3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
3UT5B 5LP6B 4YJ3B 4ZI7A 3VOBA 5IJ9B 2Q1YA 2RHHA 1TVKB 4X1IA 4I55B 4B46A 3N2GB 5GONA 5JH7A 2RHJA 4IIJB 4O4IA 3RYHA 5J2TA 3ZIDA 4U3JB 2VAWA 5EIBC 5C8YA 3N2KA 5LXTA 4X1YA 4O4JA 1OFUA 3HKCA 2VAPA 5EIBD 5IYZB 3R4VA 5KMGB 5KX5A 3WGJA 5EZYB 3HKDB 5JQGB 4DRXA 1W5BA 5MN4A 5LYJB 2R751 5MN6A 3ZBQA 1W581 3JALB 1TUBB 5IJ0B 4O4LB 4O4HA 4EB6A 4IHJA 3JAKA 5FNVA 1SA0A 3RYCA 3WGMA 3WGKA 5JVDB 1RLUA 5ITZB 4I4TA 5CA1A 4F6RB 4ZHQB 5CB4B 2BTQB 4WBNA 3M89A 3WGLA 4LNUA 5CA0B 3VPAA 5EYPB 3E22A 4ZOLA 3RYFA 3HKBB 2Q1XA 5LA6B 3UT5A 4YJ3A 5BMVA 5IJ9A 4YJ2A 1FFXA 1TVKA 3JATB 4I55A 4TUYA 4TV8B 5J2TB 3JARB 4O4IB 1Z5WA 3RYIA 5LOVB 2RHOA 4X1YB 4O4JB 2RHLA 4E6EA 5IYZA 1W5EA 4FFBB 5J2UB 4TV9B 4X1KB 3V3TA 4O2AA 2R6R1 1JFFB 5JQGA 4XCQA 5LYJA 3VO8A 3VO9A 3JALA 1RQ7A 4O2BB 2XKAA 4HNAB 3RB8A 3HKEB 4EB6B 1W5FA 5FNVB 4I50B 1SA0B 2GVIA 2VXYA 4EI9A 3JAWB 4X20A 4ZOLB 5LP6C 3HKBA 3JASA 5JVDA 5LP6A 4EI7A 4ZI7B 4F6RA 4X1IB 5JH7B 3N2GA 5GONB 4B45A 4IIJA 3RYHB 2BTQA 1W5AA 4U3JA 4LNUB 5C8YB 4U39A 3N2KB 5LXTB 3HKCB 3E22B 3RYFB 4M8IA 5LA6A 5BMVB 5KMGA 4YJ2B 5KX5B 4EI8A 5EZYA 4DXDA 1FFXB 3HKDA 3JATA 4TUYB 4TV8A 2BTOA 4DRXB 3JARA 2XKBA 3ZBPA 5M7EA 1TUBA 3RYIB 5IJ0A 5LOVA 4O4LA 3C8LA 4O4HB 4FFBA 4IHJB 3JAKB 3WGNA 5J2UA 4TV9A 4X1KA 1W59A 1JFFA 4O2AB 3RYCB 1RQ2A 3VOAA 5ITZA 1FSZA 4I4TB 4O2BA 5CA1B 1Z5VA 4ZHQA 5CB4A 4HNAA 4KWEA 5JCOC 4WBNB 5MN5A 3HKEA 5JCOA 4I50A 5CA0A 2VAMA 3CB2A 5EYPA 3M8KA 3JAWA 4X20B 3JASB
chains in the Genus database with same CATH superfamily
2BMAA 1WLSA 1WHTB 1YKGA 4K8RB 4UC0A 1TVKB 2RKOA 1D6NA 2V6BA 4UXJA 1NLUA 1EQUA 1TF5A 2X7XA 2FEMA 3F5MA 1GUAA 2EWVA 5D1NA 2ZSAA 2AC4A 5TT1A 2QTZA 3H4IA 5I47A 1VLVA 2Z3VA 4JLWA 1YZTA 3MBIA 3CLTD 4WE3A 1YQUA 4XDZA 5LLSA 1A8QA 3GA5A 3CRVA 3AEQA 2AL7A 4NMXB 2CL0X 4G0MA 4Y2JA 2WSIA 1I94B 1OXUA 5IM4F 2HJRA 1XSEA 4B8YA 1SJ9A 4D56A 4XB2A 4J4BA 4D92A 1T2AA 3WLEA 2HBZA 3ICOA 2X8JA 4BKQA 1ZEMA 1SIUA 3P8ZA 4UMDA 4ZVNA 5BT9A 5HKKD 4I66A 1O0SA 4BP9A 1P33A 3PFWO 4YCBA 5KNDA 4MCJA 1D2CA 3SC2A 3GFOA 4LTNA 1G41A 1DKOA 3VR4H 1J49A 3HB9A 5AJTA 1NYTA 2EHJA 1YV9A 4ZYUA 1USUA 4HLDA 2FOIA 3DOFA 3HHPA 2R3SA 1JFTA 2HI0A 1I1QB 1ZD1A 4JFRA 1P7YA 1RJFA 2DQKA 1FTSA 4EPWA 1WQ1R 2D5BA 2F1HA 4AUKA 4ZOLA 4TMKA 1UMBB 2VJDA 1U7XA 2JGDB 3UMJA 3FTNA 4L85A 4LJKA 5BRNA 2PJRA 1V48A 5EA2A 1EP3B 1RPAA 2VDUE 5FI3A 3CF6R 3DL7A 2HLNA 1EWRA 1AZSC 1FQOA 1KH3A 1W6RA 3P2MA 3O8BA 1RKXA 5HY1A 1YZFA 4BN4A 1TAUA 2G40A 2ZRNA 1NXOA 1RQNA 1UT5A 3PX2A 2WU1A 1YE5A 3NK7A 2BFCA 2YN4A 3F9CA 2PRJA 2QL6A 3OUUA 4EVSA 4WLNA 5IX8A 5KI6A 1BMFA 4H77A 4IMPA 5DPMA 4HHEA 3AUSA 5BQOA 4EATA 1PK8A 1URPA 4QOIA 4B73A 3AGKA 3ZWXA 5FORA 2RHBA 4FZ3A 4MR8B 3FRJA 4G1EB 4I9NA 5GVRA 3EDMA 3ZZTA 3V1MA 3GYBA 5JIBA 2QB5A 2OTCA 5LQMA 5KDLA 5JAHA 2QV0A 4C7JA 3THSA 1VOTA 3L7DA 3OIWA 1ORTA 3HXLA 2QAGC 4UDOA 2IUUA 3ZE9A 1VHTA 4B6GA 4D9HA 4NNOA 4UDNA 4ZAVA 3LWVC 1RHJA 3CYPB 2QUIA 3K7EA 4DGQA 3QFTA 1HA3A 4UPVA 2RGCA 2Q9AA 4LNAA 3QSGA 2W8BC 1W2HA 4Q4JA 3DXFA 2YWDA 4YRJA 4XSVA 2GN0A 4FOOA 2AKAB 1SZQA 2QA4F 4EFKA 3ETGA 1MRZA 3PUYA 1K6EA 2AZDA 1VPLA 3GVCA 3OKAA 1LC0A 4UBKA 4AG6A 7ADHA 4F1WA 1OFHA 2P78A 5G02A 5JO9A 2GMWA 2OLEA 2GXUA 3HCAA 1C9DB 1W52X 4GFDA 4WMLA 2AEEA 3UA4A 1G66A 4BWGA 2FLKA 1DAIA 4JP2A 2ZUUA 1K9MH 1OHHD 4S05A 1Z63A 1KI9A 3UNXA 1QCCA 2C3PA 1KO8A 2B9EA 3W2TA 4K9KA 1SAYA 2JAUA 2RHDA 1KZ6A 2OZLB 4Y9SA 4G97A 2OKGA 3ACDA 5LLDA 2BZGA 1DTWB 1KYYA 2Q0SA 5FWYB 5LP6B 1BCSB 2PFGA 1VHLA 3L0YA 3WQBA 2APJA 1DIOB 2NTEA 5A06A 3HN7A 2Y71A 2JW5A 1MH9A 5A71A 3U44B 3H0CA 3R77A 3ZDDA 5BSTA 1GNPA 2HCBA 5KEIA 4FFDA 4DOMA 1VP3A 4EPYA 3JQ8B 1RACA 3PE3A 3WIBA 4LFBB 3QI7A 4KIFA 5TB5A 2XKJE 1W5BA 2ZBFA 3UFBA 2IYRA 5JXJA 3I9MA 3DXZA 4G26A 1A82A 4E08A 1W3EX 3GB9A 3CBQA 2BFOA 2COUA 2VUTA 3AERB 3DGFC 3MTDA 2HU7A 4KAXA 4PBRA 3DSRA 5AESA 2YV4A 4LSGA 2C9BA 4D0NA 1QU2A 2ZRIA 1BS1A 4C0HA 2DUJA 1P74A 2B2CA 4OQEA 3DONA 5ESWA 5JVDB 4N9QA 5C1DA 1QYXA 3AVQA 3VH4A 3ZC3A 3RODA 2J6IA 4Z0NA 5BQFA 1GUYA 2GBFA 2FAXA 1B15A 1BH6A 2WINI 3OOHA 4PZLA 1TU0A 3TZCA 3K2XA 2FC3A 1VHDA 5HM8A 3AM3A 3KJNA 3GPLA 5JSKA 2BRUC 4DEXA 3I0ZA 4DA8A 2R7NA 3P45A 3DZJA 3L4BC 1N78A 3ULKA 3BCHA 4X61A 3UKDA 3H1FA 3PC6A 1GIAA 3EEQA 3Q3EA 3UPTA 3D3WB 1QG6A 1BKYA 1Z0IA 3NWOA 3DOHA 3I6ZA 3ROKA 2BLLA 4AN4A 4BZWA 1HTWA 3C3AA 1CKEA 1T2VA 1VJDA 1XDZA 2CJWB 3BH7A 2L26A 3ENNA 3HPQA 4E6EA 2DBVO 3BTOA 4R2XA 2VFAA 1C9MA 4OM8A 4IHKA 2HQSC 4J4HA 2UV8A 4WUVA 1LDGA 4GGOA 3U7HB 1D1PA 1JTEA 4KR0A 2J1LA 3PC7A 2BHSA 2XDWA 1E61A 1S01A 2A88A 2QIOA 2V7PA 2ZB2A 3LDUA 4KRYA 5LCXA 3HCDA 1KPIA 1NSYA 3D59A 4P8RA 5B1EA 4K9OA 3SS9X 3GCGA 4V02A 3DBRA 3K9QO 3VJKA 4FGKA 1LPMA 4NENA 1G5RA 1PX0A 2B20A 1TADA 3KYDB 4BO2A 4R1OA 1E0JA 2RGBA 3NUGA 3UCXA 5B58C 1AA6A 5GINE 2SBTA 5AM3A 1R64A 3U7FB 3NBYC 2KTUA 3DO8A 4K9NA 5L3ZA 1CSEE 1WSWA 4OF4A 1H1LB 1NVAA 5K0JA 4HLUA 2D5CA 2GYYA 4S1VA 4F84A 5KWJA 3T7RA 1DG1G 2CE7A 4BZQA 5LL6P 1JZSA 1Q8RA 2PBZA 4L75A 1PJLA 1TZJA 5EJ6A 2FZ5A 1M0WA 2V0NA 1MG5A 3LC1O 1O9GA 2A30A 2YWRA 3NALA 4IJWA 4KYIB 4UNIA 1KSHA 3DVQX 1Z4IA 2NU9A 4U00A 2NTYC 2IHNA 2YMLA 1QZUA 2IKQA 3VR6H 5A7FA 5CEEA 4DR6B 1UMCB 4K87A 4QYXA 3ICEA 2BZ1A 3SYLA 2ZODA 1QUEA 4FJ2A 4QHTA 4ZDWA 3ZQJA 5KNBA 5L3VA 2FQYA 4WFJA 3TIVA 4E7OA 1EZ1A 4HB2A 1H3FA 1ULBA 1UDRA 1YBFA 1K6JA 3PVZA 4BO8A 3LX6A 1KTIA 4IQFA 4DMMA 2GUWA 4A73A 1BJTA 1OXSC 2JGLA 1JIIA 3QNUA 2CHVA 1I80A 2VDNB 4P36A 4WFIA 4DBLC 1D0IA 1S3GA 1VPVA 3LA8A 4RESA 2MINB 4D3ZA 1LFAA 3HCFA 2P11A 3I05A 4RY0A 1KVRA 4XIIA 1GFIA 4WOBA 3ZDRA 1KWGA 1JIKA 2GPTA 5BSKA 1K8AH 4BY9D 2C7PA 3KLNA 4ZOLF 3V9PA 2FFJA 2ONYA 2B8TA 2XAAA 4XM0A 3L07A 4BVFA 5ILOA 3WJQA 1YUMA 2AYZA 4G8JA 4L4UA 3W2IA 3A4LA 4PSVA 5HCUA 4JSRA 3L8YA 1F8GA 4CCYB 4EMSA 2MSNA 1P1CA 2JD0A 4TSFA 3ZQ4A 3EY9A 5DRYA 4Y1GA 3TZQA 5EZQA 5I7AA 3A2LA 5FBWB 1D5CA 2HA6A 3GTZA 1F14A 1YCDA 2W2KA 3FLMA 3JQBC 4DZTA 1KOFA 3ERCA 2AH5A 1FY2A 1GHTA 1N57A 4ZAYA 4M88A 5KBYA 2RHWA 3T4EA 4EHNA 3UK7A 4KPYA 4MKFA 4WZBA 5CH8A 5BMOA 1P2DA 2B5VA 1YJ9F 2XMBA 2J46A 3HA2A 4BCBA 2X5OA 2R9VA 3FPHA 4I4NA 3QE0A 4JP5A 3V2UA 3LPLA 3PQCA 5EIFA 5KTMA 3HDTA 4AP5A 3K1TA 1QO7A 1R4MA 1W93A 2HDHA 2W2MA 5IUKC 2HUPA 3J81k 1AGXA 2FN9A 1KP9A 2P9TA 2QENA 4BNUA 4E3ZA 1FP4B 5G0TA 1EUDB 3LFUA 2FWAA 4WOKA 1JKIA 2EDAA 5I9IA 1DUVG 1H8HA 1PD0A 3KR1A 3NEJA 5TSDA 1GL6A 5IABA 2WKQA 1XMSA 1THGA 4DAOA 3KPJA 4E21A 1ZYUA 4RCVA 4YAJA 2XE8A 3DFUA 4DNXA 1PV4A 2O8DA 2XZTA 3D3QA 2K87A 2FPPB 3RUFA 3JYQA 1GGFA 1XPUA 2HMYB 4MAAA 4B1FA 3FVQA 4GKBA 4U7TB 3DMNA 3KKNA 1MAHA 4H15A 4QM6A 3VHRA 4ZANA 4IG9A 5K0EA 3IKFA 1Q7TA 4X3CA 4IIHA 1TAHA 1QIMA 1G7TA 1LDMA 2B83A 2OWDA 3OFVA 2DUUA 1PJSA 1Y4UA 2GO7A 3COJA 1U2SA 2OMKA 4YJKA 2NTNA 4KYUA 3KE8A 4EA8A 2O7NA 2BE9A 1G17A 3IA2A 2QLNA 3PLAC 2PGIA 1ZK3A 3NBAA 2OV1A 1P4RA 2ZBEA 3GP3A 4NU8X 2JJMA 2OB1A 3PT5A 5JI2E 3RQIA 3DDHA 1CV2A 3H0KA 1NSFA 1V0JA 2V5VA 3CUKA 1U7PA 1GJRA 4ZD6A 3SP1A 5CX1A 2Z1NA 4KLZA 1HQYE 1LQ2A 4OA5A 5J4LA 1H05A 2PD4A 3B8HA 4WNIA 4DPLA 1E9RA 1T1RA 3KNZA 4KX3A 4YAUA 3EDYA 1OXKB 4LV5B 3T61A 1OFUX 3B3FA 3DJFA 4QYTA 4IILA 4JT4A 1RRVA 4V24A 5D01A 4BNLA 1SHTX 3GUYA 2QLJA 3ZH9B 1A96A 1JSLA 1OBHA 4MPRA 3OT4A 5JYEA 4MS4B 1NXSA 5IXJA 4D4KA 4HAYA 3WGNA 1XXHA 3KLOA 1YB1A 2XWSA 3H9CA 3INYA 1JFFA 4QXAA 1VHWA 4Z1MA 1QGYA 3STWA 2PBLA 3NETA 3U81A 3NATA 3A9WA 1QX3A 2AR0A 2EFYA 4CMBA 1AKEA 4B44A 1GGEA 2PZJA 3Q5EA 2XY4A 1V7CA 4Q3AA 3RS4A 1EHCA 2OHOA 3UWDA 1CY4A 2XYHA 3ABRB 4DC1A 4KRGA 4M8SA 4R6XA 4KDFA 1ZH4A 4Q12A 3CUVA 1O89A 4P6VF 3W1EA 4YJ3B 1Y3IA 5BURA 2HHAA 2RHHA 1O4VA 1DTSA 4N6OA 4KREA 3NANA 1TL7C 3R5XA 3GIDA 3NKVA 3DC2A 4M1TA 1PNQA 1T36B 2ISSD 2XITA 3VPFA 5FBVB 5KYXB 3VXKA 2QROA 1YRAA 3CPSA 1Y8RB 3KZOA 3O5AA 4P4SB 4RKYA 3TK1A 3EXHB 1ATZA 4MR9A 4CT5A 3BDVA 4YLGA 5JLJA 2H7YA 1NF2A 3FWKA 1J25A 1QH8B 1QONA 3QYFA 2IEIA 1KDRA 2P79A 2O8VA 2PA0A 2ISCA 3CR7A 5T6BA 2XEXA 3R74A 3ZY2A 2XMGA 1FFYA 3GRAA 4OQPA 3CUWA 5I51A 2Z2KA 3N0RA 1U5BA 2CZWA 3E61A 2Z1EA 3QWIA 4GECA 3NV7A 1SXJA 1GO1A 2G72A 3ITDA 2BP7A 4KZPA 5BN5B 5GZ1A 1OPXA 3HXPA 2P3QA 5FOUA 3ESAA 1NV8A 2YICA 1RKVA 2OECA 3FWPA 3MN1A 4JLJA 3CCLF 1HE4A 5LWQA 2P9FA 2B98A 5BYAA 3HRKA 1MZPA 3ESRA 1M6YA 3LYUA 5CA0B 1VC2A 3BFVA 3OF2A 5J1TB 5TPZD 4MUAA 3EPJA 4BV9A 2YZMA 1TPYA 4N03A 2H8KA 1W2WB 3NFRA 1CT9A 2QKYA 1P7PA 1AUVA 4J76A 5CHYA 3S5UA 3W6OA 4BLRA 4CIXA 5DCVA 3NCHA 3NJRA 1J7JA 2CLMB 2ZM6B 2CB0A 2MYUA 2DY0A 5F64A 3N75A 4A91A 5L7YA 1D6SA 3K2BA 4GGMX 2GESA 2OCPA 4I36A 2C92A 4W1PA 2BEUB 2X8AA 3BBLA 4G9EA 1FNDA 3BWEA 4D6YA 4G8CA 1A4RA 2B3DA 5CH5A 1XXHE 4UBLA 3DEAA 1IQUA 4ONEA 2X3YA 3EC2A 3HYLA 2JD1A 1XBIA 2BFEA 2C2OA 4QXQA 3U19A 3OEWA 3AHIA 3PDHA 3DAHA 3K0BA 4DV0B 2V0CA 3RUEA 3VPSA 2DHEA 4XYMA 1JTFA 5CDSA 4RD4A 2X6TA 1Q21A 5EO3A 5EXDA 2IV3A 2HCJB 3M6IA 1P7VA 4NOMA 3FD5A 3BUSA 3JTEA 5F76A 4QU8A 5HRUA 1SKYE 4DUYB 2GCOA 2O5CA 1E1CA 1Z6GA 2IQQA 3N2GA 2V4ZA 2CCKA 1VJGA 4PQGA 2C20A 1QE0A 2PLAA 3ESYA 3LUAA 4N8EA 1WW3A 1RI1A 4B79A 2XE6A 1SKUA 1RMYA 1XAHA 3URKA 2G1PA 3TCNA 1SUFA 2P2DA 4BKPA 1H6AA 4OUKX 3IIIA 3VV2A 5A2GA 2W11A 4HMPA 3W4JA 2HSJA 4KWIA 4Y2QA 5FRDA 5ALGA 1P2TA 1EXVA 4GUDA 4UUBA 4BLQA 2JAOA 4DY4A 2JCGA 3ZK7A 1XP8A 2G9QA 3KJZA 3ANSA 3SNHA 3PJGA 3T7DA 3D5EA 4GZ5A 2CJYA 4PHHA 1SH7A 3MHPA 5BNFA 4ANFA 3U2QA 1SXJE 5A5EA 4LF8B 3VOAA 5K45A 2IHKA 5FPYA 3B1KA 4A8JA 4EYEA 5GOZA 2CV2A 4OHYA 1HC7A 1A4XA 2I2CA 4YB8A 3C6XA 3RF7A 1GEGA 1KI7A 2E85A 3JD1A 1UFVA 3L6BA 1LBTA 1Z6ZA 3OPYA 1FEZA 3QV1A 4U63A 1IMJA 4RGYA 2LIVA 3DE1X 4EP1A 2BGWA 4ND8A 3VDMA 5CDYA 4F5DA 3AL0C 3TG2A 4P3YA 3RBVA 5JSHA 1E7WA 2ZJ1A 1OLUB 2ZYTX 4UPDA 2NUPB 2PJUA 3KQWA 5JECA 1DELA 3N87A 2ZFUA 2CYBA 3WIVA 1T4CA 4F45A 1W4CA 2QI9C 1OWOA 2JJQA 4Y1FA 4YMIA 2C9MA 4DADA 2JI8A 2XYGA 5EZYB 4FQ7A 4RQBA 3JVDA 3ML1A 1UFQA 3ND6A 4YS6A 5CDHA 1TI7A 2VWHA 4JFAA 5DNYB 1E4EB 4K6HA 1YQ9A 5K3EA 5J4HA 2X86A 5DTRA 4MDYA 1GYRA 3WR5A 1E5TA 4G1UC 2H4ZA 1VL2A 3L8CA 1U0EA 3RVOA 2G5PA 4DT1A 1WNTA 3U1VA 1O0CA 1MXFA 1DX4A 2XZOA 3W9YA 5EZSA 1YA4A 2EKLA 1C1DB 3EAGA 2WUFA 4YT4A 1QHEA 3IBCA 1W19A 3RTEA 5K8TA 3JWPA 3HRHA 3G5LA 2I2DA 4WBNA 5K1ZA 3FLBA 3T99A 4V03A 1YVRA 3HS3A 5LZ7A 1HDIA 1V3QE 2X5NA 2VP2A 3LHIA 3PXCX 4O1MA 2CVLA 5G4UC 1GKKA 2YS7A 3A6KA 3EYWA 4YP6A 5F9MA 5C3UA 1SUAA 2KTVA 4PC1A 3RUDA 5HJEA 4KQ2A 2VDWB 4J1NA 1GCGA 1C50A 4BVTA 2BHNA 1HLPA 1AGRA 4KO4S 4DMLA 1B3RA 1LJ8A 3LDFA 1WVIA 5EKSA 2QVCA 4JLUA 2VPIA 4PWYA 3BJZA 1NASA 3F9RA 1IM5A 4HC4A 3B6JA 1QYIA 1V6CA 2OP0A 3IDFA 3RHZA 4FMCF 2AEMA 4EZIA 4D1YA 5DI3A 4DZZA 4AZ0A 3FCYA 4LRSB 1R0RE 3TZEA 3P9PA 1ZBDA 3LKZA 1ISGA 5HILA 3T7AA 5F7OA 2BUBA 1G2PA 3MS4A 2WW8A 1PU2A 4P7GA 2GO1A 2CUNA 1JR2A 2CXPA 3BJEA 4KPUA 2ENUA 4ZTUB 2YFKA 2ZAMA 5FTKA 3I34X 1FYDA 2NSHA 5JWRA 2YWFA 1DKRA 1KQOA 1Q12A 1C4KA 3GW8A 1KAMA 1Z0AA 3KVYA 4JZKA 1WQ4A 2VF2A 3DR3A 2NACA 4RLSA 5HQTA 4C0JA 1U9ZA 1K4MA 4P0PB 3VDRA 1GDDA 3GD5A 1EVYA 3L7OA 3OZUA 2DR2A 4DKXA 3KAKA 4PRKA 5JFOA 2Q5JA 2I2XB 2QDKA 3GAFA 4YRSA 1RBMA 1OSNA 1M2VA 3TOVA 4DQKA 3P9CA 1U0GA 3Q5GA 5K5EA 1ZHOA 3Q8XB 3STYA 1FDTA 1L4FA 2G28A 1BD3A 1MMFB 4OH7A 3T3EA 3NOXA 2J85A 3MNFA 3O1LA 4U0KA 4JYAB 4OFXA 1QB7A 3KYBA 3SEQA 4D9MA 4YQFA 5IKXA 2AC7A 1XTTA 4NRDA 2FP3A 4C7OB 4TS4A 2O2YA 1PT8A 3C1OA 1U8ZA 5TPWB 2G8NA 3SVLA 3QEMA 4H4DA 3X2FA 2VXOA 3IFSA 1PHRA 3PIIA 4IRMA 2Q8NA 4ZK6A 5CH3A 2WWRA 4QWMA 4BY9E 1FUIA 3UMGA 3VMFB 4R84A 1K9SA 1ZJ5A 2A59A 1XMVA 4X20B 3IUPA 4NAHA 2ORWA 4XW2A 2B7BA 3QBJA 1VRWA 1FQWA 3WWYA 1UBLS 4G9BA 5GONA 4KPGA 4CUKA 5T6MA 1O9HA 1LEHA 3BILA 2ZSJA 3DFKA 5C46F 1SG9A 2PUFA 5BYJA 4X0EA 1SO8A 5CK4A 4B80A 4CDNA 2PRSA 1RJGA 4RIEA 4OP3A 1YHYA 3WB2A 2GTHA 2Q5LA 4KLAA 1FA9A 4UQOA 2N75A 4GOLD 1C2YA 4RH0A 3SCZA 5BSWA 2E7ZA 4MW2A 4XWTA 2O5EA 1PG5A 1D4AA 2MR5A 5BQXA 3S3TA 5AW5A 1E32A 1RXCA 2DLCX 3TOXA 3WTBA 3DJYA 4AZTA 5DGXA 3PA8A 3V5NA 4JY7A 4Q7KA 4BO5A 1NN5A 1NOJA 3D4OA 3T1OA 4CMJA 3VH1A 3L4KA 1JSZA 2IX9A 3ZK9A 2HP0A 3BJMA 2E49A 3G6KA 3I6YA 3R3JA 4TZ0A 4F4UA 4ZQEA 2GD0A 4MW5A 2NQTA 3O4JA 3ZQUA 1E6LA 1ZRMA 4I5GA 1BMQA 1PNOA 4KWCA 4OQNA 3JQ9C 4EW6A 5A4IS 1OOEA 1NN3A 2QAGB 3IUMA 1EDEA 1EI9A 3PTZA 4JN6B 1U7WA 2ZI3A 4UVHA 3TIFA 1CUDA 3BMCB 3FH0A 3I9OA 4QYWA 1Z7GA 4HNGA 5JJBA 2XT0A 2W8BB 1YULA 5E1BA 2HJSA 3MMXA 3JD2A 2FJPA 2VIIA 4LF5B 3D1JA 1X3LA 2KS6A 2YRWA 3BF8A 5AWFC 4W63A 3D3NA 2HADA 2KWIA 4DRZA 4LBYA 5H70A 4MW0A 3G23A 2RH8A 4M60A 1LF0A 1QHXA 2I78A 1GUBA 1IEQA 1JPUA 5DB4A 1WDWB 1R2QA 3R7NA 3UGKA 3LUBA 4ZYTA 2GAJA 3GEHA 3OMLA 1WV0A 1OXBB 2EW2A 2QN9A 4INJA 9MHTA 3UFXB 1E8NA 5CBKA 1Q16A 2I4NA 3EIQA 2GVIA 2HB6A 3TSWA 3T1QA 4IUBS 1DMSA 2LWIA 4I8DA 2COEA 3JVHA 4YRQA 4EI7A 1SOAA 4PW0A 2ZTHA 4QRHA 4D43A 4K0KB 3ESCA 1CC1S 4XM1A 5G53C 3KUDA 1DT5A 4C4OA 1FFAA 1DAKA 5E9JA 3W5BA 3G1TA 3GDFA 3VKGA 1RHKA 2QAIA 1X80B 1Z4OA 4N12A 2XVYA 2XA1A 1WHSB 3AKDA 3IBFA 2C96A 1EFPA 2GD1O 2YQ5A 3QFRA 4FJ0A 4GZ3A 3LWPC 1ISJA 4FXOA 3KWMA 3N6XA 3RNOA 2RHRA 3BCRA 3GQVA 1DRJA 3L5OA 1M34B 4DVJA 1DAOA 4IHJB 1QKKA 2GHQA 2V7BA 3KQQA 3VCZA 4BFYA 2FFQA 5TXGA 2Z2XA 3ILVA 2AEJA 1U2DA 3GK3A 4HWTA 1NF9A 2R60A 3NPMA 4JROA 1MJ5A 2EQ5A 2WHQA 4MI3A 4D46A 2NNWB 1E3QA 4YT5A 2ZRPA 3X1JA 3AIOA 3S44A 3IQFA 2LRHA 4AUNA 2JPDA 4NARA 1AKRA 4GBMA 1Z2NX 4GLFA 3LX4A 2Z57A 4DIBA 5BQ3A 4LZNA 2VYND 2KJQA 4W8OA 3ZDBA 2P62A 4DMFA 5BNIA 3C74A 1YB5A 1U02A 3L41A 3RUAA 5JANA 2OO5A 4UTOA 1CHDA 4EB0A 1T2CA 3VKHA 2H07A 3KJEA 5J9FA 5DXJA 5EIHA 1H8EA 1C4WA 5EZ5A 1US8A 3V97A 5HQ3B 4R3WA 1JPJA 1I3LA 3H5LA 1GU0A 2CXHA 2WMDA 2FX2A 2XVAA 4E31A 2PKQP 3CRMA 4QATA 1VQVA 1E92A 4FR5A 1OYOA 4QTZA 1R6TA 1I7NA 1ZM9A 5A1JA 2ATEA 4A27A 4DR7B 1TW2A 3IHLA 1O58A 3E8XA 2P4HX 2C03A 4G1CA 3M6AA 2HMVA 3RVLA 1F5SA 1JQAA 2CBGA 3N05A 3WJ7A 3MJTA 5K3OA 1JS1X 4DWJA 4ZRNA 2WIDA 1Q3KA 1QDLB 3BZBA 4IVPA 4RTRA 2JLVA 1YCGA 5T41A 4YT8A 5B55A 1MNQA 2BGUA 2I0FA 3SFZA 3U49A 3WO0A 4UKDA 1YTLA 2ZJBA 4AKSA 5A62A 1CE8B 1YOVB 1VPEA 1D8TA 2H0QA 3LQ2A 2CVHA 4R7GA 4QE3A 1ZD4A 3RFXA 5K4AA 3H2GA 4RPKA 5A03A 3OKCA 1HKUA 3OX2A 1EFDN 1P77A 4LQLA 1W42A 3QBTA 1DEXA 2AXQA 3BWMA 3ES9A 5H9VA 5CVJA 3BMNB 3GLHA 4E15A 2JI6A 3C8ZA 4KBGA 5KQSA 4GSYA 3O9VA 2ZJYA 4Y67A 2E4ZA 4HAWA 4PAGA 3I55F 1PZEA 2GPSA 2UVPA 2HPZA 2GJAA 1ZH2A 3DFFA 3E9DA 1KOLA 3TN7A 1FRVA 2XGMA 3TQQA 2JCYA 3F2IA 1E94E 1NYRA 5KNCA 3VO8A 1U1DA 3ANYB 1NMXA 2HX0A 5AVMA 1WJGA 4XI9A 4AP9A 2CXXA 2ZETA 3C1TA 2Z5VA 4RE6A 3VPHA 4MVJH 2FZGA 2JIZD 3BERA 3GCXA 3G2LA 2Z4TA 2GBLC 3L9WA 1BO6A 3QXXA 4Y3UA 3V46A 4AC9A 1FSFA 1KAGA 3O21A 1ZD2P 1NC1A 3HH8A 3AJDA 1YD7A 1VPTA 1KS9A 2K4MA 4DC9A 4KK3A 3A9RA 3KZ1E 4XLTA 1KO4A 5EJEA 5HK9A 5KYUB 3BS4A 3OBIA 1OD6A 1D2NA 1WUJS 4MQ6A 3W5UA 3GLFB 2YS6A 5J4KA 2FN7A 3MM4A 1M1YB 5DX0A 5EMJA 4TYPA 5GONF 3O4HA 5KWIA 3Q8KA 3OU6A 2R1TB 3Q5DA 3SVTA 3EFBA 1HFWA 4HNUA 1OH6A 4R51A 2WLSA 2OBXA 3OY2A 1P8JA 3R2JA 2DLNA 1PJAA 3ABOB 1SB8A 4ZREA 4ARAA 3DTVD 2EWMA 2PPVA 3K9FC 5EL0A 1G2IA 1QO9A 1YKSA 4FFWA 5HIAA 2Q50A 3UMCA 1ADFA 3ZE2B 1I0IA 3IVCA 3OAAA 1BN7A 1O5TA 4DR5B 4EHBA 3OM9A 1PFUA 1SK8A 3F6YA 1A9XB 2D06A 4OBXA 4UEWA 1X39A 4HUQA 2QJWA 2OQIA 2OV3A 3KIPA 3KUXA 5TMEA 3HMKA 3ZGNA 5MFPA 1KOGA 1EVZA 1HEYA 4RY8A 3OE4A 4ZVOA 4PO9A 1JPVA 1B8VA 2IOQA 1LBIA 2UDPA 4EEXA 1JJAA 4E1VA 2NVUA 4DCJA 1U3GA 2VBGA 2YR0A 1KJQA 4D0SA 1WQ3A 2CL6X 4FZJA 4BDTA 3VKWA 3C5WP 4WK4B 2WSYB 1Y8ZA 1KYTA 5JH7A 4BP1A 4JQOA 3Q7QA 1ZW6A 1EBFA 2Z5LA 3O31A 4WEQA 1O87A 5ALTA 3IO3A 4ZT4A 4BNHA 2A0UA 1ENPA 1NW4A 4WA7A 2I2AA 3H6GA 1EHYA 1JLHA 4JAVC 1M5TA 1LPSA 2JJ1A 1C5KA 5DYNA 4BV3A 5FWXB 1X42A 3Q3GE 3HY6A 1Y48E 2QBYB 2AG5A 3PFHA 2J3MA 4TN5A 3H1TA 1O0BA 3EPPA 2W6QA 2ATVA 3CCCA 4BAGA 3PQEA 5L51A 3O7WA 4YAWA 1FJ2A 1OFTA 2EKBA 4MRRA 3BF7A 4C3VA 3ZJ4A 2HYDA 4Q1VA 1LNQA 3UJ7A 1JYEA 1Q1GA 3SHFA 1HYHA 1FS4A 1BX1A 3K0CC 4QOEA 4CLRB 4CN9A 1CUWA 3WGMA 4GXQA 4WXRA 3V4VB 2Q46A 5K0FA 1AJEA 3E2MA 3VSDA 3L7CA 4OMCA 1IUOA 4MWTA 4IDPA 1Y1TA 4FHZA 1U94A 4G2TA 3UJCA 2QM7A 1A1SA 4GYJA 4AYTA 4YXFA 5AW8A 2ZYHA 4NF2A 3WLAA 2WYHA 1OTYA 2VUSA 3E1GA 1T13A 3FJOA 4NC9A 4KQGA 4TS9A 2J5RA 4ZALA 4RCYA 2ANBA 2KE5A 3TTSA 5IXYA 2QRLA 2ACKA 5F1KA 5SICE 5DWDA 2I66A 3T9FA 1P19A 4UCWA 5JS7A 3OZBA 4TQAA 1MIHA 3H2JA 2G77B 5LOVB 2ZJOA 3W6NA 4BO1A 2PX5A 3DEIA 5F5NA 1UP6A 1Y7LA 4L4ZA 1EGAA 4TYMA 4BNDA 1YDMA 1XT6A 4Q1BA 1ZL2A 1T0UA 3OT1A 5LZ4A 2DYKA 2OVFA 2FN4A 3C3XA 1HT0A 2ZI5A 3Q6MA 2YINC 4OQLA 3ZGZA 4MP3A 3M3HA 4AY6A 4WN3A 1KJYA 1OMOA 1QZTA 1USGA 2VDMB 3FKQA 3PFFA 1YVDA 2B0JA 2O5VA 4LV8B 3G79A 3KU4A 3PFBA 3E4CA 4RHTA 5IPFA 2Z6VA 1UADA 3QJGA 4ALMA 3H75A 4FR2A 4MICA 1N3IA 3PCRB 1I10A 2A1TS 1P3Y1 3C6MA 4UAVA 3WLLA 2UXCB 2I6XA 3EVGA 4RD2A 3HK2A 1YDGA 2GLZA 1DC7A 4KXLA 3VBCA 4UVEA 5LIRA 2WJGA 3JS5A 3JYNA 4FW9A 4H1HA 4IV0A 3ZHYA 5DM60 2JI9A 1OBVA 3GQBB 3C41J 3Q7IA 1TX4B 5KWVA 2DLDA 2CN1A 2V1XA 5KTYA 2V7GA 1OLXA 3KHKA 4YUXA 2QSUA 4EFMA 1J2EA 5AUPB 3HKDA 2H48A 2JGKA 1VBKA 3BH0A 1YVEI 3ORSA 3I04M 2EJTA 2P9EA 3N28A 4JLKA 3VHXB 3LS2A 1C14A 4A0SA 2WUWE 2PO7A 3D00A 5IJZA 5TVGA 4C6HA 1Z13A 4Y18A 1L5FA 3WGGA 5E7QA 1KZ1A 3BBPA 3AUUA 3ZVRA 4F8JA 2ODAA 4PYKA 4N39A 4D0GA 2QM0A 1LF5A 4EJSC 4OQQA 4AX8A 3UWMA 5GV7A 4HYQA 1NNEA 4AI6A 1WB5A 1OAOC 4IQGA 1BE6A 2GF9A 4GNRA 2I87A 3R5KA 1GA4A 4U0JA 3SSNA 4EUKA 4LPKA 2O54A 1E1NA 4C7MA 3ZGOA 1KRXA 3HA5A 4AURA 4PN3A 4I50A 1TGYA 2AFRA 2D1SA 3QGMA 4QARA 4HXYA 3CB2A 1MB3A 5LZ2A 1GGNA 3JAWA 2EJUA 2PUTA 3L4SO 2PMDA 1FLDA 4HD8A 1JEJA 1DC8A 5DXFA 3ZX5A 4B9AA 5IMBA 5IKPA 2H8EA 3DYVA 3L4EA 4U2FA 1RM0A 3G8YA 3JWJA 3BSSA 4Y2TA 5ED0A 1NWCA 1U8UA 5D51S 3PF9A 1V95A 4A82A 3R24A 1Z2EA 3B9PA 2C4VA 2EKZA 4EVRA 3EDCA 2ZKLA 2H2HA 4MYSA 1WR8A 3CEHA 3SE0A 4FTWA 1TYCA 4NMWA 2IITA 3ENKA 1N0UA 2FWBA 1QHFA 1DARA 2LP4Y 4YJGA 2IXTA 3GP8A 4C20A 2GEVA 4CFSA 3LHKA 2C2XA 1VIVA 3VNSA 4YYEA 3DOEA 1FQKA 4JQYA 5GTDA 1ZCZA 5FFMA 4IIYA 5BOSA 1KNQA 3OEEA 4OK5A 4TLLB 5FDFA 2FUEA 3BXOA 3PR2B 2FGYA 2E6KA 2IV2X 4DSOA 1PUXA 4UNPA 2ZSKA 2VHJA 1BNCA 1XJ5A 4JYPA 1IJKA 1V9LA 3LA6A 4Q37A 5ALMA 1M7GA 4O2LA 4YWJA 4RVOA 5FOTA 3DPSA 1ABEA 3NT4A 2WWVD 4RVGA 1QDEA 2WU4A 3OX1A 3TD6A 4Y30A 3BL8A 5L3QA 3D7NA 4MYTA 1ICEA 4EH1A 1ULAA 5I45A 2OV6A 4M22A 5B37A 2Y66A 1QOPB 3TJZA 3DEZA 2W6OA 4FFOA 4IV5A 5CT6A 2NPOA 2V6MA 1RAFA 2QE7D 1NJ8A 2LZ0A 3SEAA 4B8WA 5IT5A 3ITEA 4IDAA 4LAFA 3IDSA 1NBAA 4P7FA 2ILTA 3FCOA 3ZVMA 3FTCA 4CGYA 3MSCA 3A14A 3PRHA 3AFMA 4R41A 4C4ZA 3B6KA 2DYYA 3M0EA 2NZYA 2IF2A 3OQJA 3VAYA 4AU1A 1PS9A 5A6VA 3FJYA 4FLMA 3RC9A 3QOFA 4UEOA 4WCFA 2CNKA 1KP2A 3K0FB 3BK2A 1Q0RA 5HE9A 4A6XA 4L02A 1P4GA 2PR7A 4WK2B 2KBFA 4LJ4A 3EPHA 4CQMB 3K4PA 1LWNA 2OHGA 2QT9A 3MINB 1W6UA 3ITKA 2PX4A 1PIWA 3I9V1 3H1PA 3QLUA 1HE2A 1W34A 3D5QA 3V1TC 2VRCA 4JVNA 2Q2OA 1MXHA 1ZITA 2DWQA 2QT1A 4URZR 5T4BA 2VAVA 4BLSA 1FFSA 4MMXB 4QRIA 3R40A 3I9V6 5JH7F 4RJJA 5LR6A 5AXDA 3HZRA 4MQEA 2OE2A 3NU1A 1TM7E 5DW3A 3WOHA 4CF6A 1VSTA 1N8TA 1Z56C 3IAM1 2G1KA 3W8EA 2FHPA 1W7AA 4NPAA 2VOJA 5FI0B 5AUNB 3OP4A 4DRXB 1ECPA 2CD7A 3FYUA 3W9UA 5CPFA 2HXGA 3PX7A 1TU4A 4L0MA 4JXXA 3IJEB 3NONA 3JWHA 3LDGA 4J0GA 2RGDA 2W6NA 3IAM6 5IZCC 2ZRAA 3O73A 1IN6A 1RXEA 2OCIA 4Q3KA 3VR5D 4GZMA 1ONOA 3U4IA 4P4GA 3T3PB 1NVVR 4R01A 3ESJA 5FUQA 1IE3A 4E5KA 4A8TA 1N1MA 1IONA 4GPD1 4XWOA 5EPUA 1E8MA 2B6NA 2CVFA 4IEIA 3HO1A 4AXBA 3FUVA 1WOYA 1F6WA 2CXTA 3KT3A 3NGMA 3WKEA 3LM8A 3M6UA 4NZPA 1T25A 2C8VA 4U02A 4URYR 3SMVA 2B4TO 2GPJA 2WJVA 5J63A 4UE6A 1P9WA 1Q2XA 3E35A 1GG2A 2ZBVA 1NM5C 1XEFA 2B6HA 2REQA 2ZPAA 3HFJA 3IAEA 4TLAA 3RIXA 3CX8A 1VQOF 1RKBA 4IJMA 5ALWA 4ZT6A 5CG2A 2Q6TA 3O26A 3R8CA 1Q1BA 4GZLA 1VIMA 3IP9A 1M8KA 3VUEA 1L5OA 1T5OA 4K05A 2JA1A 5IYZB 4Y1RB 3EIFA 4Z9AA 2FG5A 3MWDA 4W5JA 5KMGB 1G16A 1IL0A 1KMNA 5EMKA 1GZ0A 3QIVA 1FBNA 2MSDB 3W8FA 3DDUA 4I3FA 2JAHA 4E5YA 1O3YA 2Q4EA 5MN6A 1TT5B 1M6NA 2JANA 3WK6A 1MBZA 1VQLF 3TQOA 2R7KA 1T91A 5EXPA 2WJPA 5F33A 1II8A 1A8PA 3W8RA 1BRMA 5HCIA 1WLYA 2QNRA 1FNKA 4S3MA 4OI2A 5COQA 1G8PA 4JI7B 3C3CA 3U4DA 2QX4A 2PG3A 1ZKMA 3IEPA 4D99A 2GNOA 1ZAYA 1TTHA 2CC2A 5JBNA 2QE6A 1NW7A 4PZYA 2GX6A 4IJQA 4OAOA 1U8AA 2H5JA 3HJNA 4NATA 5FBRB 1E7QA 4A0GA 5LJLA 3H84A 1B8PA 2C83A 1NUSA 4S1TA 2BEWB 4NNJA 1OBOA 1Z6QA 4KI0A 2V7WA 4IZOA 3WK7A 1COWD 4PS1A 1BVYF 1MJHA 2ORVA 2ZPUA 3EGXB 1KYWA 3UT0A 3BB4A 3LBNA 4XE5A 3R9KA 4MW9A 3HA7A 4JR1A 4YHBA 1JI0A 5C7IO 2WUDA 3U16A 4KQFA 5EIAA 4TYYA 3DEFA 4TLCA 3K9BA 5BSUA 4JI1B 5E6UB 3RHSA 2NT3A 3NYWA 4Q4AA 1KZHA 1Z0UA 2NLOA 4LSMA 4OXKA 3RTBA 2QD3A 4QTXA 5G4KB 1LB1B 5I8ZA 3SZOA 1FF9A 5AHXA 3JAMM 1B0UA 1VH8A 5AOBA 2HRRA 5KKCA 1CUYA 5B8FA 1WOMA 3GRPA 3HKEB 1KVSA 4EB6B 2WM2A 1IEVA 3HM2A 2Q6LA 3P2IA 3GYGA 4R9UC 1R4AA 5KHAA 5CVDA 1Q1QA 4M8KA 4DMRA 5BRJA 3EZ7A 5DLDA 3IPXA 1OUMA 4LVCA 4I50F 2PS1A 2H4JA 4IOKA 1JDUA 1UEIA 1E5VA 4L8FA 4FFSA 3TEFA 2AMYA 2OSVA 2PTGA 2WLTA 1G98A 3K0SA 1IPAA 4CF3A 4Z49A 2DFTA 3RSSA 1Y3AA 3VSAA 4D5GA 2F1RA 3K0HA 1G42A 2Q5EA 4MB6A 4K88A 2G7ZA 3U9SA 1V8ZA 2H2WA 4KLCA 5I3CA 4Z4QA 3K8ZA 1J4AA 2JFNA 2H3HA 3BD9A 2H5LA 3B2QA 1UUFA 1UQTA 1TFRA 2DHCA 1Y5IA 4QPJC 2JK1A 5HJ2A 3LHSA 4E32A 3ZH2A 4YLYA 3CKMA 2YHAA 3I4LA 3HBJA 2ZB4A 1C4OA 3DZGA 3V7EA 1RAAA 2GCGA 3DZFA 3GAZA 5FF9A 1NBMA 2G1UA 4WOCA 2WYUA 2NU7A 4IH4A 3IELA 1V71A 3FPGA 4Q7QA 1QVAA 1SWVA 2DOKA 4P22A 2QSJA 4UCXA 4MTLA 2V55B 5KHOC 1U2PA 3RYCB 2I71A 1FDWA 1QC5A 1VLQA 2NZJA 3BQMB 3HN2A 3QTBA 1X7XB 2Q3HA 5I8WA 1NUPA 3G8DA 2J9XB 4NYIR 2JIPA 4M6WB 3UXYA 2CF6A 4JQZA 3ED5A 1GZ5A 1HFJA 1K7FB 2LCAA 1OAAA 1MPXA 1V1JA 1WXFA 4QG7A 2Q0HA 1N92A 3RS3A 5JATA 2KBEA 1Y9DA 2DFDA 2AD1A 2O2CA 2IA5A 1K8RA 1NJFA 3PWTA 4TN1A 5ANRB 3OMXA 2DECA 4UUOA 2GM9A 3G0HA 4YAGA 3MELA 3Q3CA 2G5CA 1BHO1 1Z4NA 4UHBA 1EXWA 1PL6A 5I48A 1RZRD 4FCWA 3ZJTA 1U4OA 1T4MA 2QHXA 3KQMA 3NWEA 3CW2A 4M4SA 2XA2A 3WGJA 3SBOA 4EMTA 1I2ZA 5EQJB 3WRVA 4EYSA 2ZTSA 1NBIA 1V4NA 3NHJA 4Z3KA 4QG3A 1BW9B 1JNYA 4WXHA 3OCZA 1UBSB 2LIPA 4RKWA 3ETLA 4Y1EA 4OBEA 3ET4A 1AY0A 5D3KA 4F3CA 1THZA 3GGJA 2B5WA 3KL4A 5INTA 4RENA 3EARA 2GLTA 1WP4A 2B21A 2P1ZA 1G4HA 1KXJA 1AN0A 1M1XB 2Y27A 7REQA 1O95D 1JPNA 4EDHA 2KB0A 2Q29A 3MMSA 2LBPA 4HLCA 4AO7A 5EHIA 3EODA 1LLFA 2P9BA 2R5NA 3JVUA 3ECCA 4BQRA 3U60B 3R1IA 2OAGA 2HMAA 1ZJ4A 2JH8A 2WD9A 1RQRA 1DWQA 1VI5A 4FGSA 3VC1A 3FPSA 1P61B 3ELBA 3Q9NA 2P2GA 2G83A 4HDOB 1M0TA 3U4HA 2YW9A 2PCJA 2AQKA 4LSZA 4DLSA 1Q1AA 1MX9A 1QFYA 4MA5A 3BMOB 2X6RA 1DGQA 3F96A 4PINA 3W5VA 3OM8A 3LF1A 5DNWA 4PXYA 2WIAA 3D2LA 5IT9A 4HR7A 4F5YA 4KQ9A 2R6R1 3BA1A 2DT8A 3K1AB 3GGGA 3MG9A 2PVCA 3C15C 3D8HA 3QUBA 4ZT5A 2CW5A 3VNUA 4OOEA 3AB3A 3O3NB 1JZTA 3EB9A 2GRUA 3WL8A 1EG2A 2HK6A 2AK3A 2WHPB 4HEA6 4YI5A 1G9TA 4BFUA 3L6DA 1XZIA 3BGVA 2QUHA 3FUWA 5IULC 1LS6A 4Q4HB 3L1HA 2IY7A 3ZU3A 1W2BF 3GJXC 2WE7A 4AXXA 2XKKA 3EZ9A 1IATA 2JKZA 1JU9A 4YP1A 3PBKA 4IXDA 5CW2A 5EP2A 1YL6A 2X3FA 2C4HA 1QFSA 3H6KA 1L4GA 4RPLA 2E89A 4YXWA 2YYSA 5ICMA 3D54D 4B75A 4TTPA 3TX6A 1F2TA 4M21A 3ZN2A 2ZWOA 3RNLA 3CZAA 1D2EA 4TUYB 5DP1A 1ACLA 3LYBA 3FNHA 2BTOA 1U28A 2YDYA 2M6RA 1YRQA 1YB6A 1ZN9A 3CPJB 3OZSA 3QV2A 4EKYA 1R4ZA 3NTOA 2PQ2A 1QIFA 2OCDA 1CUEA 1ITZA 2O2EA 2FWPA 4U7JA 3UAZA 4BFCA 4DMGA 4HVLA 3CZ4A 1UBFA 2OY0A 5GM1A 3SMQA 4QDTA 2F3PA 5AJVB 2DUMA 2BFDA 5HIIA 4OLAA 4DG9A 2AOUB 2B5OA 4F3NA 1DQSA 4NABA 3FIUA 2P30A 1A8SA 5CA1B 2IYPA 3SLRA 1J2YA 3SN6A 4R16A 3SR4A 4CTOA 3CISA 1VB3A 3B13B 4I1UA 3W9SA 4D82A 3N2YA 3R0IA 4DEVA 2F43A 1M1KH 3D0OA 4KUEA 4YASA 2ZRGA 1E58A 3DZIA 4QU9A 1XF1A 5AJHA 2WSLA 4J7CA 2FRXA 4B31A 2X5XA 2GT1A 2P0EA 3RVJA 4XAQA 2QM8A 3FETA 4LWQA 2FPOA 3ZWCA 1LZLA 4U1RA 4DWWA 4B32A 2BUCA 3BXPA 3W3AH 2DSTA 4LCKA 3LWOC 3DE2X 1FP2A 4R5HA 5AW1A 2PUCA 2NWQA 1ST3A 3HO8A 5T4EA 2NUAB 2QSZA 3P0JA 3LDTA 5KNLA 1XRGA 3EEOA 2HU8A 1QV7A 4TGLA 1EAMA 7MHTA 1EM8B 1XDSA 2Y4NA 4KXUA 1C0IA 1K6MA 3CSSA 1TA4A 4Y6PA 4HQFA 1R6VA 1P4HA 3RAGA 1VG8A 3P0RA 4HN4B 4O4LB 3VX3A 5U4XA 5CNIA 4EJMA 1IUPA 4IJUA 2CMDA 3LRPA 4YP0A 4G5FA 4J7AA 1G3MA 3F78A 3FM9A 3ZI7A 1KHHA 4J0CA 4COKA 4DCVA 2XECA 1XLWA 2OXRA 4HMOA 1YC5A 3S0YA 4MB2A 5GGYA 3UQZA 3A10A 1GPLA 2B1GA 1E2EA 2CZGA 3G5UA 1AB6A 1JAYA 4QNMA 4AQDA 2G6BA 2QJOA 1PO7A 2XJ4A 1OTXA 2GCIA 3BD8A 2F9LA 2OTJF 1VMDA 4QDJA 3K70D 1SDSA 3CMAF 1B2RA 1CZKA 4YMWA 5UKDA 5CURA 4AG3A 4C0WA 2Q1XA 3Q85A 4EMBA 2OHWA 3SC3A 3RS5A 1TVKA 2X0JA 3L1UA 4KE8A 1PNVA 1L5SA 3R8FA 4G63A 4LOJA 2NNLD 1E99A 4KH0A 2BMDA 1LCIA 3OOYA 1S2GA 3SHTA 4G5HA 3DBVO 4NCHA 1TM5E 5I9MA 1KJ9A 4B3JA 1QF6A 1MVLA 1PQYA 5EJ5A 4XVQA 4MCIA 2WZDA 4PG4A 2WTNA 3I56F 2P6RA 3R5TA 2GPNA 2MHCA 1ML3A 4B35A 1W4RA 2F9MA 4ZVLA 4UDXX 2N42A 5H4HA 3OE7A 2A9PA 3HGMA 3D81A 3DL2A 2WQ7A 1XDGA 2ZP1A 2IS4A 3KJGA 3F0GA 2Z3WA 3AZQA 4OMUA 2FPKA 3UJBA 3NDBB 1I24A 2PU5A 4US1R 1DRUA 3AR9A 1Q17A 1DAHA 4I08A 4C0QC 2BCJQ 5GINC 1JDTA 1ZMTA 4PZCA 3ZWPA 3O6VA 3D7SA 2HLPA 1S4QA 1TE2A 4Y9TA 3FCEA 3IQDB 5KREA 1UMBA 2REXB 2QNBA 3N58A 4R2HA 1W5TA 4K1LA 3W5HA 4NICA 2CMFA 2JGDA 3QY0A 4XARA 7REQB 3FLEA 1I7LA 4GM4A 5AI9A 1PZFA 1PDWA 1SHKA 2ADFA 4XTCS 1QGZA 2YJ5A 2V7UA 3D8SA 3RKRA 3WDKA 4YUWA 5CD1A 1S02A 1PWEA 3DH0A 3X1KA 1P1JA 4RF4A 5J40A 2P1DA 3ANXA 3UZUA 1QORA 2JFHA 3NCTA 2C4MA 3Q72A 3FVWA 3QX7A 5CVEA 3IE1A 2BYTA 3H6HA 4JT8A 2VSFA 1OU0A 4XJTA 1I1HA 5JAPA 3WJPA 1TLLA 3GDHA 3H1BA 3Q3HA 2YNMC 4G1BA 2AOTB 3GGCA 3BC1A 2M6SA 4UBMA 3N0XA 4DCSA 4K9MA 2JLRA 4PO3X 1R6BX 1XAIA 5JD5A 3UB3A 3NAGA 4XYBA 9ATCA 1I2AA 1W0CA 1FFEA 4MR8A 1ICIA 4HCJA 4J6EA 5KZMB 4PTZA 1L5WA 1RYYA 3WMFA 3OICA 3AEKB 3CT6A 2C4KA 4LRQA 4HBGA 4I55B 4I9HA 5G0VA 4ZKDA 2CHQA 2POCA 1BGVA 2MSCB 3WWPA 1HDOA 3AM4A 3OCJA 4MQUA 4XR4A 4TVKA 3TAUA 3SOPA 4J1QA 1KIMA 1R3UA 3WJ2A 3B51X 3RFVA 1Z83A 1W75A 1QG0A 1QQ5A 1O94A 4XPIA 2QPTA 4INZA 1P2BA 1CUJA 4ML3A 1NQ3A 4MKGA 1KEPA 2VXCA 4Q6BA 4QODA 4UCQA 5TQ0A 1SVSA 2Y9MB 3NC0C 2WTBA 2WAYA 1U1CA 2CLCX 2WU8A 3AF1A 3WV4A 2PMPA 1KNXA 4B3MB 4OYYA 4H6VA 4NBTA 1VCOA 4OHRA 3RUPA 3PEUA 3GFSA 1YZVA 4N0DA 1I32A 4L4XA 3ZLTA 1XTVA 4BMYA 5JHGB 1P2UA 1H6DA 2JDID 4PNEA 1JHOA 1TD1A 2QTPA 2OMEA 4YN3A 5H81A 1MA3A 2VC2B 1E2IA 3I72A 4ITVA 4KO8A 4AJJA 3FCUB 4I8IA 4DILA 5BVHB 4U7GA 4QA9A 2BC9A 2JGIA 1FLVA 2W0SA 1U1FA 4DLBA 2OZLA 2GPWA 5J58A 1ESDA 4NJEA 1JIJA 5FWYA 1BA3A 2W6ID 4BIMA 4O33A 1A2OA 2JIOA 5EGNA 1G64A 2W22A 1FTNA 1FXUA 4B9EA 1IXRC 2I4OA 3MOIA 1WF3A 3OZGA 5EKTA 3TI9A 4ETMA 4YDQA 2GM3A 2G9VA 3N8NA 2G06A 3NZEA 3U44A 4JOSA 2Y77A 3OFSA 2YMMA 1UXGA 4MKHA 2AX3A 1Y1QA 3AOEC 2I91A 3MBKA 4E0BA 1H66A 2CJPA 2H00A 3CVXA 1SBZA 1LU9A 3SS7X 4D98A 3H5RA 2WF8A 3BTSA 5ER9A 5KS2A 3BE5A 5BVGA 4TS3A 1W40A 5L6MB 4DKJA 1E3IA 2JHCA 2XTAA 4NJMB 5CXUA 4FM9A 1H22A 5FH9A 4D26A 1HLGA 1NFFA 4Q47A 1C9YA 3AERA 5JNRA 1W5FA 3EWIA 1ZR2A 5K8UA 1RAIA 1K97A 1P5HA 5CIQA 5EMLA 4L7VA 4JA2A 4C88A 5JVDA 2HJHA 2OA0A 2VZEA 3DB1A 5BXYA 4GG1A 1N2SA 1Y82A 2J0UA 3R7FA 3OLZA 3RJ9A 3K6SB 3ZLVA 4CTJA 2NZ8A 2DF8A 2VP5A 1JVBA 2VN8A 3FSGD 4HOYA 2TMYA 2XB4A 4J0IA 3I01M 2ZB8A 1QZ3A 5D3MB 3F46A 4C3OB 1QO0A 4J07A 4PFQA 2V9CA 1GZSA 2BDEA 1TUBA 1H0RA 5CCXA 4JI8B 1N3LA 3A6FA 3BXFA 3DD1A 4KV7A 1QRRA 1GPKA 2GXSA 4CPDA 2R11A 1E79A 4RBNA 2OQVA 2ZJ4A 4R1LA 3VKUA 2O57A 3WNZA 5JQWA 1FPQA 3DNFA 3R7LA 3TKYA 4HO1X 1CJCA 3RAPR 1CR1A 4IVNA 4DLTA 1QHNA 4Q1AA 2GDZA 3P4EA 1W0KD 5HIMA 2PSEA 3UXMA 3S0WA 2W6PA 5ALXA 3DDWA 1RBYA 2HMUA 2RMKA 4JP3A 1BXGB 1VQMF 3UTCA 3HKBB 4J8PA 3GOHA 3EISA 5AM1A 2FUG6 4LY6A 3SR3A 1VDMA 1NKTA 3FDXA 1NW3A 5IDQA 4J0KA 4FMPA 2DFVA 3DBLB 3PDIB 4P4LA 3VOTA 3V7WA 1H1LA 4FYMA 1H6CA 1W49A 4OHWA 1AZTA 3HJRA 1P9OA 2CXQA 5H3LA 3SJ7A 1KRHA 2G4LA 3IOMA 1B6RA 1ZN2A 2Q2WA 5B6JA 2B8JA 2YOGA 6YASA 1TM1E 1SWWA 2GZRA 4RJ2A 3QG1A 5DYWA 3ONDA 5IARA 2AHOA 4IMRA 4KOEC 3RU9A 4ZHWA 2AUTA 4G5GA 2NV6A 1IH8A 1UXIA 1ZL0A 2ZT5A 1AB5A 1TEZA 4JBIA 1BXRB 2NXJA 3H3JA 2ZSFA 1AKYA 5TE9A 4H9GA 3HB4X 3OTHA 3E9ZA 4NULA 4JBGA 4FZ5A 4G8BA 3WGKA 4RVUA 4KN5A 2IKSA 3RK0A 1G5PA 1RLUA 2QRGA 3TEMA 3UGQA 4UHDA 1IV4A 4FCTA 5A5FA 4GM1A 4RHEA 3E1YA 1NU8A 1U0FA 4BNMA 4H1VA 3SQNA 1G1MA 4BGUA 3L49A 1UCFA 2YFYA 1XJCA 2VVTA 3LNCA 2O2GA 2OHIA 4D8UA 4NESA 1VQ7F 1NUAA 2MINA 2VDJA 3QU2A 1XTZA 2UYKA 1Y33E 4GYYA 4M86A 5LA6B 3OURA 4X1OA 5JOQA 4YGYA 2NSLA 1KBQA 4IWNA 3GUUA 1LK0A 4R0MA 3M7IA 2Q4DA 2YHSA 4Y0AA 3JQQA 3OX3A 2HBRA 4MGYR 5AQEA 2V5UA 3IMKA 4CCYA 4FP9A 2IEBA 4XLLA 3DTTA 3RSLA 3UY4A 2QV7A 2XDQA 3V4RA 4GZ6A 2SCUB 2IP4A 3LQ4A 4QOSA 3SWWA 1NIPA 4NYJQ 3GEIA 2W8ZA 1QP0A 1J6UA 1L5YA 3KCQA 3GVIA 1Y1PA 2FOLA 2L17A 5DGTA 3UCEA 5K6TA 4FHEA 2CHEA 1YGPA 2XGSA 1G20A 1N2XA 2VYVD 5BSGA 1EP1B 3BULA 5DNDA 4D9GA 1FE8A 2ZI6A 3EWNA 2ZJ5A 4EHFA 4EZEA 2ZRKA 3F6PA 1XCGB 3R3YA 2NQ8A 1X70A 3RSOA 3WGQA 5KC9A 4DA9A 1IBCA 3W6UA 1ZAKA 2YUIA 1E66A 1D0SA 2IYLD 3OTQA 3DMTC 1F9AA 2FTKE 5IFLA 3GDOA 1ZWZA 1UIMA 2YJTD 4FHCA 4QYSA 2JG3A 4LWOA 1FTYA 3CUTA 3QQ5A 1EUDA 2GZAA 5D7NA 2X4GA 3ZS8A 3DF9A 3FKSD 1E6UA 1F0PA 3A0RB 3OLYA 2IUEA 3P27A 4XGKA 5EUMA 3H17A 1ZHFA 1OX4A 3CEPB 2X4IA 2JLAA 1QWSA 1Y8QA 4TTRA 1K27A 1GUZA 5DGCA 5HY4A 3GELA 3LUJA 1H0SA 4TVBA 1MC4A 3O4RA 2DKOA 3FMIA 4HAOA 2X4LA 5AKEA 4ZOEA 3U3RA 4C4PA 4CRWB 3JYPA 2G1JA 4NEHB 4F9TA 2O52A 1E0SA 3RS2A 5B2FA 1ADBA 2FMKA 1XZEA 5J47A 2QW0X 4U2KA 4ZHQA 1H2FA 3NVDA 3TZKA 3QW2A 4O3MA 1T0IA 4E3WA 1VYHA 4L9RA 5EZ6B 3QVXA 3BE6A 3CH4B 2WZQA 4GYKA 2DKNA 2QL5A 1J1UA 3I37X 5EIXA 1NP7A 1WKVA 1WSBA 3GEDA 1OT3A 3G9TA 3UWPA 2NVOA 4UE3S 2N48A 1OAKA 3SHOA 4HVCA 2O06A 1EU1A 4REMA 1FJGB 2JHGA 2P90A 2QTHA 8ATCA 4YY3B 1XZDA 1R50A 2BELA 1YOBA 4MW1A 4WZAA 1PL8A 3GAAA 4PC6A 1DHRA 3R3SA 4WIAA 4IGKA 5AO9A 3CS3A 3CW9A 3PEFA 2IK8A 1OIWA 1CY0A 2GN1A 3L7KA 3O1HB 4MKRA 4S1NA 2KMLA 1C1YA 2PSSA 1XTQA 4NZMA 4BBPA 4HDKA 2IYFA 1SVWA 1D8AA 1CNFA 1GPAA 2ZU6A 4TM7A 1NQTA 3QEOA 1XQ1A 2OD9A 4M1ZA 2CMGA 1SA0A 1UK8A 1G20E 1ZD5A 4QO8A 1NXPA 1U8CB 4EHIA 4GX5A 3O8NA 4LDAA 4DV4B 2CNBA 4PQEA 4EGCB 3UENA 1Q22A 5ICEA 2JL1A 4NAUA 4KDCA 4LJYA 2VZ8A 4KHZA 4RVSA 4Q9KA 4CF4A 2D2XA 3B1XA 3B78A 3LCVB 4NZNA 1FFCA 3GJ8A 4YO8A 5JVDF 2EGGA 5BT8A 4R1MA 6ADHA 1JG6A 2P27A 4GOKA 3MUNA 4II7A 4MUBA 4X7MA 4TKUB 4Z0PA 4CKZA 1KU6A 5EC8A 4K81B 1YMQA 1Z29A 4Z53A 4KAFA 4YJ3A 1KBZA 2HAEA 4LK2A 3ZHRA 4IDGA 1IB0A 3FYSA 3GAMA 2A33A 3AT1A 1EK5A 1TM3E 2LBWA 1RABA 5KYXA 2XUOA 1PJQA 1XALA 4ODIA 1YZLA 3OE5A 4P4SA 2RHLA 1PDVA 4NS4A 2JC3A 1UZNA 5FEMA 3AUKA 1PQPA 1ORVA 1QRDA 2AI2A 3INGA 1QH8A 3R6TA 1QIKA 1XJQA 1CK2A 1XC7A 5DT2A 3VNBA 4B87A 5JRZA 1COMA 3H9UA 3SAJA 1XYYA 4LY3A 2P3SA 1E3SA 3T35A 4EHLA 2EJVA 3ZYZA 3K9CA 4ZU6X 1Y9EA 3ZPXA 1ZGHA 3OQMA 3ND7A 3T5BA 3ZXYA 2ZVQX 1DO8A 4YRCA 1JDVA 1ZJWA 3KIZA 1UR5A 3I6MA 1KEEB 1G2QA 2IGBA 3I83A 1NVEA 1TJ4A 2Z9DA 2PWPA 5JD6A 4DXAA 2R44A 1F17A 3IEKA 4WJLA 5BN1A 4PO8A 3OA2A 3RU3A 5L7WA 1TZMA 2AJDA 2C9YA 3B1JA 2J3IA 1MEJA 3THOA 2EOAA 1QG4A 2QN7A 4XCVA 4AJEA 4ENQA 4TMWA 1WMSA 5AM5A 4UOEA 4YAEA 2Y9PB 1G8JA 2PK3A 2Z5FA 1OE0A 2I7TA 1NUUA 3SJUA 4CEIB 2I4MA 2MSWA 2QQ0A 3D6TB 1VHJA 4WZAE 3KZNA 4HUTA 1Y1KE 3L06A 4FYIA 4D4MA 3A04A 5ULLA 1UBHS 221PA 1PNRA 1XZLA 1P2VA 1YFJA 3CEJA 3EMKA 1OXTA 1QK4A 2QGZA 2WJYA 2GN4A 1SCNE 2MJLA 3WRYA 5LB4A 4M3NA 5HDBB 4B3GA 5HUQA 3KQKA 2IAFA 2AA3A 4Q9IA 1M7HA 2ZE7A 3AUTA 1O9BA 4RPJA 4U7HA 4CXMA 5TS3A 3LWZA 2GKGA 1ZR4A 5IVHA 1E2UA 2W70A 2C4NA 3EPLA 5CB4A 2K2WA 2JB9A 2VYCA 1VXRA 4L15A 5MN5A 4TQ9A 5EWLB 2F17A 5DSXA 3ZHXA 1GT91 1DCMA 3DEJA 3Q11A 1RE1A 3M33A 1D4OA 1VGRA 1QMPA 1LNZA 2PVPA 3OI7A 1GA6A 1JVNA 3CZQA 4CR6A 2GTIA 5G3YA 3ZUPA 2Z4SA 2Y1EA 3Q2OA 2X0DA 1R12A 1ZM4A 2YJ3A 3CUUA 5ABPA 1CZRA 1PUIA 3LSYA 3EVAA 1B0PA 4JL8A 4M49A 1TAQA 4GPIB 4OTZA 3VZDA 1M2OA 4ZQCB 1Z6PA 1V1MA 1GNTA 3RRMA 3KETA 4MOWA 5CVVA 2YKGA 3BQNB 5I9LA 3WNQA 3DL0A 3W5DA 1Z0JA 1I4WA 4LMPA 4CIBA 4KO2S 5MN4A 1YQTA 1HNZB 1GR0A 4C30A 3WHPA 1Z6YA 1Z3IX 3EH2A 3LCMA 1VE3A 4LXIA 5FPTA 3HV0A 3OD5A 1SKMA 2R8BA 4BGEA 4ABTA 5DIFA 4Q3LA 5JZBA 2XWQA 4X3MA 2E48A 4P2BA 5G41A 4ATNA 5AVWA 2ACVA 3BGWA 3C6YA 1H93A 3IBSA 4ZWNA 3T3MB 4ES6A 2FSVA 3O93A 4Y6GB 4D3XA 4MRPA 2PSHA 3PAFA 2G5TA 2EX1A 2Q0QA 1X74A 5IN4A 4YCMA 2FCRA 4B7AA 2H1CA 2CB9A 3G7UA 2II6A 4N5LA 4ARVA 5IF9A 2NZ2A 3V34A 3BRCA 3L92A 4NCXA 5CFRA 2IG8A 4RIIA 4UD6A 4FJ1A 4KRXA 5HIKA 5JAMA 1OLUA 3ILYA 4NE7A 4QM7A 2A84A 4TMXA 3SM9A 3KXDA 2Y1LA 1ECLA 2ZIXB 2IZ6A 4JLAA 2Q4TA 2O05A 4Z1OA 4C2BA 1Z4KA 4R7ZA 3CNOA 3BG5A 3EW9A 4YALA 3TLBA 2HO4A 4GW3A 1ZM3A 4KTTE 3I1JA 1EFAA 4E03A 2C3UA 4RQTA 2YWCA 3FHCB 3ERNA 3WVNA 3MGGA 4DF3A 2EKPA 4AMZA 2PO5A 2X8JB 3PB3A 3HEAA 4C06A 3AL3A 4AF7A 1Z33A 3UK0A 2EARA 5DTJA 1T0BA 4D8TA 3SC2B 2Z1FA 1K8YB 4N8DA 4ZHQF 4J43A 2FEOA 2EG9A 3D8RA 2QRVB 4IO1A 2VYFA 5LQCA 2QMYA 3ZWNA 1KEWA 3KQHA 3M6FA 4EARA 1IDN1 4BWYA 3SZLA 2OGSA 1VL1A 4QAQA 3ZV5A 3KYIB 2ZRBA 4EITA 1FTQA 2JFUA 1GV1A 4GICA 4OOFA 3N2KB 4N6GA 1OU4A 3IKLA 3IYLW 3RFUA 1QLWA 1SOVA 1ZOOA 3HY4A 4F3RA 2N47A 4ZYXA 2V03A 3NRJA 4MO9A 3ZV4A 4B17A 1JHPA 1SU4A 4IQ8A 4H4EA 4EMUA 2EYUA 1YQNA 3T6KA 2VP9A 4IDHA 4DDMA 4Z4FA 4OPMA 5FLYA 3DM5A 4R9SA 4CM8A 3KXPA 2FPWA 3HI4A 1IV3A 3TDNA 4BQSA 5JD4A 1UBKS 2FMUA 5JJIA 4E5DA 1LK7A 2XMCA 4QVGA 3ZJYA 5EEHA 4FX5A 1T5TA 2BFCB 1RM5A 2IXGA 5FA5A 1EVLA 3VPXA 1KR2A 5FPHA 1ISFA 1J0XO 2FMXA 1ZI6A 5D86A 1MRNA 3RW9A 1C41A 1BH2A 3ETEA 1LW7A 3E0XA 4Q3EA 1QOQB 3ADPA 2ROQA 1ADJA 4GC5A 4Y2RA 5LU9A 2OZKA 3GX1A 5K03A 1G3RA 2JBAA 2D7CA 1RQGA 2QMQA 3P9KA 5FD8A 5FIUA 5BXQC 2J4DA 1K92A 3IHKA 4I5IA 1KI1A 2Q1YA 5FLXA 2Q5QA 4B46A 2H1RA 5C5DA 2HQ1A 4N0QA 4LY0A 1UANA 3L0OA 1EX1A 1MC8A 3TPFA 4XVCA 2ZCUA 4YJ3F 4H3SA 2XMDA 5JSFA 2Q9BA 3MS2A 3MIIA 3IEQA 3K20A 4IGIA 5ALLA 4DCMA 4LN1A 5JZ9A 1QFZA 3ND8A 3R09A 4PPYA 4RIGA 1RCTE 3HVUA 3PV0A 4YJHA 2Z6AA 3D0KA 3WIUA 3FTEA 4JB3A 4WJZA 1M6WA 3NH6A 2HH9A 1H9AA 2YIMA 4DCOA 5TR9A 2GZSA 3RTDA 2QQ5A 3HNPA 1C3LA 3NG1A 1ZC3A 1MABB 2H1WA 16PKA 4C7OA 5JNVA 5KQLA 1JJVA 1YC2A 3JD4A 3MJDA 4S2UA 4UHJA 3JQAA 4Z6KA 2G9RA 3M6WA 2A58A 1X13A 1KMQA 1VMAA 3SOZA 5LMZA 4QVIA 2O8BB 1AU9A 1E5DA 3E58A 3OZEA 3MOSA 5EPEA 3ZVLA 2UYYA 3K32A 4AROA 1E1LA 5FWNA 2E1RA 1IOWA 3VUFA 1J00A 4YJ2A 3T4UA 3FWHA 3H0EA 1PYOA 2X8LA 1XQXA 2VHZA 3OZIA 4I0WB 4N7JA 4JEMA 4RS3A 4JUCA 3BRWA 3SBEA 4V0MA 3IQIX 2OVBA 2RH5A 3BJRA 4F7WA 1J5EB 4MTCA 1VJTA 3KKKA 1AHIA 2AF4C 4V0LA 1W96A 3RH0A 4D97A 1JXAA 3VPDA 4HDSA 3FOZA 3DULA 1JBQA 5HBGA 4EFNA 4BUCA 3QSYA 2BMWA 1Z4LA 1Z37A 4CR7A 2VGNA 1VQPF 1WAMA 2VWQA 1RQ7A 1OI4A 3WLSA 1VCHA 1FRZA 2YXLA 4WJKB 4KOAA 3D5TA 1GKIA 3C7AA 4BZXA 1UINA 4RQAA 1UXOA 2FSHA 1EVJA 2NZWA 3ECAA 1GSIA 5SYNA 4XD7D 4EYOA 5CB4F 2QTWB 4L72A 1WX1A 5M2QA 3BWYA 2R2GA 2AZ4A 3VGJA 6REQA 4ZI7B 1PZNA 2AZMA 4KODA 1U65A 4DJAA 4NKRA 2YWXA 1AHPA 1EGMB 4WZ6A 3CLUC 1GPWB 2J5XA 4ZZ0A 1YB2A 2A4KA 4LGMA 1RU3A 2W2LD 1NJSA 3TRJA 2BKLA 1E5LA 1U3VA 1IIBA 3B53X 4PGFA 1QH9A 2PS9A 4RZXA 5DX8A 5KNDH 5LYYA 3UB4A 1JU4A 2IUTA 5L45A 1BWRA 1GAQA 2N1MA 5DM0A 1P7CA 1BX3A 4IJ5A 2D5AA 2O0LA 4ZEWA 4CR8A 4CL0A 4O4HB 5D5HA 1CJKC 3FD6A 3TXAA 3W7BA 4MKXA 1HX7A 2AG1A 1B1CA 1Z0ZA 4R2MA 1L4MA 4CU2A 4DCCA 4D9BA 1L1FA 1J1ZA 1G0OA 4FOSA 2MDTA 4DDHA 4LF4B 1FJXA 2WABA 4MV7A 3BB1A 3UQYS 2JIRA 4HRAA 4MLZA 3TRHA 1CIVA 3UFXA 2ZYGA 2ID8A 5I7OA 3DBRB 5C7YA 4EA7A 4LPSA 3U17A 4LOLA 2OBLA 4FGLA 2Z58A 1E2DA 2YHBA 3M8KA 3CC8A 3MEQA 1RC0A 2I22A 2AOVA 2HF7A 3BZUA 4KYTA 4KQHA 3UMSA 4CF7A 3C3DA 3OU7A 2DPGA 4GX2A 4MARA 4L9WA 1IOVA 5ADVA 2HOQA 2FVXA 3AX6A 1F7UA 3ROTA 4BO6A 3TBKA 3GLIE 5FULA 4BOYA 1YO6A 2MSEB 2P8SA 4BATA 4W5QA 3RBXA 3GARA 3ND5A 3ZU6A 2QRMA 3UJPA 4F4CA 3JVIA 4LQ4A 3VPGA 3HWX1 4G4SO 2QJFA 1YQDA 3WQHA 2WV7A 5HP4A 3OQ6A 4TQUS 1NLYA 2AVDA 4FILA 3KHUA 1C0PA 4WV3A 1ZMOA 2WJJA 1MQ9A 4BJ3A 5CIWA 2O07A 2X22A 3FSJX 4DQLA 2AKEA 3KQTA 1OFGA 3NP7A 4IHJA 4PZZA 3ZS9A 4DMHA 4ESHA 4J91A 2F48A 2OHJA 3GEMA 3AO0B 4PTYA 3IVAA 4OYRA 3W6PA 1F5NA 3NDIA 1HFKA 2ZRCA 1I4LD 3I73A 3IGFA 2VRNA 2A35A 3C5HA 4PAWA 3MLBA 4QTTB 3HYNA 3M1LA 3W5IA 2VGMA 3KSAC 1KL7A 1DKQA 3GG9A 3K71B 3TLGA 3CCSF 4RZUA 4DL9A 1CW2B 2BRUA 1XVLA 2WA2A 1E1KA 1RYBA 3L4BA 2M2IA 5ITWA 2FZWA 4FNMA 2PKXA 3CQ9A 3WYCA 4EAAA 4Y2VA 3AV0B 1E6KA 5HFJA 4B6EA 4M7WA 4PAMA 2X2PA 2Z30A 3B3AA 4Q00A 3UKJA 4B5CA 3CB4A 5I7VA 2ATCA 3E5RA 4JBNA 3L02A 4DNPA 2AMJA 4TROA 3FDZA 5EE5B 5CCDA 5LUAA 3QE9Y 5IC5A 4TV9B 1IUKA 1V3TA 1FDSA 3NBQA 4O25A 5IAOA 1A9SA 4WTOA 3OD1A 4NFHA 1UBNA 3UWKA 1D0VA 2IXDA 5BV2P 1JSXA 3T1NA 2W2KB 4RXMA 3T3DA 3F6CA 4JCCA 5B2ZA 4ZCRA 1JI3A 3RA6A 4WGFA 1TFUA 3IEUA 4WESB 2RI0A 2V45A 2WHEA 2Z1MA 3IPLA 1LRLA 5AH0A 4HWSA 4NYJR 2LUOA 3KWJA 4INPA 3F90A 3C9SA 5YASA 4M53A 1V9SA 4PZ0A 2JBHA 2R8EA 1U2GA 3MWEA 4OIMA 4ZMSA 1R1DA 1YQWA 3O2SB 1NATA 1CE8A 1DFIA 3FDFA 4UHEA 3ZE8A 1WM1A 1J22A 1RS0A 4MH0R 3UO8B 3A6LA 2PH7A 2R6DA 3G0BA 2XJ9A 4A2WA 2A1TR 5EQFA 1UK9A 5AUOB 5IZCA 1Y3FE 3H99A 3C7TA 4O63O 3TSAA 3IHTA 1RWXA 3EDOA 4NBKA 4N54A 5LQSA 4CTKA 2C2KA 2WFZA 1IXKA 4JXJA 5FOXA 1ORDA 3LBIA 4L5YA 2IOYA 4E1BA 3LLMA 3ZJUA 4KUGA 3ZWAA 1EVIA 1EX7A 1J56A 2F9ZC 3KJKA 1L5HB 4ASUD 1DAPA 3R5FA 2HZBA 1QHYA 5IBPA 1OIVA 1M10A 1N5IA 3F4BA 2Q3DA 4LVOA 3FY4A 5FV7A 5M5BA 4MIEA 4LRYA 4EG4A 2V54A 2PKEA 3BGSA 3BIOA 3CUSA 3EF1A 3GJ3A 3P97A 1XNRB 1T6YA 1KC8H 2XUJA 3PXBA 4UZSA 4E51A 4DWVA 3TOZA 2Y3IA 1A69A 2FEWB 2HIGA 5IHXA 2FEXA 1H0HA 3C0KA 3RHFA 4E5MA 4M0UA 3QUCA 1ESZA 3GLFA 3ZI4A 3A6EA 4P7JA 4YJ2F 3LUHA 3NR2A 4NV1A 3GFGA 3R0QA 4FEGA 4HTFA 2D5LA 4PNHA 5CX1B 3C6BA 3ZV3A 3AR3A 1YTUA 4OLJA 4ZGBA 1KU0A 3C9UA 2CJXA 1O8BA 3DO6A 1QU3A 1BKSB 2RGGA 3GCWA 4FR0A 4FMCB 4LOAA 3RV4A 4JJFA 2HIHA 1P5FA 3DMPA 4WAUA 5AKJA 4X6LA 4E09A 2O8NA 4CHTA 2V65A 2J6BA 2WHRA 3SIUA 1CEEA 1JU3A 1A50B 1XXHB 4UTNA 3ONVA 3PITA 1KQ3A 5C32A 2BF7A 5FPSA 1D2HA 3L8HA 3MMZA 3EUWA 3W90A 1XEWX 4B3BA 2XZLA 3NNSA 2YTZA 2V1UA 1ONBA 4AKGA 1NXTA 1EGHA 3A05A 2JIMA 3F3SA 5KJFA 1SQ6A 3ZW7A 3SF8B 4ZRDA 1ACJA 1KE2A 3D43A 1I2BA 3EVDA 4GIBA 3GG2A 1VKZA 3FNRA 5EOVA 3OKPA 3CHYA 3PUWA 2NW6A 3IAFA 1TYZA 1SKYB 2NOAA 2YCLA 4LDPA 3QHDA 3HBNA 3B60A 3HP7A 1VQ5F 1X86B 4CZ2A 4CM4A 4YH1A 5KNBH 3KDAA 3OZRA 4G24A 3G8CA 4JT2A 5I5GA 4BC0A 5JSYA 3OBYA 2JH3A 2XB9A 1L7BA 1OJ7A 5FUVA 3B3GA 4MR9B 1NP6A 1V4VA 5FWXA 3F7MA 3V00A 3IH5A 3DR5A 3V3TA 5DLQC 4O2AA 1NW5A 1U8XX 2P2NA 2QBYA 4QQKA 1Q0SA 3BTUA 2FUNB 3HWRA 3KB6A 4WNCA 1L5QA 2IXFA 4QGBA 1ZK0A 4YMLA 1NY5A 4FQ8A 3NBXX 4IGEA 3VI3B 3DMRA 2B4AA 2OEPA 2GUGA 3HCPA 3IALA 1SXJB 4CLRA 2BP7B 5JXGA 5FBHA 5D87A 2ZQYA 5FR1A 2I6RA 3C8UA 3NX4A 1U2QA 1ILWA 1T2NA 5F3DA 3ORRA 3MVEA 5K6RA 2WVGA 1J8YF 1RPTA 2DTEA 2Q5OA 4OYLA 3MAJA 3GFPA 4D45A 4PG8A 1QE3A 3VR4D 2RGEA 3C9RA 3LQFA 4BX2A 2ZEJA 3K9WA 3PICA 1G0NA 5JMOA 1BFUA 4ZDKA 1BDIA 3AFOA 2UXDB 2YXEA 4X45A 2HREA 4GI5A 2WDPA 1KMHA 1PS8A 5JPDA 4P82A 5K0GA 1UZMA 2ZJAA 3U31A 3RRFA 5LOVA 3GJ6A 1GCIA 1JMKC 1Z25A 5EMMA 1MTZA 5FWAA 1ETHA 1JXMA 1P2FA 3T06B 1OI3A 2P5UA 4G3XA 3FZQA 4CCSA 1ONSA 1UKEA 4OXRA 5FJ4C 4YIHA 3ZP7A 3OC0A 4IHJF 4YAOA 3WLMA 1UPUA 3JQ7A 3SG0A 2FN3A 1Z35A 4QSHA 5HKLA 3LH5A 1QPBA 2V7TA 3QWFA 5JAQA 4YRKA 2UVDA 1TMGE 1AMUA 2E4UA 5DRTA 3DKRA 4ZO6A 1BJRE 3TGLA 5EYPA 1YRYE 1O54A 5E3IA 4JVMA 4X93A 4XM2A 2FMHA 1ZNQO 1Z3CA 1XRPA 3M6LA 5G1PA 2DTXA 3H1EA 4CL3A 5JZVA 3H9GA 2QLBA 3N2GB 4DG5A 4RJLA 3IR7A 1DKNA 2PDAA 1RSZA 1E6WA 4QWWA 2RG1A 4BLPA 1GO0A 3GGOA 1R8JA 2JGFA 3GQBA 2B7LA 5DHTA 2UUOA 2O2DA 3IQXA 4N01A 5I4CA 2MTBA 4ACAA 1IG3A 1J8VA 4JLBA 3P4YA 2ZYVX 1OC2A 4JKYA 1VRCA 3MC1A 5LSAA 1BZYA 4BFLA 3VHXA 3L1VA 2BGIA 2R751 1L7MA 5FOVA 3T4PA 4YPVA 3ZE7A 4ERXA 1QLJA 1SQGA 3HFGA 2VQFB 3KXKA 1H7MA 5U9CA 3GNTA 1GDTA 3L1IA 3C43A 3ZZMA 3GLQA 1HLDA 4JD5A 2QR3A 2AJBA 3RS0A 4HKTA 5CLFA 3THWB 4WKNA 1NN1A 3SX4A 1S2MA 4B3HA 1BU5A 2Z04A 3QXCA 1XU7A 3VKFA 2HSEA 1DQYA 3IT0A 1KY3A 4WCFC 3C5CA 3ZJ5A 5K0ZA 3NTRA 3WWDA 5E3HA 1G9SA 4CG0A 4IH9A 3BWVA 5AI8A 2H7CA 1SXGA 1TKBA 4EGAA 1VI2A 3O8QA 1AK2A 1FS5A 2H2IA 2R6HA 3AF4A 1VFPA 3OPYB 3FTFA 2O8EB 1G1AA 1LXCA 1X9IA 3QXJA 4EYGA 1R88A 1AURA 3Q87B 4URWR 2QMEA 4ETIA 3BMXA 3OQPA 4Q3OA 4YMTA 1R6UA 2VRBA 5K2MA 2E9SA 3G2KA 3RVRA 4BN5A 2IS2A 1UPXA 3A25A 3BTVA 5BUQA 1CB7A 3PFKA 5C1IA 1HSOA 3O74A 4G56A 4FE4A 3WV5A 4MV0A 5K99A 1W1IA 3A06A 1UBGA 5EFZA 4EPVA 5TJ9A 4GS5A 1UWLA 1N2BA 4NXNB 1TDJA 1N4AA 1N9GB 1SIBE 2H6EA 4A15A 4MQLA 5IF3A 1E6EA 1E60A 1NVTA 1WDLA 1Y7TA 1T9GR 2FKAA 2OAP1 3JQCA 3TINA 3VZSA 4BB0A 4TT3D 5IT0A 1ZM2A 1LBQA 2DPXA 4NBRA 5DBGA 1T2DA 3L46A 3G5AA 1M1NA 5K4GA 1XLVA 2P5SA 1SIWA 2X0NA 4HDQB 3SHWA 4DWOA 1DX9A 4Q66C 3GRUA 3AP1A 4JLOA 2M6KA 5LD2C 3TD5A 4PPNA 4A0FA 1GQ2A 1W5AA 1ZD9A 1Z6TA 2SICE 3SS8A 5JROA 2ZIGA 3AM5A 4KC0A 2JCSA 3H8JA 3MGAA 2ZXUA 2HVYD 2PQ0A 1PJ8A 3IIJA 3GFFA 5H4GA 4EGSA 1ZESA 2WAOA 4IDEA 1XPJA 2HS3A 1DQNA 3ELUA 2EP7A 1ISMA 2YRXA 5IAKA 1DQRA 1EKXA 2GAOA 5ALRA 4RA9B 4BQIA 1KWKA 4CV3A 5B3KA 1Z8FA 4IKOA 3UV3A 1HRDA 2O1WA 2ZUCA 3X1XA 3PVSA 4GXNA 1Z17A 1S96A 2R1UA 4PWZA 3T5CA 4LFCB 1QANA 3QW4B 1DAFA 2AIZP 5DI3B 1ZDMA 1I14A 4MUGA 5JXHA 1N6HA 5KQGA 2FMIA 3SSAA 4E5UA 5ICGA 1CZNA 2O3SA