3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
4X1KA 4ZI7B 1TUBA 4DRXA 4O2AA 5J2TA 2BTQA 3VO9A 4TUYA 5LOVB 4O4HB 4TV8B 5GONA 3JALA 3JASA 5BMVA 4I4TA 4HNAA 1OFUA 5LP6B 4YJ2A 3RYIA 5CA1A 1RLUA 4LNUA 5IJ9A 5JCOA 3HKEA 4KWEA 3HKCB 5LXTB 3C8LA 2VXYA 3ZBQA 5LYJA 4EI9A 4YJ3A 2VAPA 4B45A 4TV8A 3V3TA 3ZBPA 4ZOLB 5JQGB 4O4LB 1RQ7A 4O4JA 3JAKB 5C8YA 5LP6A 4TV9B 4IIJB 4X1IA 5EZYA 4I55B 1SA0B 3WGMA 2RHLA 5CA0A 4WBNB 4IHJB 5CB4A 2VAWA 4M8IA 5JH7A 4X1YA 5IJ0A 4EI7A 3HKBB 3JAWA 4X20A 1W5FA 3RYFB 3VOBA 4DXDA 1W581 3UT5A 1FSZA 5JVDB 2R751 2Q1YA 5ITZA 3HKDA 3N2GA 2XKAA 4IIJA 4EB6B 5KX5B 1SA0A 4I50A 4ZI7A 2RHOA 3JARB 5JCOC 5IYZB 4U3JB 5LOVA 5MN5A 4O4HA 3WGJA 3R4VA 2GVIA 3HKBA 3VPAA 5FNVB 2XKBA 4O4IB 3CB2A 3WGLA 5EIBC 1FFXB 5JVDA 1JFFB 3E22B 4EB6A 3HKCA 5LP6C 5LXTA 3RYCB 3N2KB 4F6RB 4FFBB 5J2UB 3M8KA 5IYZA 2R6R1 3ZIDA 4ZOLA 5JQGA 4E6EA 4O4LA 4U39A 3JAKA 4ZHQB 1TUBB 1JFFA 4DRXB 3E22A 2BTQB 4TV9A 4TUYB 4XCQA 3RYHB 1RQ2A 4B46A 4I55A 5EIBD 3RB8A 1W5EA 3JALB 3WGNA 3JASB 3N2KA 4WBNA 5BMVB 5LA6B 1W5AA 4FFBA 4I4TB 4IHJA 4HNAB 3VO8A 5J2UA 1Z5WA 1TVKB 5CA1B 5IJ9B 5KMGB 3HKEB 3JATB 3RYFA 5M7EA 4ZHQA 5LYJB 4O2BB 4YJ3B 5EYPB 3RYHA 1Z5VA 5KX5A 3VOAA 1W5BA 5LA6A 4O4JB 3JARA 4U3JA 5C8YB 1TVKA 4X1IB 5FNVA 2VAMA 3JATA 4O4IA 5EZYB 5KMGA 4EI8A 4X1KB 1FFXA 3WGKA 5CA0B 5CB4B 4O2BA 4O2AB 5J2TB 5JH7B 5EYPA 4X1YB 2RHHA 5IJ0B 2Q1XA 5GONB 3JAWB 4X20B 3RYCA 2BTOA 4F6RA 3UT5B 1W59A 2RHJA 3M89A 4YJ2B 3RYIB 5ITZB 3HKDB 5MN6A 3N2GB 4LNUB 5MN4A 4I50B
chains in the Genus database with same CATH superfamily
2QMUA 2IH4A 2CN1A 5ECDA 3KHUA 2VRCA 3AERA 3FWZA 2BELA 4CCYB 1QQ6A 2NZUG 1OH7A 3VZDA 2FZLA 2PHNA 2Z09A 1YVUA 3LNCA 4I4TA 4LSMA 2QIOA 5KTOA 4HUQA 5DTEA 2W7TA 3PJDA 4GKVA 4LRUA 4I9UA 1WUHS 2Q9UA 3A37A 4AN0A 1CVLA 4TTAA 2P7HA 1T25A 9ABPA 1H2YA 2VKTA 3DF9A 2DPLA 3UJ6A 4QO7A 2UYCA 4L08A 2Y71A 4D0NA 1WXWA 2XE7A 3LP5A 3PVCA 3DWFA 5CU7A 5T67A 1RU3A 3KYDA 1R7RA 2BIFA 3G82C 3NOQA 3QK7A 3ORSA 3I5XA 3UG7A 5JXIA 4EHIA 2YQ5A 5FAXA 4OQEA 4WBNB 2BGMA 5K03A 5HGXA 2HTFA 3DBHA 1J0AA 1AKQA 2OCXA 5C32A 1CF4A 4UREA 1YAJA 4I7EA 4YMLA 4L4XA 2W43A 1YACA 1X0XA 3IAAA 2OHOA 2Y0CA 3F9RA 1ZJ5A 1HYHA 3U3XA 3CKKA 2VHYA 1OI4A 2NZJA 3QVXA 2Q1YA 3GHYA 3U4DA 3PUJA 4DWJA 4QTYA 2FAXA 3NKFA 3OZCA 3G68A 1L5VA 3ZNPA 3P52A 4BTVA 3H9GA 3PC8A 1WHTB 3NHPA 3DBLA 1WPXA 2Z2XA 4P3YA 1VIMA 3KKEA 4MPJA 4I4IA 4QHSA 4Y2YA 4BY9D 2B8WA 5A1JA 2BHRA 4D8YA 4MUIA 1WU7A 4ZVNA 4R2LA 2B83A 3TF5A 2BCEA 4Q1AA 1KSHA 2ZB4A 3ZZ1A 1RXCA 3ONNA 3QYPA 3HXOA 1XPOA 1FVHA 5C0OE 1HOTA 3M8KA 4IHQA 1G5QA 3GG2A 3RK0A 3A04A 1DIOB 4TX1A 2JCBA 1XRNA 1ZOPA 2X58A 4MVWA 2R6AA 3V4ZA 1EQUA 5HK8A 2YOFA 1PJLA 2WABA 3MDOA 1CE8B 4GXRA 2HSJA 4I55A 3C5CA 3IDZA 1PFQA 4EYQA 1L5WA 1W7AA 4LHVA 5JRJA 1UBGA 4DV3B 5AKXA 2BR5A 1FTQA 3MGCA 5CA1B 1TECE 2YWGA 2AJLI 3C9UA 3BBPA 3SR0A 3FHOA 2VJCA 2D59A 2OPBA 3ND5A 2A6PA 4JCOA 4UM7A 4ISCA 4A1FA 1BN7A 2FZEA 2XZDA 3LWRC 4B7CA 5J1SB 1HRDA 1H3NA 1PK9A 3TZCA 3M6VA 2UYNA 1T4GA 1L5KA 3NDPA 1V9CA 1D7AA 3TXYA 4YUAA 4AURA 4NTZA 4AWXA 2IHJA 3F7NA 2SICE 5GIOE 5FOQA 4AMUA 2QTHA 1W35A 4CM5A 3DOHA 2H8CA 2BGRA 3I23A 1FFXA 1QE5A 3NBUA 1NBME 4IH4A 2VXOA 4PR3A 4WOKA 3U3RA 4X65B 3GPCA 1DC7A 4EYKA 4X20B 2W2LA 1BS2A 1IHDA 1HT0A 3P9CA 4P38A 2P69A 1CJSA 1L7PA 1S8OA 2J6IA 2OORA 3LT2A 2BONA 4CV3A 5LNK1 1F2VA 2HREA 4QQFA 2ZIWB 4G2TA 2HU5A 4YUZA 1SUAA 4YASA 1IVYA 1YFJA 2YZNA 3AKDA 3MWEA 4HB4A 4PCUA 1F9AA 1H0SA 1MG0A 2RI1A 4EATA 2E5WA 5IBQA 3DS8A 2FPIA 3N6XA 1OHHA 4GOOD 5CJPA 4MUJA 1WX1A 5LDDC 1JPJA 4I1SA 1X39A 3KR1A 3GH3A 4UDYX 3PJEA 4K6FA 5HF9A 3VPDA 1HY3A 3LBYA 4NR0A 1O96B 4KX5A 3UFXB 2C61A 2JZOA 2R5FA 1XRRA 2XF2A 3AFHA 2WKSA 2AA3A 5LR6A 3HCRA 2QGFA 2WI8A 1SKMA 1NUPA 1I14A 4YP6A 5FWYA 3VCZA 1U81A 1XIVA 2WHYA 3KEQA 1ORDA 1H6DA 2PZKA 4I3FA 1W3EX 2Z83A 3OCVA 3IX7A 2OCBA 2OHJA 3Q8WA 2CXTA 3GLFA 2ENWA 2NTJA 1U7OA 2ZTUA 1SVLA 3DWIA 3RIYA 3I1YA 3ZWDA 4FYIA 4EG0A 2TYSB 4M9QA 3RTEA 1SHUX 2H63A 1PG5A 2XJ4A 1I4TD 2X22A 3O9VA 4LS3A 4BP3A 4NP6A 3AGKA 3TSOA 3VPXA 5BSTA 4HJRA 1Z2AA 3V1NA 3ZX5A 3HUTA 4CQLB 3V1MA 2X0KA 2DTXA 4PX3A 3ZXXA 4QATA 2FVXA 1DV2A 4PZYA 1Y7HA 1C7JA 1W0KA 1AQYA 2ILTA 5JECA 2GCGA 3HQ4O 3P9YA 1HZJA 1MAWA 3R24A 1N5RA 3VYSB 3EZYA 3C5HA 4NE9A 4GU5A 2IH5A 3LXXA 1OBHA 4C7BA 3IEWA 3K6RA 1TZKA 3DDZX 2WM2A 2MSKA 1L8QA 2PMCA 3DD1A 3KFVA 2IG8A 3MCAA 2ODEA 1XNGA 2W37A 3JRNA 4BN4A 3WDSA 4CMIB 1B74A 2QPTA 4HXFB 3C3JA 3T3GA 5A3QA 1OLXB 4V1CA 4OCZA 3I6QA 2PM8A 3GZTB 1N5DA 4ZMSA 3LWOC 1GPAA 1EB8A 1NASA 5AW4A 2J5RA 1JWBB 1CY4A 3PDCA 3NORA 1GTRA 3C0KA 3QBEA 1J97A 2W8BA 1J2UA 4Z7QB 4J9UE 4O59O 1VYVA 1BE1A 4ZZ3A 4D5GA 2GETA 2F48A 2IPOA 2IHVA 3DV2A 4ESHA 2ZYSA 1LBIA 1YNSA 4PR0A 1K68A 3UAGA 3G59A 1T6XA 3BMNA 2VH1A 3WK7A 2J87A 1SC9A 4RF2A 1XTBA 2JHGA 1JQDA 5KTNA 5AKYA 1Z5PA 1YAHA 4OHZA 4EABA 4C4PA 2J3JA 1O95C 5EUMA 4MEAA 1RBQA 1ZHHA 2C9BA 2FX3A 2GNOA 1N33B 1N9KA 2HRYA 4U2FA 2D2FA 1PYGA 1HLDA 4K0RA 4DV6B 2CW4A 5CX1A 3ABOB 2JJ1A 1PUIA 4PFKA 5A2QA 4BQNA 4UHDA 3HACA 4RAOA 5JJKA 3IMCA 3IELA 3PVSA 4XM1A 2NM0A 1VL5A 3JVEA 3S8EA 1T13A 1ZUHA 2A88A 1JKMA 3OJXA 4EVRA 1GL7A 4FCVA 4KE9A 4OGWA 3JALA 2PA0A 4M1OA 4UZFA 5IBRA 4NAHA 4RD4A 1XEAA 2DYYA 5CJ2A 1XQ1A 1YQ9A 1E9RA 5JCOA 2DC1A 1DTEA 4B83A 5CVTA 4RZXA 2O0LA 3BZUA 4MRNA 4LGCA 3QVKA 3SOPA 3FTQA 4QOSA 2LPMA 5EXTA 1PNQA 5T5QA 4C21A 2Z4SA 3W9SA 1YZVA 1I10A 2ZYHA 3C3MA 1O57A 4ARVA 5GOTA 1EXWA 2VK1A 4ME6A 1UMKA 5FV7A 1YGPA 3EWNA 4OLHA 2JEYA 1ONBA 2A0UA 1MDFA 2IL1A 3KKQA 3MTAA 4OD0A 1RM4A 2VAWA 1PT8A 2V0GA 4B5KA 2IYOA 1N0IA 4CN9A 3ITKA 5GADl 3SNHA 3QJGA 5CLJA 3GUUA 3HJNA 3OOYA 1ZVKA 2Z9BA 1L7RA 1FE8A 1ZWZA 1KJWA 2VA9A 4PRKA 3WX0A 2GDZA 2PL1A 2WQZA 5BW8A 1C0IA 1YRLA 5KTYA 4WXMA 3WP1B 3SZRA 1SVMA 1RLGA 1V2HE 1D0SA 3O21A 3C6QA 4HDQB 4EHLA 3IUMA 1TCCA 2OP0A 2D06A 2C5FA 1NXVA 1Z4JA 4P7KA 4PX5A 1S1MA 2JF0A 5D3ZA 2AIZP 2C5LA 4NS4A 3RSCA 4WLFA 2V7EA 4EGFA 5BWMA 5BUQA 4J3FA 1NDUA 2E21A 2X8AA 3AF2A 2AGVA 3MT7A 4L3OA 3QPAA 2QUZA 1SQ5A 3U37A 4BO4A 2R8ZA 1ESMA 2I6XA 3IKTA 3AR2A 4HTAA 4MUKA 2IHNA 2C8JA 2IYQA 2WAXA 4ITVA 4E33A 5DB4A 3U0OA 1KJ8A 3DOIA 1MG5A 1DTSA 1NVGA 5C4IA 2YXLA 2K7ZA 1CJUC 1O0SA 3I9FA 3ZCSA 1KEEB 2IXTA 4FUTA 3H9BA 3IP5A 3R3XA 1Q0PA 3UWOA 2V7QA 5B2ZA 3DE7X 3LIPA 3EGIA 2FEWB 1GQQA 3MMPA 4MOWA 2FXVA 2GZDA 1W5EA 3ZWAA 3UH1A 1GPUA 5JSYA 1FDSA 2JHPA 2IE0A 3H84A 4JOQA 4KSBA 4IZHA 4XR4A 4LXHA 4R5HA 2HAEA 4E07A 4H60A 2HXSA 3AKZA 4Z5XA 5KMGB 2JKYA 2FPOA 1GKLA 1RRVA 2HIAA 4J49A 3ZVNA 3A06A 1J39A 2YY6A 3RKSA 1ZM2A 4X7BA 2GPNA 4ZO8A 2CNWA 1QG6A 5HUHA 4A73A 4V24A 1CUUA 1J9EA 1VPDA 1IONA 4G1MB 4I1RA 1HSOA 4N7BA 1Z47A 3T9AA 5K6AC 1HNNA 1XYGA 1YDMA 2IY9A 3ISJA 4EENA 1H85A 3R3SA 4JV5B 4ZCRA 2J30A 3WB0A 3FHJA 1ESDA 2GLXA 4KYIB 2EQBA 5DF1A 3ZQ4A 2WB2A 4QOJA 1SG6A 5EHGA 5ARCA 4KXQA 1EUCA 3QHDA 1CR1A 3AJ8A 3BD6A 3TQFA 1Z4IA 1I2CA 4WZBB 4XWOA 3NBKA 1ZK3A 1GAQA 3H65A 4OQPA 1HLGA 4J6FA 4GYWA 4FOTA 3ZO8A 1E6MA 4X8HA 3VJRA 4AUKA 4JODA 2ZRJA 3ORFA 4DARA 5CDHA 1P2SA 1NBEA 1NT2A 2F1OA 3EXG1 2OHVA 4BC0A 4NNOA 1BXKA 4XD7D 3SG0A 4TZTA 3V2GA 4BNNA 4YR7A 3TIGA 3O2NA 4J9VA 3K6SA 4KQHA 4XARA 1VG0B 1MW8X 1R15A 1U11A 5FUXA 3WWOA 2E1RA 5ICSA 2LDBA 2WM9B 5HG0A 3EPPA 3J81A 1DBSA 1XMIA 3HGQA 2B8TA 3TB4A 2AOUB 3FCSB 3L0DA 4DNFA 3I37X 4FNOA 1L5LA 1JIKA 4WAUA 5PNTA 2ES4A 1YVDA 3GD7A 1T0PA 4JP1A 4NRDA 5B1EA 3EORA 1AZWA 2VUTA 1UZUA 1UIMA 1K6IA 5KWEA 3A6EA 3HJHA 5HKKD 1TT5A 1WXDA 2FNAA 2RJ3A 5FDFA 2FSVC 5A6VA 2WJWA 5B3AA 2B9EA 2ZVYA 1IH8A 3M84A 1Z0KA 2FZ4A 2PGLA 1UP6A 2PLNA 1KNJA 4Q1DA 2GF0A 1DI0A 2Z2YA 3AZQA 3ICPA 4ALIA 1ECJA 2OL4A 3UV7A 4BBAA 4AJOA 3A1CA 1OX6A 4WKBA 3HN7A 1V5WA 1NF2A 1QE3A 1IU9A 1W6RA 2QRVB 3L7KA 2VZ9A 4M0EA 3U40A 3WK9A 3I2FA 1PKXA 2GYUA 3RHTA 4DS3A 4Q6WA 1G6KA 5DTRA 4A5OA 2ETXA 4PANA 2XE6A 3FDZA 3R5SA 3T3EA 1FUUA 2Q2QA 3JRXA 4I2NA 3N87A 1H47A 4ZU6X 3FI9A 4KU4A 3DW3X 1XTZA 3NU1A 1Q17A 1W4ZA 2DWOA 3G2MA 4U8GA 1SCBA 3RRYA 3VH4A 4BT4A 4KPGA 5HIIA 1KYTA 4ONEA 3N70A 2BBTA 4Q48A 5A2GA 5I7VA 1JEYA 2QY9A 1DKOA 1Y1TA 1ZS9A 2KYRA 3CPEA 3OA0A 3UGQA 1CS4C 1Z6ZA 3T5AA 5E3HA 1ST2A 3F5MA 2C7OA 1TIPA 2FW0A 2X4GA 3ANTA 1QHFA 3HV0A 3IQIX 4WW0A 3QE4A 4FQ7A 4NOJA 5JS1A 3NIDB 3Q5EA 4RVCA 1LLQA 3P96A 1EVZA 1MMFB 2A92A 3AV3A 4KMRA 5KKCA 3EQ9A 4E4TA 3CZMA 2K5UA 3HUDA 4MW0A 4O4LA 1C8KA 4HQOA 3W8DA 1IQPA 1J00A 1VLHA 1KZ6A 4J0HA 1M6VA 2PLFA 3JQPA 3K1AA 1XHOA 1VA5A 4URXR 1Q7BA 5KYXB 1NC3A 3RJMA 1JJBA 2UYYA 5FUQA 3NYQA 3AHEA 3NVDA 5KKNB 2CXSA 4F96A 1LRJA 1TLLA 2GVNA 1SXJE 1X80B 2HMVA 4YQEA 4GBED 4ZO6A 1HSZA 3C7AA 4NU8X 3X2FA 2WD7A 3W5AA 2HLDD 5AOVA 1DEOA 2O0HA 1UXKA 4M0UA 1VE7A 1UXGA 1GTG1 2QX4A 3MS4A 3ASUA 1UBTS 2GK7A 4GOMD 1OYWA 4MCIA 5A3SA 2VBGA 5CJJA 1G3IA 1M1UA 1Q2XA 1U4OA 2F64A 3B48A 3ON1A 3JCMM 3PEUA 4JA2A 1CBUA 4OGFA 4B8ZA 4EQZA 4ZDWA 3L1IA 2A9OA 4Q4JB 5EZYB 4OSOA 3VU8A 2BCGY 2HT6A 5HZHA 1P9LA 1DFGA 1NI4A 3ORRA 2W2KB 4NI5A 5IM5A 3ZJUA 1JFSA 1VFNA 2G1AA 1QIHA 2C95A 4P92A 2C7QA 5T4EA 4JUIA 5KYYB 3TG2A 1P19A 3CRVA 3H1TA 3ITDA 1TM7E 2V7VA 1WB9A 1L4MA 2ONKA 5D3QA 2JGIA 1ESNA 1R3UA 2QPOA 3WGUA 5ECGC 2ORVA 4AY5A 5ICCA 4Z9YA 1UBCA 3UWSA 3K53A 3L5KA 1P72A 1K7XB 3ND9A 3LE8A 2E5LB 4PS1A 5DHRA 2F9ZC 4O4HB 1CZLA 3OFJA 4QPJC 4YJ3F 1WO8A 1RADA 2DMRA 2PD4A 1U3UA 3FPBA 1RHKA 2C00A 4KE7A 2GCOA 3MJVA 4MVJA 4HAXA 3F8TA 3FRIA 3VU9B 1M0EA 5IJ9A 3V7YA 3I0MA 4MH0R 2CD9A 2G9RA 1E3EA 4YHBA 1NUTA 3Q0TA 2A33A 1SBNE 1NN5A 1JDBB 4FGKA 3HO6A 4GO1A 4OHRA 2B3TA 1X8KA 3BWCA 4OXIA 2ODQA 3GLHB 1KI6B 1TO6A 4IXWA 2NU9B 2JJMA 3HP7A 4X71A 4CODB 2JAUA 1BGXT 3CNNA 1X1AA 2QRJA 3E1GA 2PWPA 2FF5A 3CUVA 3AJRA 1Q50A 1M6NA 4NFLA 1PW5A 3CF6R 3M6WA 3SYKA 1M1NB 5JUWA 2B4KA 4Q02A 2BZ0A 4L0QA 3EQ8A 5ERGB 1Z7GA 3AF3A 1N2HA 2VZLA 5MGBA 2C7VA 3AR5A 2MMGA 1JHUA 3E18A 5DZSA 4BLTA 5EA2A 3WIBA 1XFAA 1VLLA 5EIOA 4JBIA 2H00A 1NMSA 1X25A 2YXZA 2GPJA 3LUCA 2ZBVA 1MXHA 3QV2A 4AQDA 2BFMA 4D9IA 2IIBA 5ICMA 4XPZA 1P80A 4IRXA 2HV8A 1HQDA 3T94A 1OXBB 2I7TA 4CKEA 2UZAA 4G24A 2GZLA 4R16A 2FF7A 1NU8A 2ODWA 1A2OA 1ZSNA 2HA4A 1ZOSA 5JPDA 5KWJA 4CKXA 6CHYA 3VVMA 3TG8A 4FKZA 3Q9LA 1OLSA 2QX8A 4L9RA 1H48A 1T5OA 2GKOA 1ZK4A 4MIYA 4NJEB 1BW9B 1LI7A 3ID6C 4OY3A 4ERXA 4LF9B 3IKFA 3FD5A 3TE7A 3K71B 5BUSA 3IMKA 4EJ6A 1JALA 5K3DA 4BVLA 3KWLA 3A11A 2MR6A 2HCRA 4ZIRB 4B6RA 1OZGA 1USUA 1DOZA 1GUBA 4J0JA 1WHTA 4BB6A 2R6R1 4IZ6A 3SS8A 5BUCA 6REQB 1CY2A 3EDRA 4AMZA 3ZE6A 5GIPE 1W36B 5J58A 3ZD6A 1ZN2A 4GW3A 3W4KA 1JG3A 2DFKB 2VYVA 3B89A 4Q47A 2IPMA 1BWPA 1QPGA 2EX0A 3HI4A 1ONNA 4E2WA 1JLHA 3M1LA 5JARA 3DJFA 1O9BA 4O5AA 2W42A 4EG3A 1HEYA 3JQGB 1JYSA 3AKCA 2EDAA 4OXXA 5D86A 1NY6A 1YOVB 3BWDD 5C5DA 5A3JA 3GGCA 3HU3A 3MAAC 2FSGA 2ZE8A 1G17A 4OOFA 3R7SA 3AR9A 4DR1B 2HA6A 2F3TA 4I9FA 5CDSA 2H51A 3KE8A 3C6BA 2HEIA 2WC1A 4RMIA 1ACLA 1YF3A 3F5FA 1QSGA 2VKQA 1C2TA 3EPHA 4GBGA 4HG2A 3HSSA 4C30A 1TJ3A 4AC9A 3B9QA 3EIQA 4MICA 4QFCA 3ZHZA 3V2HA 4CWAA 4BB9A 3A9TA 3PWSA 4HO1X 5AVQA 3VV3A 3D54D 1A7KA 3DNFA 5TPWB 5ISMA 1T0BA 2LP4Y 2QVBA 5DDIP 3RT9A 1E3LA 4FMDF 3FLEA 4N5DA 4EVSA 3QBDA 1QNLA 3ZE1B 5JT1A 1ICEA 2FEMA 4E5SA 2CZWA 3BN3A 4EZEA 4R1TA 4HMPA 4N6GA 2RARA 3EA5A 5TARA 1T8SA 5KQLA 4DSZA 3RWOA 4JL5A 1ONPA 1HDCA 4OJKA 4P33A 3UQYS 4CETA 5ES4B 2Y6VA 2ZU6A 5EJMA 5D5QA 5ALUA 3ZWMA 5FTWA 1PNRA 5KIAA 2H7CA 3Q88A 2GBCA 4ZREA 4WUVA 3UMCA 3RVOA 2AOTA 1CT9A 1PXWA 2W70A 5JWOA 3OTGA 3T7KA 1P4SA 1O94D 3CWCA 3U4CA 3W2FA 4M98A 1G20B 4Q00A 4IWXA 3OIWA 4DR3B 1QH1A 4D3FA 2Q99A 1V7ZA 3ONDA 4F91B 2JLBA 4DREA 2OM6A 4LMPA 3VNVA 2RHTA 3CRRA 1TF7A 1VIYA 4Z3DA 5EGNA 3R09A 2H5IA 1OD6A 4KIWA 2PCJA 4HYYA 5HHTA 2EFHB 3U1TA 1G5TA 1RXSA 2F9MA 3CPHA 3DTVB 5DHTA 5HZMA 3SYRA 3UC9A 3TW0A 3VH2A 1GAJA 4BNUA 2DPGA 3D7LA 1W34A 2BCJQ 2O5RA 4BZZA 2VQFB 3PCRB 4F3YA 1C9EA 3JTMA 3IPCA 2C84A 1J5EB 2QYSA 3ZOZA 2I1QA 2P5UA 3C6YA 1B8UA 4MQUA 5C3MA 2PANA 2HS3A 1ZMRA 2V6FA 2C7BA 4TSKA 1QF7A 3UB3A 1XPUA 1CUCA 1GU1A 2WV9A 3ENNA 5JS2A 3ZQ6A 1RVDA 3PTAA 2HF7A 2XMDA 3Q9NA 3FGOA 3IHLA 1MENA 4R9NA 2JGRA 2O8VA 5U4QA 3L06A 1Y3FE 1HE2A 1GGKA 1E7WA 1P2BA 1T91A 1WEKA 5FTMA 2LCFA 3VYUB 4DV7B 3MHTA 1GD1O 3CKMA 2D00A 2VHCA 4GWLA 3LRXA 1I4OA 4GQBA 2Z3ZA 3TOSA 3ET4A 4I1YA 4XEUA 1RRPA 2WWXA 1JS1X 1U8EA 1WCXA 3LF2A 3F0TA 3NHBA 3OQ1A 5CGZA 1M6EX 1K7CA 5FBWB 4BKQA 2OYSA 2O8BB 5SYNA 3GCWA 3LYBA 1U3LA 2Y0DA 1W30A 3B7GA 1P77A 2Z5VA 1X77A 1F06A 4LJYA 1FDVA 4LZZA 2F1JA 4QLOA 4RK4A 2BL4A 4XIIA 1QVWA 3F3SA 2EL9A 3O90A 3WB1A 4B8YA 4ZO4A 1EQ2A 3QGMA 4RVNA 4I14A 3R5HA 4QVKA 1XCOA 1JEOA 1RYNA 4NBTA 4ZI3A 2OC9A 4CMIA 3MCUA 2JVJA 4WA7A 5EKTA 1P4RA 1OLXA 4LECA 1C3XA 1O6ZA 2OILA 4MJ7A 4W1RA 3SIUA 1ORHA 3JVIA 2O2SA 4KR6A 2GS9A 3N4YA 2WG2A 4MKGA 4MPTA 5E3IA 3T9BA 2Z4TA 3K72B 3NX4A 1CRZA 1MDBA 2IYFA 2A2ZA 2PSSA 2WR8A 4WJLA 3ACCA 1U0SY 3AHIA 3QVUA 3NMUF 4DG5A 3L0OA 3KJJA 1EKXA 1BDJA 1X7YB 2ZYTX 4Z1MD 3IAHA 2NXCA 3MMNA 2JAQA 2GEUA 3RNLA 3MWFA 4NH0A 1JHZA 1P62B 2IX9A 4BMXA 4QFDA 5T4BA 4GXTA 3L02A 4KFCA 4WZZA 1NQTA 5DNCA 2AH5A 3VV2A 1JV2B 3I2GA 3W7VA 2V65A 1U8YA 3DPUA 4GPEA 1XU7A 4A8PA 1GVNB 1Y3DE 4D4GA 5HM6A 1YJBA 1S6YA 3HZHA 3TNFA 1ZG3A 3K0KA 3L7DA 4HQFA 5FHRA 3SSOA 3AIIA 2FE4A 3DHNA 3G85A 2C31A 2Z1DA 4QSMA 4FDUA 1TF2A 1N32B 4R40A 1W4RA 3CX4A 4LC9A 3CCRF 3U4QA 5C5IA 1ZIYA 3OLXA 4PO3X 1JU3A 4L8VA 4MGHA 1FFAA 4YALA 5DH9A 1RWQA 3JAMM 3VYRB 4C05A 3TD5A 1CUEA 2NVUA 3OM1A 3NRBA 1E2QA 1LBQA 2YNMA 2ZIZA 1TQ4A 4AQ7A 4ZV4A 4I1UA 1N2SA 3T0FA 3GLIB 4MW1A 1SHKA 3EY9A 2RB9A 5JQGB 3OTQA 2O2DA 4JLDA 3BULA 2GA9A 2ZIGA 3LF1A 3ESRA 5ALOA 1E1DA 5B1HA 4EHJA 2Q8QA 1CUDA 4O4LF 3FUCA 4P3KA 1M7HA 2G0NA 2WIJA 1H1TA 2BMJA 2DFPA 2WYHA 2R79A 3OT5A 3PC6A 1OZAA 1OX4B 2K4MA 2NAPA 2SKDA 2PT5A 5EKUA 3AJAA 1YL7A 4M0MA 5EESA 4U6QA 2WU0A 3ELWA 4D6PA 2OOSA 3PEVA 4FYXA 3G2QA 3PDHA 4KK4A 1Y4SA 3JYOA 3L05A 1YB4A 4AS1A 4ZGBA 3MCQA 3WQBA 1DDOA 1FMTA 2B7LA 3BWYA 2WDPA 3BWEA 4GI7A 2H65A 1E6EA 5EXPA 4XX0A 3TM5A 2JJYA 3I2HA 4B33A 2PL9A 2JZCA 4R05A 1L0BA 4OM7A 4IIXA 2FQQA 3DVSX 3S70A 4YUXA 3IAS1 3B82A 3EXEB 621PA 3NVKE 1QH8A 2D1YA 3NRJA 4Q3KA 5EJ9A 3A4IA 4MGEA 4G4WA 4OEHA 1QFSA 3SHTA 4C89A 3R4VA 4RW0A 2EKQA 4RA9A 1WUIS 1E4OA 1HO3A 2V3WA 3GFRA 3QNWA 4GOXA 1Y6FA 5JNTA 3PRHA 1M90H 3MTIA 2VPXA 3J7AR 3UKJA 4D25A 1QDEA 4K40A 4OFXA 4DJTA 1FMJA 4IXNA 3QPCA 4OQNA 5AXBA 4JUBA 4MQLA 1PL8A 2AZ4A 4IIEA 4ADSG 4Y2PA 2GYYA 3T3OA 2AB0A 4RXUA 5C8VA 4L9WA 1UFYA 4TGLA 5JLAA 1YS4A 1T8PA 3D1JA 4LX0A 1M8FA 3CVUA 2PLRA 2O7SA 3I6YA 4EA7A 3TD9A 2WJ4A 2O2EA 3ROQA 4CEIB 4OA5A 3KFLA 2DSNA 1EFTA 4UTPA 2OBBA 3RODA 1CNEA 2YV1A 5L4LA 1DKNA 2I5PO 2VEDA 4P4SA 3USZA 2DHRA 1VKRA 2HCTA 5REQB 4AKHA 1GUYA 2QMHA 4FD2A 3UMSA 1OAKA 2R25B 5DSTA 2HMYB 5EXDA 4OGKA 3TI9A 2VA8A 1SXPA 2BP7B 3ESXA 4O2BF 4C0QC 2ZB8A 1W75A 1F2UB 2VSQA 4FR5A 3K8OE 4EJSA 1U9IA 3SDZA 5E6RA 4ARAA 2G36A 3ECCA 3IHWA 5LL6P 1VG9B 3IQWA 1QANA 2G08A 1JJAA 2NW6A 4X1IB 5KMGA 1Y7IA 4O4IA 4BX2A 2JPDA 4G36A 2ZEJA 2MSNA 4JYPA 1NIPA 4ZQEA 4OI1A 2RK6A 2G9VA 3CR7A 3WLPA 5AHRA 4M46A 3R7LA 1KZ1A 3SHWA 4AF8A 3QLVC 1CDZA 2MYUA 5MGNA 4KHPB 1UBFA 3GUVA 4X63A 5KDOA 2ICAA 2F90A 2XUZA 3C3KA 3HCDA 1NOIA 5BSWA 1V4BA 3E9YA 5TGDA 2ZVJA 3L01A 1W2WB 2YWXA 3SFTA 4LNUB 3MBKA 4OMFG 4OU5A 4H1VA 2IUFA 3NUZA 3DDUA 3LQFA 4X0EA 4XPIA 1RRGA 4NYMR 4U2KA 4WZBA 4CKCA 5G0VA 4MKRA 3DTTA 4UVIA 4BU0A 4C0WA 5DNUA 2HVYD 2FR1A 3KEGA 5I51A 4R5MA 5FTJA 2CVQA 2ATXA 3MPUA 5EY5B 3T06B 1UKEA 3SBOA 2QL9A 2WP8J 4AKGA 5SZKB 4DHEA 4RA6A 4ZV9A 4UFNA 5JEEA 5JFOA 3ZU6A 3NC1C 5HRAA 1FB5A 4WBXC 1JBKA 1KIFA 2F7SA 2HF8A 2Q8NA 3V3TA 3G9TA 3GFVA 3PXEA 5HOQA 3KXPA 3O47A 2XLCA 4ZAFA 2HRZA 2QN9A 4C9BA 2YHBA 2O4CA 1JSZA 3IEQA 1LVHA 2AOUA 1SZDA 5KUTA 1O4WA 3PGLA 3PGJA 4H0CA 1P91A 2PKWA 3A4LA 5EWMB 4ER6A 2JFHA 1GZHB 2ZIVB 3Q15C 4PGAA 5ALMA 1OZ0A 3R3ZA 5THQA 4WJKB 2NP7A 1RHQA 3DQQA 1W5FA 1L5OA 2XZTA 5FBRB 3VH1A 4BMOB 2UYHA 4G4XA 2HMUA 3ASZA 3A3PA 3WLKX 2ZCUA 3PNQA 2I91A 2GZHA 1POWA 3WIVA 3QVMA 4RC9A 1V35A 2BKVA 4I50A 1HFKA 5A9RA 3B1KA 4MLDA 5F7XA 1RPJA 1E92A 1EBUA 2ZJ2A 2XJ9A 2QUHA 2VP2A 5G02A 4YMVA 4J1TA 4NFSA 5IT9M 1XDWA 1AV7A 2QRVA 3P9QA 1VP3A 1X9GA 3SZGA 5FBVB 5BUZA 1K06A 3AESB 4LFAB 4G4SP 3TFWA 4BB5A 1QP4A 1UT6A 3E22B 1ECBA 3ODPA 3CG4A 4NDZA 4Q34A 1MH1A 1PN3A 3LWBA 4MA0A 4XIJA 2HV9A 2IXDA 1IZ0A 1JIIA 1Y42X 2CW5A 1IEVA 3RAJA 3ZTTA 5TIIA 5JG7A 4RTJA 3FFBA 1Z0JA 3NASA 4YECA 4RKRA 2DBZA 3I45A 2AZXA 2HHCA 2J59A 5KCMA 5LCXA 1M1ZA 4LE0A 4RDXA 1EXDA 3UHJA 1GEEA 2EOAA 3DOJA 4C4ZA 2ZRAA 2V9ZA 4JR0A 1I1NA 1XCBA 4PIPA 3L8FA 1XKTA 4Q4AB 3OMXA 4JJ6A 4RLSA 3T9CA 1PR3A 2WYVA 2WJ3A 3P4YA 3ROFA 4B40A 1A1VA 1R2QA 2E4WA 1H0RA 1J2TA 1RVV1 1GQRA 2R48A 3LVRE 4JBNA 4BFTA 1SKUA 3VKGA 3WJ1A 4KVGA 3MN1A 1PJBA 4QJ4A 2Z6AA 3AHFA 1QCYA 4NV3A 2HRRA 2JZNA 4R1MA 4BAGA 1NE7A 2A57A 3S7TA 1M2GA 5JDIC 3UWDA 4DG8A 3GEPA 3HXKA 4JMPA 2W6MA 4NU5A 5G4KA 3UHPA 1U3CA 2ZKIA 3HDVA 3VGPA 4WESA 2TMKA 3H11A 3HWSA 3CRNA 3K5IA 1JILA 4A0FA 1UFRA 2C5EA 3Q41A 5GP1A 4ENRA 3HJBA 1I3KA 5DT9A 3QUCA 1DOHA 5D3MB 1HDRA 3E9NA 2ZSUA 3CLSC 1O6BA 3ED5A 4O2AF 5BWOA 3O75A 2VJBA 4KYVA 3EIWA 3HVJA 2DY1A 1XA4A 1IN6A 4A2QA 1Z8HA 5FBLB 3AKEA 4RHEA 4DBZA 2VSOA 1K73H 3ZDDA 3ZIAA 2HF2A 1D1SA 1K9SA 1R0RE 3B6KA 4J8PA 1QC5B 1VL0A 4INOA 1EDBA 2PL5A 2GERA 2D13A 4MUXA 4TWZA 4WERA 2W2KA 5BR7A 4FYMA 2OP1A 4A8JC 3FWHA 4HR7A 2HMWA 3LZCA 2WJ6A 3G17A 2CLFB 1TJNA 1N2CB 3AEZA 1D6JA 3DZCA 2DUNA 3FMIA 2Z43A 3QKTA 4OK3A 4R1UA 3S4YA 1KH1A 3SJUA 4BNWA 2CMFA 5J3JA 2HP0B 4JEUA 5J4LA 4CNBA 4OAQA 3FVQA 4IXMA 5BOSB 4KR9A 3F0EA 4OXKA 2ZAGA 1HFJA 1AUVA 2IS1A 2IC5A 3ELUA 5DBFA 5I7AA 4DV0B 2UYJA 4DY4A 4H4DA 5BVHA 3FZGA 4I9NA 2BM8A 4Q3AA 1EIZA 1VECA 5FUBA 2Z5GA 3WP0A 4XYLA 4DN6A 1MA0A 1C7FA 4GGPA 1N9ZA 1KVRA 3DM9B 4RQBA 5I4BA 4UTXA 4IINA 4WKNA 4MW6A 2CL7X 4PYRA 3WIUA 4A0GA 7ADHA 3GLHA 3MK31 1KI6A 1B0ZA 3CB4A 4HL6A 2DETA 2OTCA 1LU9A 2C2OA 1GTMA 5FPSA 1LBTA 3CH4B 2H1WA 1KEWA 1DBQA 4M9XA 4CMCA 4B0PA 5KX5B 3T95A 4U2EA 1M1NA 4A2PA 4URHA 1FFWA 2H1OA 1EFRD 1LF5A 3NHMA 2OFOA 1JVSA 1RPNA 4U7TB 3R0IA 4Y1RA 1W0JA 3WLNA 4DIUA 4X97A 1AXRA 5IFLA 4UMVA 2P1ZA 4KO2S 1Z0ZA 4AROA 3MW8A 3E84A 5T64A 3OQIB 3S2UA 1EJ6A 2XDQB 5C7YA 3B1ZA 1K2VN 2PSFA 2YWCA 2ZZNA 1NC1A 2BKEA 2VQ6A 4IHAA 2PYZA 4W4TA 1BFDA 4BE4A 3M34A 3QFTA 1BA3A 3PPWA 1OWPA 2CUKA 1CETA 1X7ZB 2N75A 1JQJC 3ILHA 1PGJA 2P2SA 3BOSA 3LIIA 1MC5A 4NJEA 5JMPA 1QFYA 2P91A 2PR2A 2QG9A 3AEKA 1BW9A 4UMFA 2O2ZA 2IBTA 1C0LA 1TM5E 3SK0A 1WB4A 2AJBA 2VF4X 1D8TA 2GQ0A 2Q4BA 1LPPA 5KSZA 4UAJA 4ZTZB 1SVKA 2RI6A 2OTMA 3A26A 3C3PA 4G0QA 4L07A 4N49A 4YRLA 1SCUA 1R5NA 5KTPA 1TQ2A 2ISSD 2W2NA 3DP7A 1TTTA 2CZGA 4IW3B 1O6CA 4US0R 2RJNA 4OO3A 1GV0A 3CEJA 1DG9A 6REQA 3RARA 1U8XX 1HBJA 3I04A 5FI1B 4C82A 3Q3IA 5AW2A 4AJ4A 4ZQBA 3G5AA 4OHUA 5AK0A 5T6BA 1JY8A 2DF8A 2C4MA 4MAFA 1Z25A 2BN4A 3OUTA 4BNFA 4BEVA 4G9EA 3E3LA 1ZI8A 1QJCA 4LCBA 4ND3A 4XOIA 4ZZ1A 1V1RB 4PLYA 4LY6A 4ZDKA 3BGIA 4Z3OA 3UPUA 1VCMA 2XWSA 3EE6A 4TZZA 3GFOA 4EI8A 1A96A 4S1VA 2ZI9A 1ULTA 5BQPA 2EGUA 4WLVA 3UICA 5JH7B 2F59A 4PZ9A 3NAQA 5KCZA 2CV0A 4RXMA 2BH2A 4UXHA 4CTMA 1WY7A 1S2GA 4X6YA 1HDXA 4BXOA 4C3OB 1L2TA 1UQTA 4ZEWA 3N7TA 2YFYA 1M6WA 1TKRA 5AD1A 3TECE 4XGQA 4KPUA 2HW8A 1UPAA 2FHSA 1CR2A 4FHZA 1IUOA 5DX8A 4YP9A 5AJZA 2WKWA 4DIMA 4D9EA 3BFKA 3A9UA 3RRBA 4F4UA 3KQHA 3M6UA 4PAGA 5DRYA 1DIBA 2XYGA 4MS4B 4BWGA 3EMDA 4MDEA 4WRRA 4JVNA 1VJDA 2EJWA 3FPFA 3OCXA 3IT0A 4EDFA 2OAP1 3DEAA 2JIOA 1U2GA 1RLUA 3QVLA 3BA6A 5K0GA 1DBVO 3MNFA 1TKAA 1IRIA 1YZNA 2C0QA 4P0TA 5DK6A 2XUIA 1BEUB 5AW9A 4ZAYA 2WD8A 3CLUD 3LT1A 3R77A 3ADKA 5GAJA 5AM3A 1UBHS 3CNQS 1XZ8A 4ZAXA 2A5GA 3BXFA 4DBLE 4Z54A 3TWOA 4WK6A 4AP6A 2R1ZA 1MO2A 1PCXA 2AMJA 1U5CA 4W9MC 3TD3A 2L2QA 1THGA 2OORC 4KXUA 2JLUA 5G1PA 5CB4A 4JXXA 4O1IA 4FLMA 3W7BA 4BQOA 3A6KA 3EZXA 1HDIA 1MR3F 1R4MA 5FB3A 1OAOA 2B69A 1FSZA 4KWTA 1XWWA 1QBKC 2PZGA 3L1KA 4YRCA 5FCDA 1DC4A 3N7AA 1RWVA 3MXTA 2JNWA 2H8EA 3TTYA 1GARA 1MC4A 3E61A 4JU8A 5DT2A 4U0KA 4Z6KA 2QAGB 1ITZA 2BTUA 3JQ9C 3F4LA 3CUTA 5F76A 1M83A 1U3PA 2UVQA 4QDXA 3PNVA 5FBZA 3DB2A 3IL2A 3L6RA 3WFZA 4QOFA 5HWSA 3K8ZA 2WUDA 3ZW7A 1NV9A 1GN9A 4Y0AA 1FPMA 3UJ3X 4O4IF 5DGIA 1CSEE 1QMPA 3DCIA 1BJKA 4MPPA 3LPAA 1K6XA 2YKGA 4FGLA 4BQEA 4M6WB 5JS6A 2B7BA 2OV6A 3NHWA 1OR8A 3AL3A 3F6BX 4TTQA 4FOPA 2CNLA 3FNIA 2XA9A 5JBQA 1Q16A 2JIZD 3B51X 2NXJA 1DG3A 1P73A 2QR3A 4H7KA 1NW4A 3B85A 5JISA 2GN9A 3A05A 1S3SA 2C77A 2QJOA 4MV5A 3EPRA 5E6UB 4OP3A 5D2CA 3W1EA 3VYTB 1I3MA 1YBHA 2ADOA 3ADBA 4RD1A 1L6IA 1T3LA 2QRGA 4IRUB 3W4JA 4ECEA 4K26A 4Q3OA 1ARZA 1WB6A 2ZJ4A 2QDKA 3PQEA 2F43B 1N1DA 2HYDA 4QBTA 3W8RA 4DJJA 3JATB 1NBMD 4PSKA 3QOFA 4ZYTA 1N6RA 2OVBA 1RHUA 4FDAA 4B73A 1Y9ZA 2X0JA 3SS7X 1ZNYA 4RFSB 2QBYB 1XJCA 4E7PA 3N8DA 4H35A 4YVFA 5H9WA 3AQIA 3IQEA 4NE2A 1TX4B 3EQ2A 2PMDA 4O63O 2A9FA 5AM4A 3WY9A 4COKA 4W6ZA 4Z1OA 4Z53A 2NOAA 2ZBEA 2BHSA 3I3SR 3P97A 1QQ5A 4KOAA 5L4SA 2Y1KA 3GFBA 3WRYC 2GI4A 4XIYA 1TPZA 4TKVA 5KJCA 1UC9A 2VP9A 5JDCA 5TMBA 3H2YA 3NRCA 4ZQHA 3MTEA 3L79A 1G60A 2EQ5A 1NJ6A 2HB6A 3QYJA 4Q7EA 3IMGA 3FOBA 1VJ5A 5BY2A 3DCYA 1X7YA 3NV9A 2XQKA 1B2RA 5JHGB 3H97A 1SFRA 4MR7B 4E5DA 2O23A 1DKQA 4FXPA 2FHPA 2OHIA 4R8MA 4CT4B 4H7HA 1HT3A 1L4KA 4B0OA 4JGIA 2AKEA 4G0NA 4AMVA 3ZCPA 5F9MA 1LS6A 5TQ0A 4RZ2A 3N4ZA 3BFPA 1C7ZA 1X1BA 4B6SA 1CZUA 1WMBA 2ILVA 3Q7IA 1Z2CA 2FWNA 1IUNA 4B62A 1LBSA 1MPXA 4UC0A 5IT5A 3CS3A 2OMEA 1J6UA 2GPAA 3MS2A 4PPGA 4RIIA 3ZXIA 1U7HA 5EMLA 4CUJA 1NKSA 1SB9A 4GFDA 5CG1A 3MQ2A 4DA4A 2JFGA 1ZH4A 5DYWA 2PMEA 1CDDA 3QX9A 4FQ5A 2NUAB 1G5FA 3IT2A 1LKZA 3KAQA 4JVLA 1WSAA 4GDFA 4YLEA 1XTJA 3HWWA 4EW2A 4NZYA 1RWMA 2EBHX 4HNRA 1MB9A 4M8IA 1ZAYA 4GBJA 5I9LA 1KP9A 4W1SA 5BN3A 4FZVA 1ZESA 1V8BA 1R64A 1VDZA 1P4AA 1QGAA 4DQKA 1NYLA 1T9KA 3LKZA 3MUNA 1QGZA 1L5YA 1ECPA 4QFBA 4KCGA 5EE5B 1RYYA 1Y3IA 1LLFA 2I2WA 1OX4A 3W6UA 2HLPA 2I6FA 2P4SA 2P9CA 4ER0A 3WIDA 2AHRA 5JCOC 4MV9A 4RSRA 5DMXA 2QE7A 3BE5A 4W6QA 2C4UA 4BNVA 3OZAA 4ETIA 1P2VA 2D62A 2LV8A 2OENG 1FCJA 2P9JA 2VNSA 1Z06A 1WE2A 1V96A 1BMFA 4NL4H 3V7QA 1PT5A 3THWA 1RM3A 1YIOA 3IUQA 5FO0A 4G4VA 2H0RA 1W55A 5EJGA 2O1WA 4WKPA 5A05A 1ZKDA 4KZPA 4RH1A 4H0NA 1EJ2A 1VP9A 3AY3A 3WWYA 4B80A 5ED4A 2WWVD 4BNMA 4LDPA 3V55A 3ZXSA 2Z1MA 3BBLA 2UYKA 1YR9A 2CXNA 4QXRA 4J2OA 2JKZA 3AEQB 1KGSA 2XNDD 4NCIA 5K0NA 4YRZA 4DQUA 5T7BA 4BW0B 2XRMA 1A9ZA 2ZS8A 3HJTA 1BCSB 4HNSA 4MI6A 4TV9A 2A8YA 3FJOA 2G8LA 4XSGA 3AVWA 5GINC 4LAFA 4KWCA 3TZ6A 3DCJA 3ZNQA 1FSFA 1Z5WA 3KOWA 1L8AA 3JYHA 4OFZA 4UU8A 2QL6A 3AL2A 5B57C 4LF7B 3KSBC 3KAKA 5HP4A 4WACA 3QVGA 4ARZA 3AK4A 4XYBA 1U2QA 1G2OA 1D2AA 1E5DA 4CEIA 2XCIA 3PNPA 4IQ4A 2GB4A 3H9UA 3WYDA 5IZ4A 2FZWA 5AI6A 3DLCA 2P9HA 3JQ8B 1KH3A 2H18A 3EVTA 4AKSA 3TEJA 2FMTA 1BE8A 1SEVA 2QUAA 4G8CA 2DOKA 4NV1A 5JNLA 5D1NA 4XTRA 2J0VA 5EINA 2Q5OA 4HX5A 4F12A 5HX7A 1ZCJA 1VK3A 4PINA 4GWKA 1JG4A 2NZ8A 5IEBA 2NVOA 1UFOA 2QRNA 4MYUA 1B3RA 3FG9A 3ZJYA 2QA4F 1F2UA 2YXEA 4GQIA 1IMJA 3DFZA 4IMJB 4REQA 3KVYA 3OPYI 1NONA 2XVAA 4Z0PA 1GQOA 2VJDA 3GCDA 1AB5A 4F60A 2WQ7A 3HRHA 2CMDA 2AOVA 4Q37A 4FM9A 4MUFA 3B52X 4K1LA 1F8GA 3DYBA 2JDIA 2ZBPA 5SYMA 3D64A 3TW8A 1ZN9A 1G5IA 4TS4A 2Q29A 5ALIA 1XTPA 1VHAA 1GQFA 2IHYA 3GJ6A 4JFRA 5H0IA 3ST7A 3VC7A 4EPTA 2VK4A 1VHTA 2FXIA 3HAXD 1BOOA 4MRVA 1VJTA 4EZBA 1JAYA 5AJHA 4P3OA 4R8RA 1Y4AE 3LWPC 4LNUA 3JD0A 4AWAA 3COJA 2XT6A 2XYRA 1P8JA 3S0HA 2ZYVX 3OUUA 2HDOA 4RDIA 1I2MA 2A5JA 3IUEA 4ZYWA 1Q3KA 1RWBA 4ID3A 2WU8A 2ZS9A 3N0VA 3W3ZB 3WC4A 1DFHA 3I6ZA 3BRWD 4U9UA 2D1SA 4B76A 1V8FA 2Q7XA 4YRTA 1P17A 1RQ7A 4TT8A 3BQ9A 1XAGA 4MARA 1V6AA 1GX1A 2R7LA 1KSJA 2W2OA 3GRZA 1X1RA 3EVAA 4HDOB 3O8OB 4YCCA 1DEXA 4FMCB 3CCUF 1JSLA 4QU5A 1B0UA 1FYDA 2F00A 2PGIA 1MQAA 3B8EA 2CHEA 1N2JA 4NPCA 1S9HA 3SIXA 4GOJA 1SBTA 3WSVA 5FA6A 1H9BA 2IYPA 2BZGA 4V0OA 4TWIA 4KH1A 3H9EO 3HB0A 1ELOA 3REQB 4TTIA 4UBMA 2BYTA 3SNKA 1XZPA 2PS9A 3C48A 2EP7A 1KC8H 4P6VF 5EWMA 1TMYA 4D43A 2HU2A 3L0IB 3VKWA 3F4KA 3ZOKA 3HSYA 3H9JA 4UVHA 1JXMA 1TM1E 3P4UA 1Q0LA 3LD9A 2FFBA 3PQ2A 3OPMA 3OQPA 4G5XA 4QDOA 4QUDA 1XXHA 1HE5A 2AG5A 2AL7A 4PLPA 1NUQA 3KE9A 3OZUA 4XD7A 5HE8A 3LRPA 1L5HA 4BO8A 3MSXA 1QVRA 1C50A 1CFZA 2OGTA 1XP8A 3GMDA 4FK8A 3ZG6A 4UVGA 4DV4B 1VRWA 2QZZA 3RC9A 5L3VA 3L0ZA 4FGUA 4M0PA 1SCDA 2X9GA 2WHPA 5DCYA 4RWEA 5LDGA 4A7PA 3RE3A 3J80M 4E46A 2BKXA 1R27A 4TXLA 4GR4A 3A1TA 1J7KA 2ZRBA 2QI9F 4JQZA 1OI3A 2DKOA 3JQBA 3E22A 4C20A 1CUIA 1C80A 3LJKA 4BRUA 2RHGB 2R7AA 3EGEA 4O2RA 1U7UA 3AF5A 4Q4HA 1KFJB 4Y8VA 3WKAA 4OF4A 5T4FA 5K9ZA 4G4JA 1A97A 2CHSA 5T4HA 1MIOA 4C6SA 2FRDA 4FN5A 4KQKA 5CXQA 1N0HA 1RI3A 3GQBA 2PYIA 3TQRA 3IB6A 4GIBA 4V0SA 4XYEA 4AJEA 2CLCX 5JAOA 2AUTA 1CJBA 1TB4A 1W0CA 1BE0A 4ARIA 5G1OA 1NAHA 2FWRA 3MJTA 5H70A 1N4AA 3IPYA 1TJ5A 2BEVB 3ZP4A 1U5BB 1CUXA 2KBFA 3RBZA 3VR5D 2EAUA 2PKEA 2VZEA 4WZAE 5EAZA 2ZSAA 1A4RA 2FN3A 4FLEA 3RRFA 1CQPA 5I5EA 1H0HA 3UWMA 3L9XA 3FWKA 3I8SA 4JFAA 4Q9NA 1HF3A 1FDOA 4C4XA 4YRRA 3G71F 4LSGA 3WGKA 3QEAZ 2NQTA 3ABZA 3KVVA 3NC4A 4B3TB 5JATA 3H1AA 4IJUA 3V8RA 5CB4F 4C2UA 4GKJB 1CEYA 4CDRA 1RC1A 1Y7TA 2P27A 4Q3LA 1DT9A 1E3MA 3PEFA 3CE9A 2OO7A 1NLMA 4CHTA 2R5NA 5IHPA 1PWYE 1FQJA 4K6GA 5DCUA 2OM2A 1SU6A 1ZH6A 4KGVA 4XYGA 3T41A 4C7MA 1PG2A 3SGLA 3V6LA 4V1CI 4QRDA 3DE1X 4OVKA 1EMDA 1Y6QA 4IDEA 5D3MA 4D26A 2H08A 5LOVB 2Z9CA 1CNMA 1GKYA 2ERCA 1KJZA 2GZ3A 2H9IA 5I9NA 1T36B 2REBA 3UCXA 2XAAA 1KZ4A 3QYAA 1IY0A 1NVVR 4AP9A 1Z38A 1D2HA 1QAOA 1XEXB 2RBKA 4PZUA 4DAOA 1E1RD 4FD3A 3T1VA 2GFQA 4FCTA 3W77A 10MHA 2R6ZA 1QC5A 1U1CA 3RIXA 4L72A 1EFPA 4MKIA 5AUQA 1CXZA 1KSFX 4OKIA 2X1MA 2DQSA 2V74B 4FHEA 4PHHA 3V6MA 4ZOEA 4CQJA 2IYZA 3HRKA 4YONB 1Z68A 1UDWA 2R6HA 3IAM6 4OJTA 3E0QA 3OLCX 5ARDA 3VDXA 5ILGA 2Q5FA 3AVOA 3CLRC 3DMGA 2DR3A 4TRRA 5IH3A 1T0HB 2W98A 4L15A 3E8SA 4I6GA 3TAXA 4WOJA 5A4MS 4JVSB 5KC8A 4K0KB 2YXNA 3GAZA 4B3MB 1DWPA 2HLDA 3KT8A 1BS1A 1QGYA 4IQ0A 4XOUA 3AP3A 2XT9A 3RRXA 4C7VA 3KLNA 3UJNA 3KTOA 4QBIA 1A5ZA 1B73A 2A30A 2JI8A 2IV7A 3KLBA 1ZJ4A 3I8OA 3MYRA 2PX2A 1VQ9F 2ZAOA 1OY1A 4R2WA 2R751 1J9ZA 1G8AA 3LBAA 2GCIA 3NIFB 2BRUA 1PR1A 5DYYA 1DJLA 2O19A 3IMEA 4HDKB 1DXQA 4HDSB 5KS2A 5TVKA 5DISB 1NN3A 2ORYA 4AX4A 1MNQA 1DZIA 5CT6A 2ZI4A 1JNXX 3O1JC 5F2EA 2Q9AA 5HFAA 2PD3A 4CLHA 3KOMA 2I76A 2VPIA 4OQFA 5FLEX 5F7ZA 3M4SA 3MTBA 2ZRIA 3NOOA 5I9SA 4D82A 5A9SB 1K9VF 4WK0B 3VXKA 3JZMA 2IF2A 1AKMA 1W25A 2BR4A 4A27A 1D7OA 4PNPA 2I4OA 1Q0TA 4X7MA 4B1FA 3IJPA 1ZC3A 3QU5A 3TFQA 3UXMA 4PG6A 4MQ4A 3SF8B 4YDQA 1Y6ZA 2Z08A 2IP1A 2LBXA 2H85A 4UM9D 4PSVA 1N34B 1Z0FA 3QKUA 4JIGA 4JLSA 2N46A 5H4GA 1I0IA 1PV2A 1TUEA 3PQ4A 4U2CA 3TZBA 3ESQA 2JAXA 3MWGA 3IOEA 1ESCA 521PA 2A5DA 3NTLA 1U65A 1H2AS 3TGPA 1QO7A 2XB8A 3LRTA 1X7ZA 4OXRA 2Y0BA 4RKQA 1BN6A 4A4DA 3NALA 5HKLA 3GR6A 4P2BA 1GCUA 2OD7A 2JFYA 4DGQA 1DXYA 3UMMA 3MAJA 1J09A 3ENQA 2FN7A 3P2KA 4RVOA 5FNVF 2N0SA 3M4XA 4WL0A 3FTFA 3FNBA 3S2EA 1XWFA 3AP2A 1WD7A 4TKUB 1IC6A 5GM1A 2EKZA 2IUTA 3PKIA 1UK9A 2Q07A 3INTA 1U0JA 1X52A 4JLKA 1Z22A 4KQJA 2WPDD 3Q7PA 3DR5A 4XGNA 3ZXUB 5CDFE 5F77A 4LJ4A 4Z4IA 3AM1A 2PVSA 3IYLW 2ZS7A 2JFOA 2QW0X 2IE8A 1NP3A 1JSCA 3M6LA 4IWYA 3RIMA 4TYNA 1R4NA 3EVFA 1ZCBA 1WKBA 4MV6A 4X1KB 1ULUA 2N47A 3E20B 5IC5A 1TZCA 4UEJA 5EP2A 3BG5A 5AT1A 4EPVA 1MU0A 1QOQB 2O4UX 5GANK 2GT1A 4W99A 3UYLA 1U2RA 1OXVA 1JKJA 4E5KA 1KERA 1PFGA 3OLQA 4ZOQI 1P75A 3SIWA 1NRXA 4CKZA 1BAPA 1XPJA 1KQPA 4QVIA 3OE7D 3B3JA 2ZUSA 2UVDA 1PYOA 1PNVA 1RDFA 1SG0A 4KR7A 1FLAA 1ACJA 1BH6A 1WZIA 1M1YE 3VO9A 1FSSA 3HFJA 3L84A 5JMTA 2ZXUA 1XNRB 3VR3D 5EIFA 3IA7A 2AWNA 2NYVA 1KF0A 1M1KH 1EWYA 2OV4A 2YICA 3KPVA 3O7MA 4WXEA 3UHFA 1SOUA 1YZHA 2GN8A 3N2ZB 3HY3A 4HDMA 1TM4E 4Z49A 2J0UA 4BMPB 1OFHA 2P6UA 3KQOA 4L28A 2GAFA 1FC0A 2RIPA 3PGMA 4Y98A 5G41A 5B1IA 4TM7A 3IP6A 3BFJA 3U7GA 1ZGJA 5TV2A 1DL5A 1JHMA 1VLZA 4JS0A 4I6EA 5BP7A 1G7CA 2BMAA 4AZSA 5BWNA 3OBWA 1K7FB 3CEAA 1DLJA 4JLJA 1GYPA 2JK0A 1MLDA 2VHQA 4I5GA 4JC8A 4E03A 3RC3A 4IJQA 1R6UA 2HKIA 1U6KA 5DM70 1YJQA 1OXMA 3F49S 1JJVA 1LJUA 1LRLA 3CW8X 4TV9F 4LVCA 2B21A 4LISA 3ME5A 3OEED 1ECFA 3OHPA 3W8FA 5G4VC 2ZT6A 4DLVA 3JR3A 4GEGA 3STTA 4OUDA 3EG9B 1IXRC 1NQ3A 4LRWA 3S55A 1TGVA 2QTFA 3KYJB 3ZI0A 2RH4A 3WGVA 3AY0A 3EGVA 4QARA 3OFSA 4DKXA 1KYWA 4NULA 1T9GS 2BFDB 3P2EA 4BV3A 4CM9D 1RA4A 2HX1A 3ZV6A 3PUZA 5KOIA 3QE3A 3DDSA 1GYRA 3MT9A 3QX3A 4IUDS 1TJYA 5JYDA 2WY2D 1JQ3A 1KRHA 4KQCA 2BUCA 2X8WA 5CXSA 4L6CA 4ZQGA 4EX6A 4G63A 4YIHA 1PU2A 2V0CA 3G9XA 4M9ZA 5CCEA 4AXBA 1KVQA 5LQDA 4XFJA 3RYCB 1PZFA 3IV7A 3LUKA 4GM1A 5CLGA 2JLYA 1CKEA 1H4VB 3LBIA 2Q9CA 2DERA 2I1VB 3AYZB 3BTVA 3PIRA 4RPGA 4X84A 2AR7A 4WXHA 4IJ5A 1QFJA 4R6WA 1P5FA 1AX9A 4MI9A 1I7LA 3RJ5A 3U0VA 4YRBA 1KZYC 4C76A 3U7HB 4LHYA 3RS5A 3GLQA 3TLAA 4MRPA 5FPYA 4YYZA 2XADA 2PUFA 1PL0A 1GL6A 3PHHA 1OCEA 1LBHA 1URPA 2AMTA 1ZJJA 3L8MA 4JBLA 4QGAA 2YWBA 5F51A 3WSWA 4HWRA 2AF3C 2NUTB 1FX0B 4Y1FA 3NCTA 2WK1A 2XE4A 3PNBA 3ZEIA 2BVNA 2AX3A 1JG2A 1RRCA 1JMVA 4RK1A 1ODCA 3PNSA 1AKWA 1VI6A 4R7GA 3P2MA 3M6AA 5E6UA 1B8PA 3UO8B 4DW8A 2GXQA 3F0FA 1FXWA 2O7VA 3KZNA 5AKZA 1ESZA 1E9DA 1ZGBA 4TSFA 1VZ2A 1PT9A 1CU1A 1HL7A 2FCRA 4FE3A 4IQ8A 4KTVE 4ALMA 5FH9A 3ZHSA 3HM9A 2XUPA 3RUAA 3AOEC 4JNCA 4QQ8A 1GYQA 1VL6A 3JATA 2XYHA 2P35A 2ZJ8A 3EZFA 1YASA 3FPCA 2ZI6A 5DXFA 5TLSA 1GFWA 2VXBA 2VJLA 4KRXA 3YASA 5J2TB 4MAMA 1SULA 4PXAA 1CPYA 4OLJA 1KC3A 3OSZA 4UUAA 4D6XA 1ZH0A 2ZI3A 3KX2A 5LQNA 4P8RA 4F6RA 1B14A 4R81A 4ARSA 1XZBA 2J9FA 5TC4A 5BMVF 3VYSC 4FNMA 5EHIA 1XRSB 3VTFA 5AWFC 2YZ2A 3WWZA 1QS0A 1ECCA 4GPAA 1YA4A 1GRRA 4Q39A 1E1QD 1EVQA 3UJBA 4QBFA 4QYIA 4AD8A 4DCOA 4MQEB 1RLIA 5EB0A 2BFEB 2QLJA 4TUYA 1EH5A 1SIOA 1I4WA 5EEHA 4FSHA 1XVLA 1PTKA 1VG8A 3UB4A 1ONIA 3BH6A 2CEAA 5TB5A 3SX4A 5L3SA 4YUVA 5JCJD 2HWXA 2O59A 2FR8C 3X1DA 4CMKA 1T15A 2WVHA 4IDGA 4M99A 4PO9A 5EUBA 4ENVA 3V8PA 1Y6RA 3N2LA 2DHDA 4HPXB 3AHJA 5EB1B 4Q3BA 2Q5IA 2H06A 3QPBA 4TRJA 5COAA 5D01A 5EZQA 2Y1DA 4B85A 5DWVA 4P80A 1Z4KA 4B4WA 3F1KA 5B5SA 1CQXA 1VSBA 1YI8A 3JAKB 2X4LA 3DC7A 4CM4B 3IAFA 5B6JA 4DA6A 2CFSA 4YCBA 4LV8B 3T7TA 1KAHA 4FT4A 2X14A 5G0WA 1KPHA 1Q0QA 5DGXA 2BMDA 3DBVO 4UM5A 1L5QA 4XYMA 4CMAA 1F6DA 3T5CA 3UMVA 4YMSA 1PZEA 3C4VA 3Q4GA 4BFXA 2WTMA 3I5MA 2UU9B 5KQSA 1BCRB 4IOKA 1QB7A 2G1PA 4K9KA 3BM5A 2QYOA 1GPJA 5LLSA 1NQWA 3TW6A 3NEJA 4CV1A 3EH2A 4URYR 4BMVA 5A0FA 1T1GA 3C15C 1ZIOA 4WCVA 3UGTA 3UMRA 2PGDA 4E22A 3FHTA 1WOYA 4Z1MA 4WEQA 1U4SA 3JRWA 5FUMA 1ZICA 2PZBA 2YJ3A 1V43A 1W76A 1WCIA 2YNMC 4HY3A 5AXAA 5K3FB 1A4XA 4MV7A 1D6NA 2VP6A 4TLLB 4ZVPA 3T5DA 3WNZA 4DLUA 1OYYA 3BF8A 1OGJA 2MMCA 2PUHA 3PDWA 3RS9A 1RNLA 3DDOA 1TVEA 2GHRA 3QIAA 4HKTA 5IXSA 1DPFA 2HNKA 3WQHA 2K87A 5G1NA 5KHLB 1P6QA 1JDTA 3ZEAA 4B79A 3N0TA 4BBPA 4OAPA 2ERXA 4GM0A 4DIBA 1PGNA 1WXIA 2CZQA 1NLZA 4LSZA 4CLRB 5CG2A 1JXAA 5MDHA 2C42A 2ZIAA 5JSZA 2C7PA 1OKKA 4XUDA 5EJFA 3AR7A 4Z4HA 4NVRA 1I0ZA 3GEEA 3AB8A 4DTIA 4C7OA 4CM6A 4IGFA 4MWDA 1ZOIA 2FG7C 2IA5A 1LWOA 2UVPB 2ZSJA 4J4TA 3T1QA 1DU4A 4XVCA 4ZFNA 1P9WA 3T1NA 3OICA 4RO0A 2VHTA 4Q7JB 2CNDA 4PX2A 3FKSA 4C4TA 2P5SA 2QRKA 1T34A 1BCSA 2ATCA 2NYAA 3W3AH 4YT4A 1T4DA 4EM6A 1YXMA 2HL6A 2XIQA 4UUNA 3U60B 2GN4A 4TQAA 2AVDA 3UN1A 1YR3A 3D8SA 2CCJA 1SCIA 1HRKA 1YMVA 2CJFA 4DMCA 2W83A 2X2EA 1YFLA 4D3SA 4JQCA 3GYGA 2C2YA 4QHYA 4OHOA 5KYGA 4YHHB 1LF0A 1NBOA 1FPQA 1HFEL 4JUCA 2JFVA 4PW0A 4ZC1A 3ZV3A 2HFJA 1L4FA 3I09A 1F8YA 1ZY2A 2E6UX 4PPQA 1V9SA 3ZE8A 1NXQA 1GPWB 5AIBA 3JQ8A 3AVTA 3MWDA 3MT8A 1EWVA 3RKRA 1RFLA 3NT2A 2QXTA 1YQEA 3COSA 3DW1X 3OM9A 4LFBB 1C5KA 1DO0A 1P7VA 3OZDA 4L9SA 2PV7A 1W47A 3CR3C 4RKFA 3A1VA 3L8DA 1TAGA 4LC0A 2Z58A 1SPBS 1YI2F 4L4UA 4WLOA 4ZMRA 2XOKA 2Z6QA 4G81A 4JP5A 5JJCA 3IEUA 1E8DA 1MB2A 4R6XA 2WJPA 2P0YA 3VISA 5LXTB 1DMRA 1K5DA 5FFMA 2AV6A 3PPXA 3SVLA 3P9RA 2Z98A 2C9MA 5TVGA 2FV8A 2XTAA 4ALNA 1SUEA 2B4TO 1UZMA 4TSRA 3I6MA 3T9FA 4D80A 1F5SA 4QYMA 5JD5A 1VB3A 4DIOA 3GC6A 1JKFA 2BHNA 1W9HA 2QLTA 2WZBA 4K9QA 3RS3A 1SUCA 4RF5A 3QIVA 4TQ9A 2I29A 4RD0A 1YJWF 2G3YA 2QRMA 3EC7A 2WOOA 4FFLA 1UKAA 3IVGA 2Z95A 4LFCB 3SSMA 3TDKA 3WAKA 3DULA 2PX5A 4MR8A 1Y3HA 5CH3A 1DEKA 1I24A 3A0RB 4QTXA 3UWKA 3TBFA 1C7EA 1BTOA 3CC7F 1G7RA 3HJGA 3EEBA 1RD4A 3LKVA 4RHUA 4AF6A 5KNBA 2XKAA 2ODPA 2FSSA 1IHOA 1NLUA 2UXCB 4YDRA 5FYQA 2JCXA 3H6HA 4GUDA 1ZNZA 3W1WA 5F7JA 3PEYA 1CULC 1NVXQ 1IYZA 4JI0B 3BCUA 4JZYA 3TLXA 4XGRA 4ECAA 1NWCA 4DLLA 4UQPA 2H4FA 1M2FA 3DXFA 1IE3A 4ND6A 3JWHA 1R6TA 3M4JA 1MRNA 3OZXA 2RGNA 3SF0A 3BL8A 1W29A 1XK7A 3COYA 2VQEB 3GBPA 2FWPA 1UXIA 1C9YA 1LPBB 1V8ZA 3GYQA 1E3SA 1P7CA 2XUHA 3CGWA 5E38A 1CDOA 3W5BA 2ZUFA 4BAZA 1KKLA 3NANA 3KJQA 4CLXA 4UEWA 1MAVA 1S2OA 3AIMA 3BX1A 3C14C 4ZP1A 2IEBA 3QXSA 2IW1A 4J75A 1HM5A 4LKRA 1KAQA 2DFLA 3KKKA 3OFKA 4RAQA 4HUJA 3VR4A 1OZHA 5AVZA 3OFND 1USVA 3GPDG 1RQ2A 2POCA 3CG6A 1AY0A 1CQIA 1T2VA 1T0IA 2DUMA 2R1VB 4NONA 2OKGA 4U2DA 5HIJA 1I5RA 3K2IA 1EDDA 5DCVA 1QYDA 4RDCA 3I72A 4TYMA 3H42B 1ECGA 1SQFA 1ZD5A 3AFNA 3I9NA 4DMHA 2H17A 4QTZA 3GRRA 1FZQA 1RMQA 3C43A 4J1TC 2F1RA 3B3GA 1VLVA 2YN0A 2JNBA 1Y98A 1QWOA 4NZZA 2G0AA 2RGUA 3K14A 2CLHB 2D3TA 5G53C 4B2PA 4DA0A 3UT0A 1XVTA 2AEEA 3GLRA 5JD3A 3GPIA 1YB7A 3EWSA 4D9JA 2NXNA 8AT1A 3K16A 4KEAA 4GS5A 1JGTA 2J3QA 1E9EA 3ASVA 4OH7A 3RT7A 2RE8A 4II2A 1EESA 3O2QB 4BO6A 5IS2A 2H5JA 5DOVA 4D9HA 4D3YA 4UPVA 1L1EA 3LK6A 2B4YA 4HB2A 1B93A 3Q6MA 4L1KA 3ZY4A 3PQFA 5LIRA 2BEVA 2QP4A 5AW1A 1UBJS 3KQQA 3MJEA 5JO9A 5CD1A 2UUBB 2CT8A 1Z2OX 1GRNA 1ZMBA 5AVTA 1FVFA 1MHPA 1IHUA 2A35A 1SHTX 2OFXA 1EZ1A 2VDPB 3P9NA 4J0KA 4U6SA 5SZIA 1TW2A 1GUDA 4IIYA 1PEAA 1FRQA 2VHUA 3V4DA 1NMXA 3IKJA 2V5VA 1Y8RA 1R0ZA 1WR8A 3LYUA 3UA4A 4EJMA 2P9EA 2XIJA 3AI1A 2G6BA 2X0IA 3K8QA 1E3WA 4ZT7A 3Q2IA 1XNJA 4X91A 3WMXA 4MB2A 1WSDA 1DZ3A 4NJMB 1AKVA 1SVSA 1VMIA 1ZBDA 3MUFA 1RXVA 3PT5A 3E2IA 2IZ5A 3MELA 4X94A 2ZTLA 2W2PA 3F97A 2EW8A 3FMGA 5CFPA 4OATA 2WSLA 2VG8A 2WJAA 3KYCA 3ZWKA 1SD1A 4X92A 1SD2A 2V9PA 8ABPA 5LP1A 4O4JA 1HE8B 1JB1A 5C8YA 4GGOA 2ESRA 3L0BA 4NECA 3RLFA 3RUCA 5J5VA 4AUEA 5B4TA 2K1SA 4RZUA 4UATA 5BXQC 4RGVA 2N1MA 1CEEA 3IDQA 2QUBA 1L1RA 2MWMA 3QUQA 4LMRA 1SQ6A 4P36A 3SQMA 5KQGA 4UMEA 2H07A 2IITA 1USIA 4MJLA 5CB6A 3FNFA 5KTSA 1M54A 3KQYA 2C2MA 4K9DA 4EI7A 2ORED 3FYDA 1GZ3A 1WSBA 2DECA 4JN6B 4R9RA 2VAVA 4DLXA 2XWQA 3OTHA 1J8YF 4LZPA 2UZIR 4C4OA 4YV2A 5AK4A 1H94A 4MVXA 3FROA 4MW5A 1JQLB 4AU1A 2XDAA 4PC1A 1RE1A 3BEOA 3W9BA 4YB8A 3O1HB 3NXSA 3CZ9A 3A1UA 3E9RA 3RUDA 3WGJA 1CY0A 4ZVMA 4C3UA 3X1JA 2WJJA 1AH2A 3PPVA 1SC4A 2QN7A 4EYOA 5A5FA 2Q3JA 2ATEA 3DMRA 3EXIA 5CIYA 4X45A 4NZ9A 3ZGOA 4EQ6B 1QR6A 2PMWB 1GG8A 2OCKA 2VCHA 3QMPA 4DLRA 1FP6A 4HDSA 1Y80A 2CWDA 3BGOS 4R1OA 1U28A 5FO1A 1Y34E 2ZWOA 3V5NA 3RG8A 2ZQZA 1N77A 4XB2A 4RIHA 1A9SA 1X1DA 2VYCA 3WADA 1N6KA 4DWWA 4OLAA 3BHMA 4NX2A 1NQUA 5JU6A 3IUNA 4G4IA 3H5OA 3D2AA 4KWIA 3HCEA 5DLYA 3G7SA 1TUBB 3IQDB 4UDNA 5A4KA 3KQNA 1T1IA 2JFFA 2TMDA 2PH7A 4ZPXA 4YQZA 4TWBA 3G0OA 4TUYF 5U9CA 2FEXA 3B7PA 4PE5B 2AG0A 4A91A 3LWZA 1ZOOA 2PL3A 2R6CA 2HWUA 3G2KA 3OT1B 4MGYR 4DYDA 4PFQA 3CX6A 3W78A 4NABA 2GZ2A 3GNSA 3P1JA 2CMGA 1XN4A 1F4LA 1XK6A 3L7CA 5HY1A 1HG1A 2F1HA 2EJVA 3KELA 3KZKA 3GU3A 3QOXA 3W5UA 1GN8A 3IIIA 2C57A 2M32A 3C3EA 1NBWB 4J4BA 1LY1A 5A2QM 1S2NA 2IWHA 4BQIA 4Q19A 1KQSF 2R8XA 2Y93A 2ODAA 2ZE5A 1QRTA 1LK7A 2D8MA 1Z5GA 3GLGE 2GA8A 1YB1A 2H16A 2QTWB 3QPDA 4QRHA 5DWDA 3WK5A 1NI3A 1V11B 3MBIA 1EFRA 4BB0A 1VSTA 3DOFA 1ZOLA 4RCYA 2P9ZA 5U4XA 4A0RA 4BUZA 3S1AA 1JWLA 1M73E 3TLJA 4BP1A 4E09A 2ZROA 2RHMA 4AYTA 5LLDA 1LUAA 1ZGCA 2JH9A 3EMKA 3NLLA 2A1IA 2J8ZA 2QP9X 3DOOA 4R98A 2OFWA 4TN1A 1IHYA 4BFZA 4X1KA 2FJUA 4JMLA 4E6PA 4PNEA 2OA0A 3K5HA 3GFGA 1Z8DA 1U1IA 3R3UA 1W36C 3QI2A 2JJ8A 1KA9H 5FIUA 3GUYA 4YH1A 1DG1G 5EZ6B 2G0TA 1A9RA 1QHXA 2IHTA 1TTPB 3AU9A 5T8KC 1WVGA 1IDN1 1BWQA 3O4FA 3DEIA 3QVOA 3G2IA 3LWDA 2P9BA 4EHDA 4KWEA 4Y9TA 2V8OA 3AL0C 1ZW6A 1KFEB 2PUJA 1BC5A 1EFHA 5BN1A 5LLTA 3QVVA 4KBYA 1LFDB 3FKJA 3QM1A 2EFGA 5DI9A 4C1NA 5ELXA 4TZ0A 1NM5A 2WB4A 3BSFA 2VZ0A 1F3OA 3H5NA 3ANNA 3KCNA 4YI5A 2ZJ3A 4AY4A 4BEWA 1UMDB 2YFQA 1YO6A 2Q46A 3CE6A 1B1CA 1LD3A 1CUZA 3TCNA 5CB0A 1R8JA 5B1DA 3STHA 1N5OX 3H3JA 8ADHA 1FMCA 2QV0A 3MJRA 2AZDA 1PEDA 4LX8A 2PX0A 5IDXA 5CA0A 1HDEA 3N74A 2X42A 3EDQA 2AN5A 1ZN7A 1T1JA 2P2ZA 2XWBF 5TEVA 2O7NA 4YAFA 3IE1A 3A9RA 5ENVA 2ZWVA 4CTNA 4F4JA 4IM7A 3GJTA 3F5SA 3T7SA 3PQ7A 4GZMA 3GO4A 1D9ZA 3E2PA 1BQ4A 2O50A 3WTCA 3PWTA 3N2GA 4MUBA 1SUPA 2C97A 2EYUA 4RJLA 3S29A 4RHTA 1OA1A 1ZI9A 1ZEJA 3DEHA 3ORQA 1Z6TA 4AJ2A 1J9GA 3RTBA 2ZRMA 4IJVA 3IEMA 4F5DA 5AKLA 5IKPA 1VYHA 2QN1A 3OPQA 4J0GA 1J99A 2BFWA 3D2BA 5B2FA 2PUWA 1LVUA 3I9V1 2WWWA 4YJFA 2H2AA 1ODJA 1D1PA 3ZCVA 1E6WA 5DMHA 1BWRA 2YWFA 4GECA 3OU7A 5JR3A 2BWJA 5C35A 1BYIA 2PRYA 3B3FA 1T0AA 3M1XA 1QK5A 1K6JA 2C4NA 2GHIA 4NARA 5MHTA 2GESA 5H82A 3QWBA 3F71A 3OWOA 1I1OA 1J90A 1PYDA 2P2DA 2ZTMA 1ZUNA 4FJ0A 2PX8A 1IBMB 2ZI7A 3ILVA 1M2NA 2GJ4A 1M66A 4ZEMA 1GPLA 4U39A 3EGXB 2GDJA 1S8FA 2ST1A 4LBWA 3HR8A 2A3NA 2JLQA 2YW9A 3OD1A 5FT9A 1NJFA 3GCXA 3HGTA 3L0PA 1VHLA 4RNCA 1IB0A 5DJ5A 1FUKA 4NIMA 1BJRE 1Q19A 2WAAA 4EW1A 4Y6OA 5D00A 3M5CA 5HBGA 3LBNA 1EFLA 4OQ4A 2Z1FA 1C9NA 4Z9FA 4B84A 4B7ZA 2GCPA 1K6MA 4CMEA 4FMPA 5I9MA 1RM5A 4HGRA 2XBMA 1HKHA 2CWJA 3OAAD 1SQGA 4NPAA 4BVJA 3IAXA 4M54A 4DVJA 1M6HA 3DC2A 3I5AA 4WLUA 2GFIA 5AK3A 3ND6A 3RASA 1H3EA 3ZW9A 3E23A 1Y1PA 2IJGX 1J07A 2WWFA 5HF8A 3FHLA 2WMYA 3DO6A 1TZMA 2OD2A 1L4LA 3T38A 1KNXA 4IDPA 1NDQA 3RVQA 5DXJA 3VZSA 1S72F 2GZMA 4RY0A 5A5EA 3I4FA 5CM2Z 1R16A 1RACA 3GRAA 4JT9A 2WYWA 4HXYA 1Q0UA 3AIKA 2XB9A 2YCBA 3ABQB 4KAAA 5J1TB 1UR5A 5JFGA 3WKBA 1LWNA 4G0YA 3B20A 3E7WA 3JAWB 1IWPB 4INPA 4IOJA 1RXUA 1L7QA 1U9JA 2O52A 4UU0A 3J81M 5ULLA 3SQOA 1EGMB 2YFKA 4RORA 2GN6A 4B6GA 3ZDBA 3VYUC 4YQYA 3L0YA 3KU1A 1IY9A 1H3FA 4WI1A 3SVTA 1MB4A 1TEXA 4O8CA 4S24A 4EBBA 3KJHA 5J2TA 3L7LA 3N8GA 4RESA 3GJRA 3OEHD 3IJEB 3OKFA 4YBZA 4PHGA 2R3SA 3QEMB 1HKUA 3WAGA 5KOJA 3BD9A 3K30A 3MUOA 4N48A 3K12A 1P1BA 1BMDA 1QE0A 3FM9A 5CMLA 4ZAVA 2JIZA 1C14A 5LP6B 2ZYDA 2XOEA 2ZQ5A 1HA3A 3FF4A 3IHKA 4ZQIA 5EUCA 3RGGA 4RIGA 2JKVA 2Z1NA 3C6KA 4UD2A 3WRWA 4KFRA 1D2CA 4KLAA 3E9QA 4KR3A 1U63A 4MQEA 1PZXA 1Y3AA 1CZKA 1NURA 2TRSB 2IZZA 3QVWA 4N0QA 2O8DB 4NYIR 2FUEA 1T24A 3JZFA 1JSXA 1IJKA 1FYEA 3FOZA 2WFLA 5LWQA 2XHZA 4QASA 4PZEA 2PVCA 4DLZA 3OW2F 1R66A 2IYNA 2VYQA 3UTCA 1NBMA 3T7IA 6YASA 3I6BA 2VJQA 3VKUA 1A9XB 4UBJA 1BXGA 2HJRA 1COMA 1YKSA 5ALPA 5JDCC 2CY0A 1OXSC 3U7JA 5EHXA 1N5LA 5JYCA 1H22A 1KEVA 1OBFO 2X3UA 1PS0A 4EJ2A 1YDEA 1EVJA 4CE6A 3CCFA 1J2EA 2C4KA 2C2BA 4QU9A 4ZEXA 5IJWA 1WIWA 4B3BA 2EHDA 3OG9A 3QP9A 4G5QA 4V2UA 3KHNA 3Q8MA 4C07A 1AGNA 1XYYA 1GDHA 2PS1A 1YB6A 3GRCA 1I7NA 1Y37A 4YJHB 3ZHOA 4EY6A 4GRAA 1H4QA 1O8BA 3I9LA 4M1YA 4FLFA 4GICA 1WMDA 3AF6A 5J43A 2GSDA 1KOFA 4ICIA 5JY6A 4K2HA 2XKBA 5L6MB 5EPEA 3H8VA 3GL9A 3W5SA 1ZW1A 4GP9A 1AA6A 1BCRA 4LCJA 2NG1A 1YI0A 3H75A 5JZSA 3O7WA 2MSEB 4EPWA 3ZZNA 3AGQA 1TU0A 3BH7A 2XX3A 3JV7A 4R8LA 4RGQA 3CLKA 4GYKA 2BF4A 3KTAB 2JHFA 4L3WA 1YV9A 2W0MA 5TGTA 1E2IA 1S7CA 1XTUA 2ZVQX 3KIPA 1M2OB 1AIPA 3ABRB 5K3FA 2J48A 1QP0A 5GOZA 3GEBA 2HU7A 5HY0A 1L7DA 2BEUB 3V2IA 3I3OA 3QMWA 3EFHA 1R8SA 2G40A 4QPZA 4DC0A 2ADMA 3D0OA 3HFRA 4NBWA 2FDCA 3NFYA 4CG2A 1IXYA 3SM3A 3JQ7B 1NR7A 3RFCA 4CF4A 5KSOA 4B4VA 1CY7A 3G49A 1GCOA 3SQLA 4CLRA 1L7VC 2CSXA 3O3MB 1GSAA 1YE3A 3T5TA 2YXBA 2CUTA 4M76B 2OBYA 4PFJA 4J2TA 3RC1A 3ZS8A 3GP3A 4OMCA 1A82A 3A1FA 5D1HA 2ZAMA 4KVAA 4XDHA 3BH0A 5HGJA 1D03A 1G8MA 3KOZA 4YMIA 1MO3A 1B15A 4LC1A 3QKRB 4BZPA 4DA8A 4KMOA 1GQSA 4O4JF 5HKKA 4JGGA 2FJPA 1BX3A 1YMQA 2YUIA 3KKZA 4YRGA 5C8YF 5IVHA 2CZCA 3HVHA 1ODIA 1OQAA 3ZK7A 2OMKA 4Z0HO 2OZVA 4KQWA 1FMLA 3TLYA 3KXIA 1ZU5A 2XPCA 1Q3HA 2HA0A 2ZJFA 1A8PA 4ND4A 3DZHA 4MA4A 2FP4A 1PJSA 3THRA 2EATA 1JE0A 1TQHA 5CEJA 4MVJM 3RSSA 3AR3A 2FSIA 4YJ2B 2XLBA 3RA5A 4NYMQ 4EEXA 1ZM7A 1HT1E 5J23A 4V0ME 3O8QB 1VJRA 4DHWA 2PBLA 3D6JA 3FCCA 4X3CA 3T3PB 3RIHA 5B2EA 1XNQB 1OWLA 2BI7A 3JQFA 2PX3A 5AYVA 1D2GA 2HK6A 3SHFA 1YE8A 4MYTA 2GLUA 3WLRA 5IDQA 2R44A 5TGZA 1IN5A 1Y89A 4Y2GA 5BW4A 2XNDA 4DCTA 5ESWA 3GGPA 5K45A 2FEAA 3C1UA 3HKCB 3I53A 5DM2A 4OHCA 4NQRA 1ZGHA 1Q86H 4G37A 4FGSA 2W2LD 2FW7A 3DMYA 1QIDA 5BW5A 3R6TA 1HR0B 4P08A 3ZQJA 3C8UA 1P0PA 2CLIB 1XA3A 3E7FA 3ZBPA 3X2EA 2F8TA 1JN0A 3FWNA 1RWNA 4I66A 2XCSB 1LC0A 1SVOA 5ESDA 1WQ3A 2IW3A 3CLTD 3MEQA 4MKFA 4AUMA 1UP4A 1QF9A 1NLFA 1VL1A 4WOCA 3HJAA 3RDPA 2MCFA 5KVSA 5IBCA 1ISRA 4KAXA 3G0BA 1UEXC 2HDNB 2CD7A 1F5NA 3Q10A 1V0JA 3LSYA 3WB2A 4HGZA 3BXPA 5HCIA 2BLNA 1U04A 3SJZA 5LDHA 4MO9A 1ND5A 4MJ3A 3TZKA 1P39A 1A77A 1RAGA 3EZ9A 1FNSA 2P6PA 4KV9A 4TQGA 1SZCA 2IODA 1Z75A 4DMUB 4HRVA 5BSEA 3ZOPA 3ZYZA 1JE1A 1KTVA 2WDZA 3DVAB 3UOGA 4MXDA 5CTJA 4R2HA 2YJNA 1T9HA 1ZLYA 4A0HA 1U0RA 3L6OO 4IFIA 1RJDA 4CV0A 3OQHA 4KXFB 1ATIA 2OHFA 4H1WA 5H81A 4JASB