYCA 3VH3A 4ZZ3A 5A71A 1XL0A 2BFPA 2P78A 3IDOA 3NHMA 1CLUA 2OOSA 1QF7A 2XAUA 2VT2A 1CIPA 3CCEF 1YA8A 2HF2A 3D3QA 4XD7D 3DV9A 2YW9A 4D3SA 1VFNA 1MH1A 4L5IA 2YKGA 4QGAA 3E9QA 1K86A 1RJ9A 2P5TB 1C30B 1K4KA 2QIPA 1GV1A 3W6PA 3HB5X 4AZ0A 4QQ8A 1RMTA 2D0DA 4LEIA 5G1PA 1QRRA 5T4BA 1JA1A 1ZK0A 4UHFA 1JWAB 4O08A 1H22A 3OHMA 5E38A 2Y1OA 3AJ9A 4Q93A 5HMMA 2G8LA 2A2ZA 4OYLA 1J20A 1XMJA 1K5GA 1NMQA 1E2GA 1VPVA 2P7HA 3PC6A 1N2CE 4D4JA 1AXRA 4R2LA 4UUAA 3EISA 2JG3A 1R50A 4FQ7A 1E5TA 1WB4A 2DR0A 3L1UA 1XD8A 3HN6A 3LOPA 4E09A 5JYBA 2C2KA 5GONF 3DE0X 3T95A 1T8PA 3MILA 1YHYA 2WF9A 2ZB2A 4NG5A 4BV3A 1KL7A 2JFYA 5ICMA 3E05A 5K8UA 3GUCA 1DIRA 1Y3IA 3ABZA 3AB8A 5KMGB 1JDZA 2P40A 5J2UA 2X2PA 4K46A 4RKEA 4RL4A 3CUVA 3RTCA 1AURA 3IYLW 4CT4B 3V1YA 5F98A 3ILYA 5GINE 3M6WA 4XPIB 2OYSA 1BE6A 3IP5A 2XWQA 5CXXA 4B71A 5IWAB 1QK3A 4BTEA 2QYTA 4JUBA 2VQDA 3WISA 1X38A 2FMKA 2G1JA 3JAKB 5IT9M 4YLEA 2IDKA 3EPKA 3ONVA 3PC3A 4QJ3A 3L07A 2DWPA 3FYSA 4Q1EA 1TK2A 3P0FA 3LNTA 4N0DA 1FSGA 4QSMA 1OGIA 4WK2B 4I3GA 1SU8A 5DGCA 1UBOS 4X9XA 1RHMA 2B36A 1YE5A 1XHFA 5K2MA 3WB9A 1UBKS 3WLOA 4NSNA 4YP9A 1EFPB 2C57A 4PE5B 3WGZA 2AZXA 4QA9A 3LPMA 3L8CA 1KI6A 1T43A 4FMCB 1D0IA 2YH2A 3SXUB 2ZKLA 2HAEA 3OLCX 4N12A 4PIPA 1I9GA 3TH5A 1K9MH 2VHTA 5JANA 2JIRA 4NV0A 1DLJA 2VGMA 5GIPE 3B3FA 2Q3JA 3QKTA 4DR3B 5C1PA 1K8ZB 2OCDA 9ATCA 3QF4B 4CIYA 5HS4A 2RGNC 2RHMA 3BN3A 3OHSX 3DBVO 1XN1A 2JLAA 3EG5A 2Y1LA 1VJDA 3FLMA 5HQJA 2YYEA 1T5BA 1X25A 3F98A 3RSSA 2XKAA 3ESCA 5C35A 1KYZA 1UBGA 2GKSA 4XI9A 1PLLA 1MT0A 4KYVA 2BEVA 3CLSC 4WKPA 3E2MA 3SEZA 3WLRA 4QU9A 1CQWA 1C9YA 3HDGA 3M9XA 4OHXA 4Y0AA 3NG1A 1DJQA 5I9SA 3W3AH 3D7SA 4JAVC 4MDFA 1CUZA 2V0NA 2CV2A 1I6LA 1Y6FA 4M9RA 3V1MA 3ROFA 1BQEA 1H1TA 3ZWNA 3BIJA 5GAPK 5ANRB 5IJXA 4D97A 4OO3A 5IAAA 1RLJA 5EWJB 2JFPA 3M4YA 3HG7A 4I0WB 2XIJA 2QPOA 3WE7A 3IUNA 3ZXYA 5G02A 4Q4CA 1ZH0A 2ONZA 4Q3DA 2JDIA 3EH2A 2YDYA 1QP0A 2IIBA 3QENA 4Z9YA 2PTHA 1X13A 4WZAB 4E2WA 1IHXA 4A8PA 4TMYA 3VRHA 2X3UA 4B62A 4IZHA 4EOGA 1KC3A 4FW9A 2GYUA 1NI3A 4P5DA 3B3AA 1GZUA 3OURA 3ZJUA 1I7QB 3GPCA 3FTDA 5LNK6 2XF2A 3FAKA 2AW5A 2E5WA 5E4JA 4PYNA 5E3IA 3VHQA 4I4LA 2WJZB 4AIRA 2JRLA 3FYTA 3SIWA 4C29A 1DDGA 1RWPA 1VJ5A 5JSZB 3EPJA 3UUFA 5HSGA 3K71B 3T1TA 1T4CA 3PPYA 4JBIA 3JR7A 5B12A 3BYQA 1T1IA 1O97C 5CNJA 3NPAA 5K0EA 1S8OA 3T7SA 1G8MA 1SXJB 3KQPA 5HE8A 3R5TA 3MD0A 4J4BA 2GRAA 4C8EA 3C3JA 1N6HA 2PANA 3VTAA 2A14A 4JDUA 3QKRA 4G2NA 1NF2A 5H70A 3HDQA 2QN7A 3IS3A 2HI0A 1P1JA 2CXHA 2JATA 4PQEA 2VL7A 4U1RA 4A8HA 3IQEA 1THMA 3AR5A 2DH6A 3AJ8A 4Z5XA 1G8GA 2Q1TA 3GK3A 2DT8A 4A6EA 3Q6MA 4HB3A 1BXRB 3HQ4O 4XM0A 3ZV5A 3CYFA 4IKPA 3IKTA 1HO3A 3KTAA 3NWOA 1CD5A 2QX7A 2ZWOA 1OLSB 3QP9A 4YPFA 4A8TA 2YFYA 1XLVA 5CJ2A 1TPZA 1GGEA 1YOVA 3UMRA 1IN1A 3NHLA 1YA4A 4HDOB 1R9JA 1KVTA 1V96A 1E2EA 2JJ1D 2O7NA 2Q9BA 2VOJA 2YN4A 4UAVA 1D2AA 4URZR 1GQQA 5H7XA 3D1LA 3V4SA 3NB0A 3DD5A 2QZZA 1A9SA 3AF4A 1X2BA 2F55A 4GD3Q 3U9TA 2WUFA 4QC2A 4M55A 1YVDA 3NC1C 4MUXA 5A9TA 2FYTA 4G0XA 1YRHA 1LDBA 4JB0A 5FUVA 4NBKA 3KQYA 1B23P 4KO4S 5BUZA 2XNCA 1PQWA 1Y7IA 4RJ2A 5AQ1A 1SBNE 4O4LF 4PM4A 3TVYA 3HP4A 3PL1A 4CR8A 5T3YA 4E2YA 2X5KO 2ZUTA 4DR1B 1M0SA 4Q02A 2VAVA 2RHDA 4CTMA 2Z5FA 4DMUB 2I0FA 1A9TA 1EFHA 1T1GA 2HIHA 2HMYB 1UBLS 2J6BA 2JGJA 5CTAA 1CV2A 1J07A 4HLDA 2D0OB 2H1WA 3EH1A 5L95A 1OB2A 1EJ2A 4OI2A 1PTKA 1BEZA 3FVQA 3MWEB 1NJ1A 4I3HA 1E2HA 3NHFA 3G2MA 1T8TA 3K9CA 1RYFA 4WFQA 4R2MA 3NV7A 3SHOA 4U7DA 3RKRA 2SKCA 2H08A 5C8XA 2ZYTX 3VHXA 5JNUA 1U63A 3AVVA 2OC9A 2QQFA 3CY6A 3GEMA 2FZEA 1Z6GA 2QG6A 3MUFA 2ZJYA 4YCCA 3N4YA 1PZGA 1MN6A 3GLHB 3J80A 4HGOA 2CHUA 4F5ZA 4U7WA 5FL3A 1JEAA 5BURA 2H4ZA 3BK2A 4GX0A 1MXFA 2YOGA 2I6RA 2J59A 3PL5A 2YWRA 3DFKA 3EMBA 2Z57A 1Q19A 2GFQA 3ZZNA 1Q95A 3U1TA 1YV9A 1KAEA 2O3SA 5E7QA 2F8SA 1XMIA 1OXXK 3RBZA 3C1UA 3DZFA 1JIUA 4KO1S 4UHCA 1BTOA 4HFNA 3BRWA 4HEQA 2PO7A 1UBHS 2DBVO 2JFHA 1H2ZA 1ZMXA 1HL7A 2YHBA 4CMCA 2WFZA 3VSCA 5M2QA 4G5GA 1PG0A 1SG6A 4L95C 1DV1A 2F1JA 2G67A 2NYAA 3L5OA 3VSAA 5BMVB 1WD5A 4JFRA 3ZKAA 2OFPA 4Q6BA 3AUYA 3GPBA 4IYRA 4IWYA 1JFVA 5LDGA 3ZE1B 3MGAA 2H52A 4F72A 4ZZ0A 4OHBA 1P0MA 3PQ4A 1YR9A 4RL6A 2DBQA 3KVVA 4LF5B 3T3OA 1PAUA 1XU7A 3VDNB 1XVTA 2B37A 1QV6A 4TRMA 2FN8A 4YDRA 4NE7A 5KYWA 2XVYA 3HN7A 3PUXA 5BN5A 4KWHA 2MWMA 4PLTA 3R3ZA 1BZYA 1VHDA 1DFIA 2Z2ZA 3WYDA 3GP3A 4MB0A 3NIBA 2GPNA 2PZEA 3G9UA 5TXGA 2ZQZA 1FXSA 5FPPA 4OU5A 2GBFA 1IATA 2GR9A 2RHGB 3EIUA 5F9MA 3F4KA 3T9DA 1D0VA 2QE7A 4KTVE 1JHYA 1E4EB 1PS0A 1X7YA 1XA0A 3P9IA 5B3LA 2I3BA 4MRRA 1V4NA 1A97A 1SXGA 1DQPA 3N4ZA 3S40A 4C4XA 4KN6A 2HJRA 2B21A 1DS6A 1X7HA 3L8MA 3VC3A 3A3NA 2DOKA 3QZUA 3TIVA 5JQGF 3ZCXA 3G7SA 1EZ4A 2NO9A 4J6FA 3GMIA 3OLQA 2CZGA 4QYIA 2AN4A 2AV6A 5I9NA 3TIGA 1R1DA 3WA7A 1WB6A 3HWRA 2JJQA 3L7IA 2JLVA 4DCSA 2PRIA 2UZ3A 5KTSA 3E22B 3C4JA 3DT9A 4YJ2B 2YN0A 5HGXA 4TMKA 3L6CA 2XSZA 1NR1A 3D7MA 1X77A 3OX1A 1USUA 2I3GA 1PYDA 4YONB 1FYFA 1KJNA 1NXSA 4HNSA 4KIJA 4ZCPA 5DPMA 3V7FA 1XA3A 1C30A 3CKMA 4U2GA 4DAEA 5DW3A 5TPWB 2OHXA 3M89A 4LDQA 1D9ZA 4WJKB 1EP9A 2QDXA 5JWHA 4G5OA 4RY0A 4ZRNA 5FXMA 4RJIA 1HEIA 3V8VA 3L0CA 1XDZA 2PVCA 4BNJA 4E4YA 4ER5A 3G4SF 4UM7A 2A5FA 4D80A 1KDZA 3TDNA 4UXJA 5C5EA 1VBMA 2Q4DA 2BVNA 1QE0A 2R97A 2P6NA 2MR5A 4EHJA 2E9SA 4POAA 1MAUA 1U7WA 2NZYA 3SC2B 3WRYC 5I47A 3TK1A 3DO5A 3O93A 2HRUA 2ZRIA 5FPSA 3DYIA 4BT2A 4E70A 3HXMA 2B8WA 1O57A 2C54A 2IQIA 1ORWA 2N42A 3K1JA 4FN4A 4V0RA 3T3MB 3MQ2A 5KYNA 1ZUD1 2G9IA 5CYPA 5KMGA 3KKMA 2JLUA 1Q16A 3WK7A 3LWBA 4JWTA 1YCHA 2XNHA 2YRXA 3LY8A 4JLVA 4CLHA 1TA4A 4XPIA 3BFXA 3U7GA 4E2FA 4RZ3A 1VQ1A 2ZAMA 1K73H 4OV6B 4M86A 2CLDX 4RFSB 5CLQA 1Q91A 4EG4A 3H5IA 1AX9A 1FRFS 5BV0A 1APBA 4JQZA 3K31A 4Q0MA 1ZRSA 4WVLA 5K4HA 3P19A 3C7TA 5HP7A 4DIBA 3C9RA 3GELA 4FEGA 2RARA 4FOPA 4B2IA 2HRRA 3R5HA 4XVQA 5IKMA 3IUEA 1VE5A 1GDHA 3KYDA 2P4SA 3RAGA 5SYAA 4P34A 1Z0DA 2ZE5A 1RPAA 4RFLA 1EINA 4F86A 3GRUA 3OETA 1XTIA 1LF5A 3EC2A 1I7SB 4FFOA 3ZHVA 2Z4TA 2IEIA 3A0UA 4WASA 1U3CA 3MMZA 5BRNA 5TNXA 2CT8A 3IUYA 1K6JA 1PWYE 4JY7A 1TPYA 3UCXA 3PFCA 4H4CA 3K05A 2ZIEA 3QF4A 2GPTA 4ZREA 4A2QA 1NSFA 2RH8A 5T8KC 2I54A 4M37A 2XEDA 4OLBA 2MQEA 2XZPA 2L19A 2A86A 3NTQA 3I04M 1OGYA 1A5ZA 2H4FA 1ZITA 3PRKE 1GEEA 1XTRA 2GCOB 3LQRA 2V6GA 2XB4A 2XT6A 5JPIA 1AM4D 4ECAA 1KHHA 2O52A 3P4XA 1QLWA 1EA7A 4IQ0A 5SY4A 3ZW7A 3N59A 3ZWAA 2Y68A 1Z0KA 2MOKA 3ENKA 3PNMA 3TD9A 4BQSA 5LJIA 5LP6F 5ESDA 3CH5A 3T9CA 1S72F 1VZ3A 1TKCA 1IUNA 1B3RA 4U5XA 5KKCA 1YE8A 3T41A 2B5OA 2WV9A 1SVWA 3UJDA 2XMRA 1WY7A 1QIFA 2AX4A 4GG1A 3LVQE 1M2EA 1NQUA 3VYTB 4DSZA 3BHMA 1QGED 1N0UA 2MTBA 3KEFA 3SX4A 1Q7GA 1QSGA 3JQDA 2QUHA 4I4CA 4NENB 3GNSA 2VH2A 3EVAA 5AW3A 4PPNA 2ZZNA 2V45A 1T29A 3CZAA 3IEPA 3Q12A 4LPKA 5FA8A 5JZSA 1E9VA 1G5QA 1BHO1 3QSYA 2GD1O 3W05A 1ODSA 3C70A 3LC7O 4GLFA 3FFBA 1CHNA 4FYVA 4KN9S 3LUFA 3EIFA 4PG7A 2QA4F 2IH4A 3MJRA 1LPNA 2ATXA 3KLMX 3ONDA 2FSFA 4O2BF 1XEFA 2DLCX 2D0PB 2DR3A 4DJEC 2K6GA 4UPEA 3HCNA 1UOEA 2GAAA 4TSFA 4F9TA 5LNK1 5DM70 3WNBA 1JHZA 1GZVA 1QK4A 4M1WA 4A2PA 1E63A 4L0MA 2O8FA 2AQHA 2P3LA 1YJWF 1HR0B 4QZVA 2B9EA 2OB2A 1HY3A 3OUUA 3AVYA 1PHPA 2A9RA 2OCGA 1MJNA 3LHIA 4XRRA 4MVJF 4YP7A 4BATA 4G36A 2G9ZA 4JNCA 4W9NC 4YREA 1DCFA 1PIWA 4RA9B 1TIPA 3A2NA 1Y5IA 4GO1A 2OSVA 3RA5A 2RIPA 3MTIA 1UUFA 1QG6A 1SQ5A 2P4UA 3F8WA 2NUBA 5MN4A 2WM2A 4FZ3A 5DN9A 4AU1A 2O2DA 3T1VA 3V8MA 1JYFA 2HJVA 2GWHA 1KQFA 4JVMA 2K7ZA 3K16A 5TLSA 4BNXA 3REFA 5HNKA 4L5CA 1IV3A 2BTEA 2AVDA 2GRJA 2G36A 2XYHA 1IWBB 4INJA 1D09A 3FHTA 3AR2A 4NS4A 1OIWA 1OLSA 5K3BA 3ZD9A 1U3GA 3R0VA 2P6RA 4KL8S 1FNSA 1TEXA 1QHHB 2PR2A 3DNMA 3RW9A 2I7XA 3P4EA 1M5TA 3CEPB 4NU8X 3GFOA 3GZJA 3GRPA 3P2YA 3N53A 3T5GA 1MQ9A 4TS9A 1X15A 3E18A 1KJYA 2JIBA 4N3BA 2HWWA 3QLTA 3ZWXA 3R8FA 1AO3A 2BFDB 4P5PA 2QTLA 3S8MA 4D4KA 5IJWA 2C5FA 3GT7A 3KSUA 1V8DA 3NGXA 5AESA 3ANTA 4OATA 4L74A 2DWOA 2R751 5KNBD 3Q72A 4IZIA 5M3BA 4H77A 4AJOA 5AVQA 3VDMA 1VLHA 1NI4B 4QNRA 4WJLA 3PNPA 3VX3A 3NHUA 4V0SA 4MVCA 3WOHA 2GNOA 4CMEA 3AV3A 4H3VA 1Z4IA 3NBUA 4WY2A 4ENSA 2H9IA 5THXA 1VPWA 3AR3A 2J85A 3GHYA 5HIKA 3JQ7B 3X2FA 2YTZA 3VAAA 4PNPA 4ZZ1A 1B8NA 1IQPA 5A1JA 3K14A 1S96A 3UWOA 2ZR7A 3WL6A 5CA1A 3ZG6A 1M8JA 3HMQA 3B1FA 4FYXA 3GRRA 2GN6A 3WIBA 4EW2A 1YTUA 3P10A 1XZPA 4J1SA 2DWCA 2GF0A 1PX2A 4JJ8A 4OVKA 4BQIA 5HHTA 3PC8A 4WA7A 5GQSA 3I2FA 4EH1A 5FI1B 1RZVA 1LPOA 2VG8A 4C3OB 1F6DA 3R7NA 2OLKA 2A0FA 5H16A 2I2WA 3KR1A 4WNIA 1I7NA 2CKMA 3D43A 2BOVA 3VJKA 1DBIA 4GQBA 4LX8A 2PIDA 2W6QA 4LHEA 4JVOA 3TOVA 4NV1A 4TUYF 4P4GA 1FS5A 1QHEA 3K20A 3L1VA 4HADA 3ICOA 1MORA 4YRIA 3K5WA 4DDUA 4EAAA 3GEDA 3PNSA 4B8WA 1ICEA 4HGNA 2PNFA 3B6NA 1BEEA 1OGJA 1PW7A 2J6HA 2QQEA 3KUUA 2EFDB 1JJAA 2M6RA 4UXIA 3P2EA 1M7GA 2XGOA 3RIEA 2HT1A 4GX1A 1CR2A 1KHTA 3ECCA 4OQFA 1T0JB 1TLLA 4MW1A 3Q8MA 1FSPA 1EBUA 1JJIA 2DPXA 3Q7SA 3HGQA 2Z3ZA 4IXTA 5KTTA 2YV3A 1C3XA 4ND6A 4BIIA 2ECOA 2WD8A 1S89A 3NTXA 5KTNA 1ABFA 1TQ6A 1JR6A 3GI1A 1M6VA 4R1OA 3WGMA 4WFJA 1U99A 2ZFUA 1N75A 2Q5FA 2AFVA 3A2LA 3L8GA 1PJ2A 5IP5A 1V1MB 4X63A 1XVLA 3QEMA 5BMOA 1ULAA 5EJIA 5AWFC 4P3KA 3R6WA 1ZI8A 4H31A 1OJLA 2FCAA 4GWGA 5I7UA 2I76A 3N2ZB 2I7DA 5CT6A 2IS1A 1LU9A 2VPXA 2AQKA 2B69A 2HHCA 1VCOA 3GVXA 4ZJZA 2QROA 1RQ7A 3AFMA 2Q5QA 1XNJA 2H07A 4AP9A 4DZZA 2ZVZA 3DMGA 3K8OE 5TQVA 3TVTA 3ZTTA 2PUCA 3TLAA 4DWJA 4MARA 1H8HA 3WLTA 2UAGA 4BLQA 3E3NA 3ESBA 3JVIA 1EUQA 3RANA 1E3SA 4Y2HA 1EK6A 3TGLA 3MYYA 1HEUA 2PIAA 1JA9A 3SLRA 4J16C 1Q7EA 2XYRA 4DWOA 3UICA 2O0LA 4KH0A 2FXVA 3FROA 1TCUA 4ARBA 5A5FA 4JKYA 5KU7A 1NW4A 2VT7A 4MJLA 4MW0A 1Q81H 4XGKA 2J0UA 1E7QA 1URPA 3K6KA 2PUEA 3ETNA 1P33A 4NZYA 1ZA1A 2O0JA 1Z62A 4UBKA 1ECLA 3LLMA 5AKYA 2X7XA 3WO1A 4JBNA 4U2KA 3OF3A 3WLAA 1ZOPA 1H23A 3FNEA 3LJKA 1V1RA 3L9XA 4WEOA 3O4FA 1D1PA 5EUMA 3FRJA 5KOJB 1NC3A 3KD2A 4RCYA 3GZTB 3NNDA 1I5OA 3QPVA 5BSVA 3IKEA 4N9QA 4IDHA 1LBEA 3DOIA 2R25B 3GN1A 1Y63A 2XQIA 3AVPA 3KQWA 5TPZD 2NACA 5K01A 4IIGA 4JJZA 3IQGX 1LJLA 3MRVA 1GFWA 4L6AA 3EXFB 4P6VF 3GQVA 1FYDA 1SCBA 3LHDA 3ETGA 3QU2A 2OPHA 3T34A 1BOOA 2QP3A 4AKIA 3BEDA 4RDXA 1I36A 3P9NA 3CN9A 4YV2A 1IVNA 1NBMA 1R8YA 2EGHA 3U0VA 1FJGB 3F0FA 1QAQA 5AVKA 3LTEA 4TV8B 1LSSA 1ZIXA 1ZNQO 2BGJA 4QG3A 1YNOA 2NXNA 4DF3A 2FEOA 1E1QD 1HK7A 3LUPA 3MBMA 1RLTA 3RRXA 3V00A 4GKBA 1Z07A 2VN8A 4GNKA 1ZGBA 2W2PA 2D2IA 4MS1B 3L49A 2X9QA 3X1YA 3RIGA 2OXFA 5HE9A 5JCOA 4ZHQB 1E3DA 1E18A 2ICAA 4A8JB 3N2KA 3D54A 1P5HA 1TL7C 2B5VA 5LUBA 3EXHC 2G04A 4DIFA 1OY1A 4YV1A 2OYRA 4HXYA 2C78A 3K1TA 4Q03A 3GP8A 1XXLA 1VM6A 2Q9AA 2ZYWX 1M6HA 3G8DA 3NNSA 3PDJA 2WJIA 4M98A 5ALWA 2Q0QA 1U1FA 1BXKA 1F2TB 3IAFA 3O4JA 4UHBA 3FPGA 2WUVA 2PL1A 1VB3A 1NKVA 1P1KA 2CL6X 2IOYA 1U2QA 1AMOA 2QGNA 5DO9A 1NXXA 1GQSA 2HRYA 4CLOA 3ZIDA 3MOSA 2AEJA 3EPHA 2LIPA 5CAEB 3KETA 2ZEJA 4UFNA 5TARA 2F1KA 1AY0A 2LCQA 3RNLA 5JNLA 2ZM6B 2A1TS 1HE4A 1P2FA 4QTXA 1E61A 1DKNA 1U43A 3T5MA 4INOA 5KINB 2BFFB 3QELB 2CHVA 2M2IA 721PA 2JLYA 2RK6A 2FMTA 3TQSA 1CUUA 2IHBA 1WCIB 3GYBA 3QVOA 3ERCA 2ZJAA 3CC4F 2AMLA 1SB8A 4FC6A 4N8SA 4CRWB 5ILOA 4CBVA 1UM9A 2CLMB 2NG1A 4J0EA 3PC4A 3AVOA 4YAFA 1QIGA 4HTAA 3IJRA 1GY8A 4GRDA 3SKYA 4DDTA 4QUAA 2DPYA 2GZRA 3OQVA 4MV1A 4Y2UA 5C31A 2YXLA 5A7GA 1B1CA 1YDFA 1AN9A 4DEXA 1K6MA 1P5FA 1QE3A 2ID9A 3PNOA 3CCQF 4RQAA 1HOTA 4G1BA 1QK5A 3DFMA 1Y5RA 3G23A 3SJAA 4WDRA 4CKXA 4F4JA 1NVKA 3HU2A 4FS8A 5ECWA 3U4GA 2KLHA 2DM6A 4ZICA 1QC5A 2IYZA 5I5EA 2FNAA 1JPJA 1RPNA 1CEEA 5IVKA 5EQFA 5IYZB 2ZRFA 4FW8A 3K70D 1T2FA 1E64A 4GE0A 2GEBA 5G4LA 3WLQA 4DCOA 1RKXA 2XGSA 4ZCRA 2DCMA 3GB9A 1TC2A 3H9UA 1B6RA 2ZBUA 4NG4A 1G7RA 3WB1A 1ETUA 4TKVB 4JUIA 1PWZA 1U0EA 3IILA 2Z1MA 4XSGA 5D1HA 1NBAA 4BLRA 4R69A 1HTWA 5AK3A 5DU2A 4CQJA 4Q82A 1IBKB 2ZSFA 4FS3A 3ZCUA 2QGZA 3OE7A 1M6NA 3E48A 4MVJI 1C7QA 1L7EA 1TYAE 2PX3A 4LDJA 3WQRA 1UXHA 4KLNA 1NVDA 1UBTS 1GRRA 4DV5B 3IQWA 5DW0A 4P2GA 1U5BA 2VSFA 4HB2A 3HCDA 1YITF 2R7KA 3RS0A 2XZOA 3MUOA 4DLBA 3HKDA 1J56A 1M2OA 2W58A 3QRWA 4Y2RA 5DRYA 5JDCC 4EENA 4ZI2A 2WKQA 1KJZA 2YHIA 1C1XA 2HB6A 1PYGA 3BOSA 3SJBA 4YP0A 3MERA 1F6WA 3HZZA 5AOBA 3W06A 1QOZA 2WE8A 3PCTA 4BRUA 1RXWA 4F5DA 3BTOA 4HN2A 4KWCA 1DO8A 3JQBC 2OZPA 3SC4A 4C4ZA 1BFDA 2Q4OA 3CU5A 4TKUB 3CF4A 4W1SA 3WKCA 2QVLA 4PCVA 3ZKWA 4NMLA 1VGRA 4RUKA 5M34A 4XR9A 2IYFA 3EF1A 5BQPA 2WNSA 4GWKA 4LY3A 3BD9A 4P4SA 1FLVA 2IE0A 4X00A 5H8WA 1I5EA 1YB7A 2FWMX 1V9LA 3BG5A 1KETA 3VKGA 4X1YB 4P0QB 3ZGXA 1FDTA 3U4MA 4D6PA 2NYRA 1ZN2A 1R1MA 3QK7A 1Q3HA 2F59A 2MSWA 4QDOA 1DGQA 3BXEA 2XXAB 2GHTA 1NNEA 2Q5LA 1KO5A 2CEAA 3CEJA 2J45A 1ZIPA 3HUFA 5KSOA 1QO9A 1G60A 2SCUB 3QE4A 4WJZA 1NVXQ 1IULA 3GYGA 4A03A 1O0BA 5LLTA 4FBGA 4ZMBA 3CZMA 4RHYA 4LAFA 2YNMC 3WIOA 2AYZA 4K9OA 3EIHA 4DBVO 1RXCA 3RC8A 4RSMA 1XAGA 4OXRA 5FUMA 1EFVA 1PWEA 2BMVA 2P4QA 4H60A 4DADA 1EUCB 2FG6C 2HLDA 2P4HX 3KKPA 3I9NA 4XJXA 2ACVA 4Y6SA 1NNUA 3V6LA 3EE6A 4I50F 3U5TA 4EO4A 3TRJA 1LVUA 1T9GR 4ZP1A 4AS3A 1Q0TA 3MCUA 3ROQA 1E20A 5EZYB 4IIJF 4L0DA 1QHHA 2R1UA 5TE9A 3RK1A 1ESCA 1YR8A 1RKUA 1Y6JA 2E85A 1SKAA 2VKQA 1LTHR 2D1FA 3EAGA 3TD6A 4ARCA 1WUHS 4MCHA 4BLWA 2Z9BA 1A1VA 3SS9X 4DYDA 5JADA 2WD9A 4JBYA 2BFDA 3CCVF 3W6ZA 3FW1A 4JU9A 3OLZA 4PN3A 1Q20A 1MZPA 3B12A 3A9TA 2IWHA 3VTIC 4DLXA 1QOPB 5ALVA 2VHUA 4B40A 5HJEA 1MF7A 1RS0A 3PX3A 4LHSA 3JQFA 1H1DA 4Y2JA 5IHXA 1U8UA 3O4IA 1EPUA 3C16C 4Z2AA 1KJ9A 4F71A 3AF2A 2E6UX 2EKBA 2NUPA 4XX0A 2O48X 3HB0A 1SBHA 1MFZA 2Q4EA 5EWMB 3SIXA 4JEHA 1R9GA 3K0AB 1HNWB 3H2SA 4G0PA 4OJYA 1KAQA 3KL2A 4ZANA 5JH7A 4QXAA 2V6JA 2C1EA 5JVDF 3NC4A 3PDHA 2YQZA 2BFMA 2Y1KA 4OB7A 5KJ6A 4KNWA 1CBUA 4K6FA 3RAFC 2B4KA 4ZVSA 2Z1NA 1EDOA 1T1JA 3DG9A 4NJEB 3I3FA 1TA0A 3BF7A 4X90A 1LS6A 1WHSB 2PMDA 1GVNB 2OBXA 3M3PA 2H06A 3OUTA 4IDDA 1Z29A 4KUEA 4PINA 3I30X 3C3YA 3A7DA 3RSOA 4BZXA 5GIOE 4MAMA 3GHHA 5DGDA 3TTUA 4ETMA 1OMOA 1Z5ZA 1JR2A 3SBEA 4RZQA 1JHVA 3QKIA 4L4UA 1IN8A 1RQLA 2RGUA 2QF7A 3H2YA 3OZSA 4KQWA 1YZVA 4LISA 1W76A 3R7AA 3RVQA 6PFKA 3WYNA 1R7RA 1E6EA 5ICCA 2HLHA 4C0WA 4R3UC 4FUTA 1T3ZA 3CXRA 2RHOA 5EEGA 2WAXA 4KGXA 1LKZA 3H4MA 3QPBA 1W6UA 3QVJA 5D84A 3WV5A 3T5TA 3O7MA 1SRQA 2G70A 3SWWA 4CJXA 1KTVA 2JI7A 2QX8A 1RYBA 5TT0A 2VJAA 2ORED 5JFOA 4CL3A 4YRNA 1DNPA 2BL4A 4BFYA 1UL1X 3W5CA 3H0CA 5CB6A 2NU8B 4AG5A 2F4VB 3VOBA 1YQNA 1UKZA 3A27A 4ND7A 3L7CA 4L51A 1YJQA 5FTKA 1F9EA 3CQ9A 3GARA 1QIEA 5CDSA 2W2LA 5JCPA 4MKIA 2X77A 1PQ4A 5K05A 3AEKA 2H48A 4QO7A 2FF7A 4KK3A 1TX4B 4RGBA 5GONB 3HJBA 3D4IA 3LRTA 5SY9A 3UVEA 2AI2A 2W22A 2J7PA 1G8SA 1XEWY 4X8OA 5J23A 2YVUA 2C2HA 1U8TA 2P2CA 2RGCA 3KIZA 2GJ8A 3FHCB 2OBYA 4AJLA 4CM6A 5CHYA 3ZVRA 3IOBA 4RULA 4E07A 3B6EA 1TZMA 3WBKA 1U2TA 1VI5A 3R3WA 4DIEA 1SZPA 2WMOB 4DIUA 4WKNA 4YRMA 1A2QA 3ORSA 3LYBA 3RSHA 1G1MA 1JRLA 2VJQA 4LGYA 1RDFA 2WF6A 1CUVA 1YC2A 3HY6A 3HUEA 4KWEA 1M0EA 1XMOB 2PRYA 1NLMA 1RI3A 2GF2A 3PR1A 4BOYA 5LQNA 1T5SA 1FCJA 1ZP6A 2Z3WA 2FR8C 2VF5X 2HMUA 4OHCA 4OQXA 4F7DA 5C7IO 2B6NA 3NGMA 3WIVA 3PFBA 1KZ7B 5ESXA 5HWSA 3FKJA 5CVVA 1KU0A 1C9KA 1P19A 4FHEA 2FDXA 1E8DA 1Z0UA 4WNCA 4OXQA 2R8RA 3QNUA 3GH1A 3L6UA 3MS4A 4G65A 4I7EA 5CT8A 2EX4A 1TXGA 5BYJA 5ALFA 5JW6A 3J81k 3HL4A 2NUTA 1DRUA 3PWSA 5A02A 4D44A 1GLVA 1PNOA 2HTFA 2RGNA 3GBSA 3MWYW 1PK8A 1X1TA 2P11A 3Q7RA 2CDAA 2Q9CA 3HS3A 2A0WA 4FT2A 5K3AA 5M7EA 3U7RA 3W5UA 5LBUA 3JQ8A 1MDFA 1QHIA 3JZIA 4MQFA 4IGAA 7MHTA 1BRMA 1E2LA 5LLDA 3L7KA 4PV7A 2VI5A 2FUCA 1T2VA 4R1LA 2IHJA 5KJEA 3QU9A 1XTSA 1Z5UA 4G88A 4JL6A 4W5JA 3ZS9A 2BGKA 4EJFA 5C7OO 5YASA 3EPRA 4O2AF 4FDAA 2