3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
4O4JA 5JH7A 4I4TB 5CA1B 3ZBQA 4B45A 5J2UA 4EI9A 2GVIA 4O4HA 4YJ2A 5IYZA 3HKBB 3HKDA 5EIBC 3WGMA 5CA0A 4EI7A 2VAPA 4X1YA 1FSZA 2RHLA 4I50A 4X1IB 5FNVA 4DXDA 4ZI7A 4FFBB 4U39A 5C8YA 3JASB 4DRXB 5MN4A 1W5EA 3HKEA 4F6RA 2RHHA 3RYIA 5BMVA 5MN5A 5JVDA 1SA0B 4FFBA 4TUYA 3N2KA 4O4IB 3WGNA 3N2GB 4ZI7B 5EZYB 1Z5VA 4ZHQA 3VOAA 3R4VA 1TVKA 5LA6B 3JAKA 4IHJB 3UT5A 5M7EA 3HKBA 1RQ7A 4XCQA 1FFXA 2RHJA 1W5BA 3E22A 3V3TA 5ITZA 5IJ9B 3RYCB 3HKCA 5LA6A 1TVKB 5JH7B 4WBNB 2XKBA 4O4JB 4EI8A 4O4HB 4ZHQB 5MN6A 2BTQB 4KWEA 4LNUA 3N2KB 1SA0A 3JALB 4TUYB 5JCOA 5LXTA 3VO9A 1W5FA 3RYHB 5J2TB 4TV8A 3HKEB 4F6RB 4IIJB 3CB2A 3JASA 3JATB 4X20A 4HNAB 5LOVA 5LP6C 4LNUB 2BTQA 4ZOLB 1W59A 4X1YB 4I55A 4B46A 5LP6A 5CA0B 3C8LA 5KMGA 1JFFB 5IJ9A 1FFXB 3UT5B 5J2UB 5CA1A 5LP6B 2XKAA 4YJ3B 4E6EA 3JARB 5EZYA 2RHOA 3VPAA 1W5AA 2VAMA 4HNAA 4O4LA 3WGLA 4IIJA 5BMVB 5EYPA 4EB6A 4TV8B 2R6R1 3RYHA 5CB4A 5LXTB 5C8YB 3JALA 5LYJA 1RLUA 4X1KA 4TV9B 3ZIDA 2VAWA 4WBNA 3WGKA 3RB8A 2R751 2VXYA 5CB4B 5JCOC 3HKCB 3HKDB 5KX5A 4M8IA 4O2AA 2Q1XA 5ITZB 4O2BA 3E22B 4YJ2B 4O4LB 3RYCA 3RYFB 1TUBB 3JAKB 4IHJA 4U3JB 2BTOA 5IJ0B 1OFUA 3JARA 4YJ3A 4U3JA 5IJ0A 5GONB 3N2GA 3JAWB 4O4IA 1TUBA 3RYFA 5JVDB 2Q1YA 3M8KA 4O2BB 4O2AB 1JFFA 3RYIB 5KX5B 5KMGB 4DRXA 5JQGB 1Z5WA 4I55B 4I50B 4X1IA 4ZOLA 5FNVB 4TV9A 3VOBA 3M89A 4X1KB 5LYJB 5JQGA 3JATA 4X20B 5LOVB 3WGJA 5J2TA 5EYPB 4EB6B 5IYZB 3ZBPA 5EIBD 3JAWA 5GONA 1W581 1RQ2A 3VO8A 4I4TA
chains in the Genus database with same CATH superfamily
3NRJA 1U9ZA 2WTEA 4IGAA 1H3EA 4LWQA 1X94A 4IXNA 5CA1B 4WKOA 4GECA 1CVLA 2OVFA 2OV1A 3UC9A 1B00A 3ABSB 3GT7A 1T5IA 3IXLA 1L4FA 1GO0A 1GTL1 2W2VA 3GLHA 4Q12A 4XUDA 3HCPA 3VKFA 4X7BA 1Q0PA 1PS9A 2LCAA 1M5UA 2JJYA 3QELB 2VH5R 1V41E 2P9EA 3CSDA 5IFLA 1KEEA 3LWZA 3TZCA 1GFZA 4Y9SA 2BGWA 1GZ6A 1NPDA 1WU7A 1D5CA 2J7PA 4G81A 3A3YA 5IH3A 5JDCC 4KREA 5EAIA 4DWOA 3LMEA 3TZLA 1PJRA 1ELOA 3CE9A 3QWFA 2PX8A 5G1PA 4YR9A 1A9RA 3H83A 1I7PA 2HTFA 4RM2A 3B3FA 2G9UA 3NVKE 1CUBA 3HEMA 3M5DA 2Z8YM 5K8VA 4HNUA 1F7UA 3S0WA 1Y5LA 3DV9A 3LMKA 4QXPA 4B5LA 1W2HA 1XAJA 1Z4PX 3GAAA 1LEHA 1EFUA 5GV8A 5LMCA 1UIRA 3SFZA 3UXEA 3WK8A 1H7MA 4O4IF 4CNQA 3ZCRA 3U6KA 3O84A 3VNRA 1CZKA 5HHTA 2QAGC 4ZRDA 1XDUA 3KHKA 3QEMA 2CNNA 3ZZ1A 5CT5A 3G0HA 3QHDA 3H99A 4BWFB 4B6FA 4M8SA 1MIHA 4P3YA 5CITA 2BZ0A 2OV6A 3NJRA 2OZEA 4EJSB 5BY2A 3Q8WA 3RFVA 5CDHA 2PD6A 5FYDA 1Y6GA 2IYLD 3CIFA 5EKXA 3QXJA 2JFVA 2HBQA 3SHVA 4F6CA 2XNDA 3TECE 5E3HA 2WTNA 4X85A 4XOUA 4RFLA 5A71A 3TNFA 2H4XA 1JIIA 1YIDA 1Z4KA 2AK3A 2M1ZA 3KOMA 1XLVA 4BAZA 4RJKA 4POOA 5AI0A 5KTPA 1VHJA 4E46A 2IS1A 4A91A 5BUZA 3AEKB 1DDOA 2ECQA 1XZ8A 3WDKA 3IKTA 4AG5A 1ABFA 1BH2A 3RVNA 1FUKA 1BS9A 1GA4A 3LXXA 3TSCA 2IXAA 4TXLA 3FMFA 2VTBA 2QP9X 5DKFA 5JXJA 3PTLA 3JX9A 1F0KA 3ADBA 1L6IA 4TGLA 1SDSA 4N5MA 2FPWA 4DUPA 2RCYA 1K08A 5GV7A 3FTPA 4NYIR 4MTCA 4Z86A 1QUFA 4PPNA 4HHEA 3OEYA 2EJVA 3ZIDA 4IH9A 1QYDA 4WBNA 2IT1A 1Z4JA 2Q4BA 2JB9A 3EB9A 1PYGA 4WKBA 4KVAA 4UARA 4O2AA 4GI7A 3H5RA 1DBPA 1JE1A 2G08A 2JFOA 3ZCTA 4BCBA 1JIUA 1KYVA 2PO7A 5E4JA 2XMCA 1BX0A 2G67A 4EY7A 5EA2A 2Y8EA 5EN4A 3QOXA 1KO4A 1VC2A 2D7CA 5TT0A 1OAOA 4NPCA 4DQLA 1TQ8A 2OL4A 2P90A 1IQ0A 3H5TA 1JPUA 3I01A 1P2SA 3QM1A 4GLFA 4ITVA 4TROA 1SBNE 4YV1A 5K1ZA 2Z08A 5FOWA 1NU6A 5SZKB 1I36A 4DLKA 2KM1A 3T15A 5AVSA 1QZXA 2DBQA 4UU7A 3BHMA 2I4TA 2XB8A 4MQEB 1V5GA 3LUHA 5K0GA 1PZHA 3M4SA 1EDDA 5CFMA 5I7EA 2VUTA 1E1LA 5EIBD 2IP1A 2Z1NA 3L02A 4K9QA 4QYTA 3ABZA 1PK9A 4HJXA 3WK4A 3AUFA 3CMCO 4YASA 4KO8A 1PE0A 1A8IA 3TBHA 1QFMA 2P75A 3K8OE 1JDJA 2BEUA 4G8DA 3S8MA 3C98A 4EY8A 1GL6A 2BELA 3IP9A 4X7PA 4D3XA 4CNBA 3H5AA 1LTKA 4DZTA 4JXKA 3K9HA 4JB0A 2BUAA 4X9XA 1POXA 3WI7A 4AY4A 3AILA 3EMVA 3THWB 1I1NA 2EKPA 3DQQA 3Q5GA 4D9FA 4Q66C 1XQ6A 1XHLA 1QV6A 2DKNA 2FSSA 3S55A 3ZUGA 3GA5A 4KR0A 4O4JF 2GN6A 5HOQA 4LF8B 1XL0A 1QIGA 4NBVA 4GIBA 2VP6A 2ZSHA 1X7OA 2CNWD 2LRHA 1QAQA 4N0MA 3A1CA 4I36A 1X3SA 3RWMB 5JQGF 1O8CA 1P4AA 1I9GA 1HY3A 4LF4B 5ELXA 3IEQA 1SHJA 1UOQA 5AXBA 1JSLA 3JAKA 2WSSA 4F12A 4OATA 2QW8A 1ZIPA 3QBJA 1Y5RA 3OPNA 5HMMA 4WDQA 4HGPA 2FLVA 2QTNA 3W3ZB 3WXBA 3SEFA 1RSZA 5AVMA 2G3YA 4RJTA 5JI2E 1W73A 3HYNA 5JH7B 1VM6A 3GRFA 1N4DA 4OM8A 1TAGA 3QHAA 5K05A 4LF9B 1FPQA 2CD9A 3ROGA 5B64A 4XYEA 1OXSC 2X0IA 3LA8A 1H48A 1EX6A 3VAZA 5C7OO 4DNPA 1R0KA 1PT7A 1M1XB 4TWJA 1WTAA 1YOVA 1VKHA 2NU6B 1R15A 3WE7A 4C8IA 3FOEC 2F8TA 4C88A 4ND2A 1WSDA 4RTNA 3I6YA 3VNUA 4Y1RA 5SZIA 3THWA 4Y6SA 3BWYA 4BUZA 1L7DA 1QQ6A 2G6BA 3FUTA 4Q9LA 3E1KA 3FNRA 2W4QA 5HW0A 1LLDA 2IF2A 2QP3A 4BV9A 1WXQA 1E92A 1ECJA 1SHLA 3RH0A 4IVNA 5TPWA 1JWLA 3C6YA 2H18A 3LAWA 4IIJA 1R0WA 4LHWA 3ZU3A 3NBYC 3E70C 3M1XA 5F98A 3R23A 1I7DA 1EXWA 3HU5A 1Z39A 4XPZA 3BE4A 4H6PA 4V39A 2G8NA 2W8BA 3D00A 2WAOA 3PAFA 1KIFA 5JCOC 2B1GA 2BMEA 2IL1A 1C3JA 2CZGA 4HLQB 4MIKA 2AMLA 2GYUA 2FPXA 3DGEC 3INGA 3LY9A 4O4HF 1NE7A 1NF8A 1D4OA 2DE0X 2VXCA 3DE5X 1ZEMA 3H2GA 4FQ8A 4H59A 5IVHA 1R16A 3CMMA 5DGHA 3U3KA 3ZI4A 4HDNB 2QN8A 3KD2A 4AUEA 1QRRA 2BUBA 4PYJA 1N5LA 2BC9A 4ERHA 3VR6H 4OL0A 5K4AA 5LU8A 5M2QA 3EGXB 3G7UA 4YWJA 3KPUA 3FWPA 1Q1BA 1XQ1A 2CUKA 2ZI6A 3JQ9A 1X87A 4D98A 3OCCA 2PX0A 3AR6A 1Y63A 3OWXA 4N12A 4WGFA 3VOBA 1ML3A 2IIBA 3GIDA 4ER0A 3PUZA 1GVHA 1WUYA 2HFKA 3IOYA 4UVDA 5DM2A 2CLFB 3ZCUA 2JIZD 2ADMA 5HS6A 1OBFO 4U2EA 5FNVF 1ZNYA 2REXB 5B3JA 3MW8A 2GD1O 4PYMA 3B1ZA 4O2LA 2GK4A 3C1AA 2A9FA 2EGUA 3OQVA 5EWMB 1VG8A 1IATA 1KO5A 1AKEA 2A5DA 1LBSA 2B92A 4QOIA 1LH0A 3G4SF 1LUAA 3ABQB 3LDAA 1PTJA 4UULA 3MTGA 4ZEXA 4F7WA 1U7XA 3AF1A 4CL3A 1N7GA 3I1FA 2ODNA 4Z8XA 5I8PA 4YCDA 2MIIA 4KXYA 4PZUA 1KFCB 4ZP1A 3JSXA 5JAOA 3K15A 3RE1A 4FYVA 3U4AA 2MSKA 4M76B 5LYYA 3ZWDA 3V9AA 3ZXXA 2HS4A 3RC2A 5J3JA 2GZDA 3CRVA 4OA5A 1OGIA 4YGYA 4LHZA 1NR1A 1COZA 2AWOA 2QX7A 1F2TA 2NXEA 1FX0A 3KR2A 3VUFA 1INLA 1WXIA 4EZEA 1IV4A 3SC6A 1BD4A 3PS9A 4KPUA 1Y9ZA 2GRAA 3OLWA 3SIPA 1QP0A 4DSNA 2QYSA 4BDTA 3GFSA 4I5GA 4ZZ2A 1SG9A 1YBVA 1DBRA 2DKFA 2WIJA 2XI4A 1JHXA 3HU1A 5AI4A 3SJ7A 4ZVSA 3VDNB 4ZQGA 1SRQA 2PMEA 4B4WA 4YXFA 4ZKDA 3IH5A 1O89A 4B75A 4KR7A 1H5UA 1QRDA 3A10A 1BZYA 5LD2B 4DB2A 3EXIA 1UZUA 5K45A 2ZJOA 5G4LA 1VSVA 2YDXA 4X61A 3SS8A 1GUDA 1N5OX 3S0YA 5CD9A 2ZUUA 2BEVA 4LGVA 4UFOA 5IAKA 1G2PA 3JQGB 3TOSA 1Q7GA 3D4NA 4LMRA 4K9OA 1M72A 3T9EA 5FPSA 3SIXA 3UMGA 3W5CA 5DNYB 2AG6A 1ZHHA 1TCVA 1N77A 3KCQA 5L51A 2W9XA 4UEOA 3EQ2A 2H57A 2CXQA 2GF9A 3KQHA 3LUKA 1XJ5A 5JAIA 2DPMA 4MLZA 3LHIA 1SVMA 3A6DA 1XDSA 1AUQA 2A9QA 2Y0BA 2PXXA 4RACA 3TE7A 1RWOA 4NZ9A 1W2GA 3BE6A 4B4UA 5BQFA 1F12A 4LPSA 1J97A 3NNNA 4B09A 2OCYC 3CNQS 3L5OA 1YUNA 4LZJA 4OB8A 3HBAA 4BFWA 1IZ0A 3AJAA 4Q5IA 3RRJA 3GJTA 3FXAA 2PX5A 5IC6A 1C9NA 1FOEB 1LLQA 1Q3TA 4EJMA 3FPHA 4BNYA 3HKDB 3MINB 4YAEA 2UDPA 1W8IA 1GTZA 2GESA 1J56A 2EWMA 5AICA 4LXUA 1SVIA 1TUBB 1GRVA 1SZCA 1A2QA 4IHJA 1EP3B 1WZIA 2FZWA 3A14A 3IMFA 2QM8A 2EP7A 2MOKA 2VO1A 3LX5A 4FHFA 2NZUG 1CVIA 1ONOA 4N76A 3JAWB 3BCSA 5AM4A 1XO1A 3B3GA 2ONCA 4QXOA 2GDZA 2IKQA 3FYDA 4IIJF 4DA0A 2YJGA 4IJVA 3D3NA 5I45A 2QNBA 4QWMA 1PLLA 3E3LA 3KYDB 3W2TA 2VNKA 3CVVA 1KYQA 1UINA 5LYJB 1TPZA 3N7TA 5IDVA 3F0GA 2FF5A 4CV2A 1M2OB 2XHZA 2ST1A 4G63A 4B74A 3LPAA 4ETWA 1Y3BE 4LZZA 4RMNA 3HBLA 5FUBA 1NT2A 1NW9B 2GA9A 1YE5A 3EY4A 5HCNA 3WP1B 4FB5A 2I76A 1JB9A 4NOMA 2HRBA 1P9OA 4PZPA 1G8SA 2ODAA 5IPFA 1VGVA 3LQYA 3VXKA 2JGNA 3G89A 3QUBA 2JBAA 4BJ3A 4OHWA 1I4EB 4Q0MA 2GZ1A 5EE3A 5JEDA 2A0WA 3P9YA 1TIKA 4QSMA 1GAWA 1YZHA 2NADA 4J4TA 4ND5A 3K5WA 5TX7A 3RDPA 1H0RA 2ZRNA 3QEBZ 2X7HA 1OV4A 4HB2A 4ZDIA 4A26A 2Z1FA 4KIFA 1KP3A 4F6RA 2OM2A 1HK7A 1OVGA 4H7IA 4LMAA 4YX9A 5KHLB 3NTXA 4ZU3A 1HEUA 3FROA 1QXSA 4BCDA 3TOVA 2ZP1A 1WOYA 1IMJA 4S04A 4NV1A 3CPQA 1Q1QA 4J1TC 5KNDH 1T9ZA 3KSAC 1K88A 4RF4A 1NLYA 1ZH0A 4LXGA 5DLPA 4BGVA 5SYAA 2IYAA 4ZTUB 5TMEA 3Q3CA 5DASA 3BFVA 3NHFA 1HG1A 1RRFA 1WY7A 4JGBA 4JLSA 2PKQP 3VR6A 2TYSB 1OXTA 1YR3A 1GU1A 1WU8A 3AHGA 3QLVA 3K14A 3DCYA 1T1SA 3PUJA 2GJSA 4BVGA 3SVTA 3QIVA 3CTMA 1O5TA 4HMOA 4Y1GA 5DYIA 3O75A 5BR7A 1U9CA 4QDJA 3H3XA 1Z8NA 2C8JA 1P80A 3GXBA 2X1HA 5K0TA 3PGLA 3D2CA 3L43A 1XMJA 3W2EA 1KR2A 4WA7A 1TDJA 2PUWA 3BB1A 4JJZA 3AOEC 1T4BA 3MHPA 4S1OA 4WZAA 2CFRA 3D6AA 4Q7LA 3A58B 4JBWA 2B20A 4UW9A 3MWFA 3PX3A 2J3MA 4ZARA 3RCBA 4BVTA 1T5SA 4N82A 5JLJA 2VF2A 2B8EA 2PZFA 4WFJA 3VU8A 1VQ6F 5K2OA 2XMSA 5TQ2A 5LD2C 1UP4A 3AF5A 3CR3C 3NHBA 1DCTA 5LUAA 1K6EA 2BCEA 3AR9A 2K2QB 1I13A 4K3UA 3LKBA 4J0FA 1TT5A 5D5HA 5HRUA 3TR5A 4D80A 1HLFA 1VQNF 1R12A 1PWHA 3I45A 3SJUA 5AUOB 2ZXFA 1VJCA 4KSBA 3X1ZA 4ZVRA 1CY6A 1UBNA 3PFIA 4EF4A 4M0DA 2IFTA 3GQBA 4BMVA 2PKCA 3JD2A 1S4QA 4MKHA 3WJ7A 3QFFA 2GEBA 1JG6A 1KKMA 3AKDA 1QZUA 3NI2A 3ITDA 4R8MA 2CE7A 4BLQA 1UMDA 2HV9A 1H0HA 1JEYB 4E03A 5IJXA 4Y9TA 2VSYA 1WXXA 1F2UA 4UTVA 4ZN6A 3TRKA 1L7AA 4HQNA 1N0IA 3C8ZA 4JROA 3LQ2A 4DTCA 2H1VA 2JGMA 1J0BA 1JMVA 2LDXA 3DKKA 3DOEA 1EFLA 1R37A 2X1LA 1QKJA 3GFOA 3HDHA 4ZAZA 2XXAB 2F6RA 2XCLA 1AOXA 4ZOLA 2O14A 4JQYA 4LTNA 4CVNA 3QWHA 4L5AA 1C9YA 1VJ0A 3FFWA 4HWKA 3AU8A 1QVAA 4I6EA 5C5IA 1BFDA 3BHIA 5HNKA 1RKXA 4LRUA 5DYNA 5EMMA 2V8BA 5FI3A 5FTWA 5LB4A 3RJTA 4CLOA 1LV8A 3HXLA 1CR2A 2X9QA 1K8QA 4B4DA 1YSCA 3K6JA 3EA0A 3DF9A 1E58A 4JXJA 2MU1A 2P2YA 1T0PA 3KWJA 2AG1A 2VUUA 3TGPA 3CR7A 4J43A 3OU6A 3ZGOA 1NT4A 1BFKA 1IHDA 1JQBA 1R0CA 4GKAA 1RXYA 3A6JA 3PFKA 5FLKA 2WZQA 4WLOA 5C0OE 4I50A 1BVRA 2LIVA 3SQOA 4LQCA 2JA1A 4MUMA 1YZVA 3MJDA 2XE6A 4YQFA 3DFMA 2HPVA 3HA3A 1XI2A 4PCLA 4AB1A 2ZZMA 4X7RA 5B1DA 4BQPA 1KDTA 5KINB 1CZOA 4YRAA 2EKBA 2V74B 3QG5A 3MSXA 1JR6A 4OO3A 2RHBA 1VI2A 1JFLA 3OG9A 2INGX 4WW0A 1N6NA 1GEGA 2I1WA 3ZW8A 2ZM6B 3VMMA 1BGWA 4F9TA 2VP0A 2F43A 1VE9A 2Q8QA 2BONA 1YR6A 4ALMA 4F21A 1BCSB 4ILKA 1OI4A 3KX2A 3VV2A 4PTYA 3L7QA 4INOA 3SXUB 1RWBA 2QGFA 2Y4OA 3FHOA 2XUQA 5AK4A 4AYTA 4OQXA 4X90A 3UMCA 4DIBA 5F9FA 3I9V6 3PDCA 4EFNA 1OFHA 2X5OA 3BIWA 2C0QA 3IIIA 3CG4A 3AXTA 2G9QA 2YYAA 3MNFA 2WM3A 3MTEA 2GB4A 1XMSA 2EKLA 2IVZA 2Z4RA 1HDOA 3K0EA 4RK6A 5F73A 3UVEA 2A0FA 2E87A 4QTTB 1WPGA 2B4QA 1SVKA 4LHSA 4G5XA 3A7EA 3KB2A 3C5EA 3RBVA 5AOAA 4P34A 3FAKA 2IOFK 3SEQA 1RBZA 1I3CA 1O97C 4CKEA 1YITF 1QLJA 1NR5A 3AUAA 3DMRA 2OZLA 4IS3A 1AKWA 4N3CA 4PPYA 3F97A 4UEJA 3HJCA 4PU0A 2BOVA 3B2QA 4YYZA 2Y2VA 5KOHA 2G0TA 1PUJA 5HGXA 1FNMA 1EFPB 3IQFA 3KE9A 4HB0A 1OH8A 2GZRA 1OX5A 1IY9A 2FEXA 1B8VA 5KHAA 1R2QA 2Q1UA 1EXVA 3VPAA 5IK2D 3DBHB 3THRA 4HXYA 3S2ZA 3JQEA 3ROEA 4QUEA 3GQBB 4JL6A 1OC2A 2OTMA 3LUDA 1K5GA 3CKLA 1I4LD 2FV8A 3C14C 3CUWA 4IRUB 1M0SA 4IYJA 1UP7A 3P2IA 4L07A 4X1KA 2PDAA 3G1WA 1DIBA 4MK4A 2JJ1D 2ZYTX 1RRPA 4Q4DA 5JVDF 1PSDA 4PYQA 1Y9JA 1H2XA 1P19A 3BWMA 4HGNA 5B1EA 1XYVA 1E9FA 2EFJA 2R6CA 5ITZB 4H4DA 4G84A 2XQJA 3QYJA 1R5NA 5FPKA 2I7VA 2CLEB 4JJEA 3ZIUA 2WJ4A 2J5BA 2JFWA 3IKVA 2ZYSA 2QLBA 4LJLA 3FZGA 3V42A 4BNKA 5KTSA 1E1YA 3F74A 3QI7A 2UZ3A 2ZYGA 1GRRA 4J16A 3TPZA 4AWXA 4EPXA 3A4NA 3I01M 2P41A 3UNXA 2KB0A 3GARA 2C4WA 4QOGA 1DIOB 3QG1A 5E95A 3S2UA 4M1OA 1Z4IA 4G4WA 4GEGA 2WM2A 4JGGA 5HXZA 1G6KA 2O48X 4L8LA 4LCEA 3UHAA 3D4OA 2FW1A 3DJYA 1CJCA 3LPCA 3JRWA 4MUIA 2WPDA 3T3GA 4XXHA 1N0UA 3T9AA 1YJBA 1TB4A 4JDPA 3TQQA 2CHQA 3QYFA 1O96B 1T3LA 2EZ4A 2GARA 2IYPA 3RIXA 4BO9A 2NNWB 3CCVF 2HZBA 1GGJA 1B0UA 1NV9A 1SQ0A 3DNMA 3KQMA 3P2YA 1N78A 1Y3FE 4P08A 3ITNA 1SBHA 3QA3E 3MT0A 1OH5A 4BLVA 1ZUIA 3O03A 4EI9A 1XD9A 3IVGA 4IKPA 3IFSA 2XUJA 4AMUA 3LQFA 4WJZA 1GZDA 5B7GA 3CH4B 2FMTA 4B7UA 1SAYA 2AZMA 2BJHA 2J32A 4OXQA 5ES4B 4DG5A 1JGTA 4I1OA 1B8OA 3HV0A 1YS4A 2QVCA 2VJYA 1B41A 1UH5A 3AKYA 5A3SA 4BS9A 4G0MA 3EJ6A 5H82A 1B0ZA 2DFDA 1NP6A 2PH7A 4HWOA 4UAUA 4F9EA 1SUEA 2HDWA 5BSFA 1V47A 3LYLA 3PEFA 3BORA 1E5LA 3L0IB 4P8RA 3O8RA 1DRVA 4Q18A 2W6PA 4RC9A 2UYQA 1DPFA 2VDKB 4AI6A 1F4LA 1RFGE 1U0JA 4RE5A 4UUMA 1O0CA 3I0NA 2NVWA 1DAKA 4P6VF 4Q00A 4PZ0A 4TTAA 2G04A 1JI0A 4PXAA 4W6QA 2PUFA 3DC7A 3K30A 1G21A 3L82B 3C3XA 3DOIA 3Q0IA 3QJYA 4G0QA 4U7PB 1ISJA 5K03A 2Z58A 2O8BB 2OHIA 4KJXA 2CKDA 3HKCA 3BMNA 3GRZA 1AURA 3PE4A 4OREX 2YV1A 4DHWA 1EWYA 1YF3A 3IJPA 4EI8A 2E55A 3FYHA 4LQLA 1OCEA 2E89A 4XIIA 4GAEA 4ER5A 4ZOEA 3TKYA 2EKDA 4LEIA 3ZQUA 1RHUA 4IEFB 4L51A 4Q3CA 2MCFA 2YRXA 2KTUA 2PH3A 4KH0A 3RG2A 3HKEB 1AQIA 4MRMA 1Z4NA 4X3OA 1F8FA 4CM8B 1OLXA 4V1CI 1XK7A 1AQLA 4LDRA 3W8DA 1L6RA 3O0TA 1G7TA 1CB7A 1XN4A 3D8RA 4LRTB 5ESWA 5SY6A 2Q2QA 5FXMA 3UENA 3MWEA 2Y67A 3UH1A 3QX3A 2BGTA 3EDYA 5DH9A 4IVPA 4L4ZA 3THXA 5JC1A 1EDOA 3U80A 3OOWA 1A1SA 5EI5A 4BX9A 3OY2A 1QGAA 2PJZA 4QGBA 2HF7A 2RJNA 5CA1A 3MA0A 4WFIA 1OGJA 4EYGA 2CWWA 3D81A 2FDRA 5AM3A 5JI3E 5IVKA 5I7RA 1QORA 2J3IA 3U39A 3NMUC 3RK4A 1C7ZA 4DMHA 1JHDA 4G5HA 3OP1A 5JPCA 3WAKA 1DIRA 3BWDD 2O5CA 3MTDA 5LYJA 1U8FO 3PC6A 1PFUA 4C0BA 2EX4A 3T1TA 2C59A 3OIFA 4U0JA 5CFRA 1SZJG 1KR5A 5D7NA 4P4TA 3FN4A 2C94A 5AKYA 3EX7C 4AZTA 2GD6A 3SXUA 2R00C 1IPFA 2BP7B 2VEOA 2LPMA 2RGAA 3K2IA 1OGYA 1VQ4F 3OECA 2OUIA 3VDQA 5I47A 1QRUA 2GFIA 1QVFF 2OFXA 3ANMA 2GTHA 3G5AA 4XGRA 1T3GA 3TX2A 2IUFA 3INRA 2UZHA 1Q1ZA 3WWEA 1OU4A 3HWSA 4B32A 1IEQA 1UXKA 2HVYD 4TT8A 1A9XA 1KO7A 1DP4A 3ONFA 1Z5PA 1R1MA 5TIIA 4X0EA 1CDEA 5FBWB 4M89A 4QVIA 1DADA 2EL7A 2D2FA 4KKXB 4Q1FA 3WOHA 3I2IA 4R2LA 4BKRA 2I3GA 3IMGA 1VPWA 1KMIY 1ORTA 2CXPA 3KYCB 5CHYA 4RZSA 3RVDA 3NH9A 1NHGA 3ZDFA 4RTRA 1ISHA 3SF8A 3TL3A 3ZVRA 2H2IA 2JLBA 5DNCA 3RYTC 2H1OA 1NR7A 5IN5A 4KVFA 3A9SA 5GADl 4DYVA 4YMWA 3AKCA 2R6AA 2XUDA 3JAWA 4KPGA 3BKWA 4QHTA 4QO7A 4TLLB 3ZLTA 4AJPA 1L7NA 3T1YB 4QODA 2NTVA 3C8UA 3I0ZA 1B3BA 2QQFA 3QXHA 3UJNA 2IYVA 4L7VA 1WBDA 1J2RA 1GNQA 1GX1A 1M8GA 3L5KA 3CFYA 3RLFA 1UI9A 3P5BA 4CTMA 3P9CA 3O74A 4XE5A 5D01A 3WYCA 1J0DA 1AQYA 1YI0A 4H2DA 4S0ZA 3AOGA 1DBVO 2F1HA 1ISGA 2WIAA 4A0QA 1CRPA 4TSFA 3QFCA 1BC5A 1MV8A 1UADA 1XZPA 4YLYA 3FHCB 1ND6A 5JD6A 4B4VA 2YH2A 1G8GA 5EQJB 2PQ0A 4MUXA 4K1LA 1QO7A 5BWBA 1XAGA 2HQSA 4GOKA 1PW5A 2IXGA 1T6XA 4WCVA 2PS9A 5AI8A 3VPDA 4RJJA 5JMPA 3RTBA 1HGXA 1MQAA 4V24A 4BVHA 1A98A 1JWBB 2Y0CA 3OCYA 4GE3A 2BEJA 3L4BA 3OJEA 3DVLA 1RLGA 5THQA 3ZWNA 1PVDA 2BBTA 1CUUA 2CDNA 1H9CA 3E3NA 2FPUA 2JFPA 4IXTA 3VJKA 5LMNB 1K27A 3PNBA 4EKIA 5KWJA 1IOZA 2EZ9A 1ZD4A 1GOTA 5GPBA 3WADA 1GPH1 1R4MA 3UCEA 4F6RB 1XZCA 2WT8A 2F3SA 4BNGA 2H1RA 1Y3IA 3WZLA 3ZZNA 1U0GA 4B46A 1HETA 2AX4A 4JAVC 1ZZGA 1HYQA 4AS2A 3ZI7A 3VSBA 4JXXA 1S6YA 1ZVVA 4KQMA 4U7DA 3MBMA 1KERA 1GU0A 1NVDA 3F1KA 5H59A 3REGA 4CMCA 1E1CB 2I2FA 4BVKA 1TMGE 4FFOA 1XMIA 2P79A 5LM3A 2PEZA 1FZTA 1IHPA 2VHTA 5AVYA 5CPFA 2C5GA 4OQEA 2F3UA 4FGWA 1QBGA 2H8KA 4FMDB 2J5QA 3D4LA 3DUWA 4HNVA 3I4LA 3AK4A 3ENVA 4M7WA 3DXYA 1L5HB 2CLDX 2X23A 4QDOA 1U2RA 4UATA 4EW2A 2QBYB 4PNPA 1HUQA 4NCBA 4JKOA 5KKCA 4CMEA 4Q7QA 4DANA 4MIEA 4MZXA 2Z5LA 2AI1A 4GYWA 1GFWA 4D6YA 4KC0A 3NM5A 4J0QA 3MXOA 1LJUA 2OP0A 2WE8A 4HPXB 3ZDEA 4ZZIA 2XT0A 5BNIA 4CLRA 3W6OA 3ZJTA 4RAOA 3LBHA 4TL8A 4ZQEA 1V7PC 1VOTA 3SPXA 4COOA 1MAVA 3B13B 1K7CA 5H8WA 1FFCA 1HE3A 1ZVMA 3N2GA 1ZK4A 4KQ2A 1ZCAA 4D0RA 1Z6XA 1O96A 3MYYA 1WEHA 4YT5A 3ZE9A 2RHGB 3LPNA 1C2TA 2QTHA 3QENA 5HUJA 4G4SO 4W9MC 1O57A 2AC4A 3NG1A 4R6WA 5IKXA 4JQCA 1UR5A 3QXCA 3KJEA 4Q82A 4BFVA 3JVDA 4UUPA 3IHKA 4ED9A 4HAXA 4B7AA 3HR7A 3M6FA 5K3SA 5ECDA 1YOVB 4E88A 3GIWA 4GPEA 3QVLA 1GARA 3JZMA 4M9RA 4TYMA 4BO3A 2YRFA 2X4DA 4GGMX 1SQGA 1G3IA 5L53A 4F91B 1TX4B 1F17A 3A1WA 4OBXA 4FGJA 4MQ4A 4AMYA 4O4JA 3A2KA 1IQRA 5FYQA 3L8GA 4K6MA 2R4UA 5FTKA 4L8WB 4PQGA 3LECA 1I6MA 5C8DA 2ALEA 1KMQA 5DNAA 2FR1A 4EKEA 2A0UA 2DSTA 2V45A 1RRKA 5DWVA 1MXHA 4E4RA 3N76A 1EFCA 1RFLA 2EX1A 2JIPA 4Y7CA 1VDZA 3QIAA 1FB5A 1HT3A 4RO0A 3ZWXA 3WKCA 4UOQA 4N3NA 1ZD9A 1GQ2A 2DQSA 2YRWA 1DAMA 2I2XB 3FRJA 2DHEA 2QEXF 1QTRA 3FFTA 4CU5A 1PX0A 3M70A 2PE5A 1PR6A 1I6LA 3B38A 3P0EA 1KC1A 4UVHA 1YC5A 2WAXA 4ARZB 3O4JA 3ONWA 4LE2A 4EGAA 3NCTA 4JUAA 4OFBA 5HDQA 3TUIC 1AGPA 1EFVB 3RF7A 2P6OA 2EBWA 3ND9A 4Z9BA 4F9FA 4PVCA 5EXSA 4MQUA 1BD3A 4G56A 4DV2B 4JR0A 1K06A 5A1JA 1XMPA 2QGNA 3WTBA 1FTGA 2QN2A 2JGFA 2JBHA 3HY6A 4MPJA 4RHCA 3MTQA 2I2BA 1CUCA 3D6FA 4KPFC 3TIVA 2GBPA 2JCBA 1B6GA 1V5EA 4L9AA 1JEDA 1BA2A 3JWIA 3IC5A 3LUPA 4W1SA 4BEWA 1MQ8B 3SKXA 2V7GA 3JV7A 5PNTA 4HX2A 3B9PA 3G2LA 1PL7A 4RLFA 2Q7DA 4L6AA 3UK2A 3V4FA 2C0CA 3UG6A 3UW1A 1PL8A 1SUFA 2G36A 4IDAA 2H2HA 1LXCA 3L49A 3ZHCA 4CDMA 4XIYA 1UOPA 2D2IA 5HFAA 3SC2B 3PHHA 3RBXA 4RABA 1G3UA 2FEMA 4U6NA 1YB6A 3M6UA 1DLJA 4PC1A 5HFJA 2O7RA 4F1JA 5TQ0B 4F8EA 4OCZA 4RL6A 3L8CA 5FJJA 2LTAA 2VUSA 3V1YA 3C1OA 1L7RA 2DWCA 3EG9B 4IXDA 1HL7A 3S29A 1U8YA 2VHXA 1WXWA 2E4YA 2YASA 4KLCA 1J39A 5JUWA 1AQJA 3EORA 2EFCB 2RHTA 2OORA 1EXNA 4A6XA 3DLAA 2R62A 4JLDA 5G2OA 2PR2A 3MQ2A 1NYQA 1JL3A 2PG3A 1YKGA 2RJ3A 1XCBA 2O2HA 2JKYA 1ULZA 1FL9A 3IEPA 3X1WA 1ZYUA 4OLJA 5I7WA 1AGRA 1XHOA 2CZCA 3PD7A 2C31A 1X7XB 1GO2A 1D09A 1DEAA 3NV7A 4A7PA 5JAZA 5FA6A 4B6OA 3LGSA 4DLWA 2B8NA 5JZSA 2O8VA 2GEFA 1I9CA 3I5MA 2WHXA 1D03A 1SHZA 4BKPA 3JTEA 1VLQA 4RK4A 4MQFB 1V0JA 2CHEA 4Z54A 2X58A 4ND7A 4RGVA 4W1PA 1RJDA 2Y1DA 3DQPA 5D86A 1I0ZA 5F2KA 5LBTA 3W78A 3WK7A 2HWKA 1V8PA 1KY5A 4IIEA 3ONEA 2KE5A 5HFNA 1O58A 5BOVA 3VTKA 2RG1A 5BSGA 1E1KA 3MQ4A 2O2GA 5IJAA 4X3LA 1EFKA 2AF4C 2IHTA 3D64A 4JEIA 1ZA1A 4XFKA 3AEUB 4WZ6A 1ORVA 1LRLA 2EKQA 1G55A 1SC4A 2FYTA 3UATA 4WBNF 2GNOA 1SCJA 4QPZA 4BCCA 1OXVA 3DYBA 3R3JA 4D9HA 5AHKA 2IP4A 1P4GA 1W34A 2NPIA 4PXSA 1K7EB 2GJ9A 3DLTA 5CG1A 1K8ZB 3TPFA 2PSHA 2RBGA 3G0CA 3M6XA 4H4CA 4N5IX 4ETNA 2VNHA 2ISSD 2C2MA 1WUJS 4CDGA 4B3HA 3O2JA 4BAGA 1PBTA 3A9WA 4MYUA 2G17A 5EZQA 1DC3A 2AXNA 3PF9A 4PBTA 4ZCLA 2ZYAA 2ZBUA 1PNRA 1JVNA 2WDZA 4GMHA 4Z8YA 4WXYB 2D3WA 3UMFA 2VDJA 3BSWA 3PFHA 5ALOA 5I7UA 5C18A 3R1IA 3WBKA 3DD5A 1AMNA 5ERYA 4YUWA 1U5CA 4FE3A 4W7IA 1Z45A 5DBOA 4MR8B 4IHKA 3GA0A 2QSZA 3VZBA 1RWWA 3M82A 4BX8A 5JS2A 3KQQA 1WPXA 2PV0A 3AR5A 2ZXUA 2NO5A 3KZNA 4OXXA 1YJCA 3UTCA 3VOSA 2GVZC 1DRWA 2MYUA 1EE9A 1FUUA 5BP7A 2GFHA 1VTKA 4PGGA 3FKSD 1RZRD 3NAZA 5CU7A 3GPCA 4L1KA 3TZQA 4Y1EA 1Z6AA 2WFLA 4JLAA 4RSRA 1KBZA 2R96A 4PFKA 5ES3A 3W5SA 4FXPA 2P9ZA 3T5TA 5BN5A 2EFGA 3OUZA 3LY7A 4AZ0A 1Q0UA 4HDAA 1FA9A 4KDCA 4U1RA 3H4VA 2PY6A 2DTDA 2YJNA 3RA5A 1XAIA 1SM4A 4W99A 1AIPA 3HJHA 3QELA 3VC1A 2DOKA 2OCIA 2ZSIA 4HATA 4L5YA 1Z4QA 3VGPA 4OAQA 1HFEL 3RK1A 1HE2A 1X7WB 2XWSA 1V7CA 3PD1A 4HB3A 5ITSA 3A1TA 3ZDBA 5KYXB 5AKLA 1WE2A 2PUJA 1QJCA 1NJ6A 3GGDA 3IIMA 3KKLA 3EQ7A 4KGDA 5K8TA 3ZO8A 4C2UA 4WEQA 4IJMA 1NXSA 1VIMA 1ZSVA 1NJ1A 2GTIA 3RRZA 5IT5A 2GZ2A 3VUEA 4YRIA 1SZPA 4HN4B 2ASVA 3TO5A 4FMCB 1DCMA 2VUHB 2ZTSA 3NK7A 1J23A 4EG4A 1S3IA 4FX2A 2OTLF 4C87A 1V4NA 4MVCA 4B83A 3EFHA 2BM1A 4NHEA 2Q3MA 3CNNA 4GU5A 1E2NA 1K63A 1R6TA 4PSAA 4W5RA 3AQ4A 1N5KA 4MUGA 4NZOA 3UICA 1EE2A 4MV4A 1B6RA 4RHYA 1TW3A 2HPZA 1FRFS 1T36B 2FZ4A 3BS4A 4ICIA 2ZBPA 2BW0A 4I1YA 4WHMA 2I1LA 4B71A 3IX7A 4JLUA 3U7IA 5EJIA 1J1IA 4DUYB 2AFIE 3KRTA 3MPUA 3OQJA 4EPTA 3RU3A 1TYAE 2QXUA 3M8KA 3MELA 3WK5A 4YJGA 5ILGA 4P84A 1JA1A 5JMTA 1NWCA 4MQEA 5CVTA 3GZ4A 4MYRA 4MS3A 2FDCA 5FBRB 4Y2TA 3RU2A 1OE0A 3IS3A 4UDYX 1H4SA 3TQSA 1HV8A 2FPKA 4CM9D 3B8HA 2V1UA 2JGDA 3I4FA 4JB2A 1UZAA 3SAJA 4HVLA 4HSGA 5E7JA 4UREA 1GPKA 1IZ7A 5JDCA 1UEXC 5J2TA 3CCMF 3KZOA 2XLBA 1L3IA 2O3JA 5JAQA 3OA2A 3Q7IA 4U2DA 1HRKA 2OV3A 1SHKA 2X22A 4WQMA 1UDXA 3CC2F 4EELA 3E2PA 3ZE8A 1EBUA 3W8NA 1GGKA 2XWQA 4KAXA 2FWRA 4R8VA 2HQSC 4OFWA 5B3KA 3GDOA 1Q50A 1MH1A 1P7ZA 1FXUA 3OZBA 1REQA 3ROMA 3JQGA 3S81A 1J1UA 2IKSA 1X92A 4PYNA 3NFRA 1FSPA 1UM9A 1X8KA 1TZJA 4G5OA 5LQSA 3X2FA 5M04A 5HY2A 1FFGA 1KYTA 1TT5B 2Z3ZA 1OFTA 1U8EA 1WABA 2W43A 5FL7A 4ZI5A 5BURA 5KTKA 2A94A 1PD0A 1VI5A 1E62A 3C6BA 2NAFA 2UKDA 3EVEA 3BWBA 3OX3A 2G0AA 4AP6A 1BU8A 2C95A 1L8QA 2RAPA 2P67A 3F96A 3K09C 3SSAA 4D8VA 2WWYA 3AV3A 4FZRA 1A97A 2PK3A 3ELUA 1EA7A 3Q3HA 4N0QA 3TCXB 4YRPA 1CBUA 2XUOA 2I2DA 1J8QA 2IUSA 4CEHA 3PKZA 5CIYA 1UZNA 5K0BA 1Y0BA 1U0NA 4RPGA 1WDWB 2NXWA 1JX6A 2IYQA 3Q3VA 5T4BA 4UQPA 1IVNA 3AHFA 5ICMA 4DMLA 4JLKA 4M1MA 5KVSA 2PUCA 1MO2A 2N0SA 2ATCA 2GNPA 4M0FA 2OCDA 4HS4A 2PRJA 3FDIA 2PKQO 3QMMA 1KAMA 1RYBA 2Q5JA 1VH8A 2VK4A 2IYYA 1WHTA 2ZROA 3LNCA 3PWZA 4KLNA 1EZZA 1JXAA 3GLGE 1GA6A 1YCHA 5CH3A 4OLAA 2P2LA 5DSXA 5J5VA 4D8YA 3PJEA 4YRFA 4Q3BA 4XYGA 3MCWA 2C92A 1ZOIA 3F2IA 2XQFA 3Q6NA 3RIMA 1RYMA 3AJEA 1JAHA 3HG7A 4EG1A 1X42A 1DJNA 3HYTA 4MQBA 2CWDA 4Q93A 1MC4A 3OHMA 4ISCA 4K6OA 1QJ4A 3WGLA 1SCIA 2EIHA 2Y99A 1PD1A 1YDFA 2XUGA 4K2HA 5F4ZA 1TZ2A 5EY5B 1V16A 3BFJA 5JDIC 5JNLA 2IP2A 4IDBA 3PFBA 1JN1A 2V58A 3A1DA 1PK7A 1OAAA 2BISA 3KUXA 1Y98A 2ZQZA 2YV4A 2V9YA 5L95A 1ONPA 4X62B 4RCVA 3RASA 1PYDA 3AM5A 1E61A 3BYZA 3WGKA 4G0YA 1A9OA 3FJ1A 1ZGAA 2CF6A 2PIAA 5DTRA 1U2DA 3A9CA 4PWZA 2DQ4A 1WM1A 4MWDA 1Y81A 1NF2A 2D7JA 3JYNA 4WVLA 1IQPA 2ZB8A 5SYNA 3X44A 3QUWA 4RQOA 1X1QA 1QQBA 2H4YA 2ASEA 1C3OA 1EGQA 2Y0DA 1CIPA 1A77A 3P9NA 1TQ6A 2VH2A 5EINA 2H63A 2HADA 2JJ1A 2SECE 4X00A 3OQMA 4DG9A 3REFA 3D3KA 2CLHB 5GVRA 4D4HA 3THYB 2HNAA 3ZHTA 1MX3A 2R7NA 1KDZA 4ZAGA 4YCCA 1G7CA 5I9BA 1GKYA 4BFZA 1YI1A 2EU8A 2H16A 4RZ3A 4F84A 1M5RA 5T7BA 2H2WA 2FFAA 3C8HA 5ARBA 4YJ2F 4TYYA 2EZ8A 5EJGA 5EMNA 3WP0A 4YRMA 1VQKF 2HA7A 2ZSAA 1EINA 1AK9A 1NMYA 1T25A 1K0UA 1UOOA 2HHCA 2O2DA 1SOMA 1ZNWA 4PSKA 1E4YA 4GPIB 2F2TA 3TAXA 1HZZA 2J9XB 2HYDA 2Z98A 3DTVA 2FPPA 4HZUB 3NAQA 5A5EA 1CV2A 1PSZA 4I19A 1K5DA 3ZNOA 4MVJD 3VBEA 1Z2EA 2XQVA 1UKCA 3K8YA 4YNBA 4EHHA 3BH0A 4JWKA 3ZLBA 1VFPA 2P40A 3O95A 4QUKA 3PPXA 4TT3A 4YJ3F 1DFGA 1KBOA 4JN6B 2P4EA 4LGMA 1RHQA 4QYIB 1MJGA 4LBVA 3WLRA 4V1CB 4JBNA 1K4KA 4V0OA 2PX3A 3G13A 1QAOA 1JLRA 2WJZB 2JH9A 3KLPX 3NWPA 5F33A 4NS4A 4RFSA 1NASA 4OA8A 3O8DA 5KYYB 1Z68A 1M0WA 3JQQA 5DX1A 4FILA 5TQ0A 4TKVB 4WKCA 4YO8A 2RAUA 3UOAB 4ASUA 1JG3A 1M2HA 1RAEA 1T8WA 3NBXX 4PQFA 5AP9A 3STYA 1SOAA 3VU9B 3QE4A 2O1EA 2FPMA 5H1YA 3E4DA 4QFCA 1D2AA 1MABA 4IGIA 3LFUA 3RT1A 4NZMA 4B43A 5AW7A 4CJXA 4Q6BA 4DJEC 2YV5A 5TEWA 2C42A 2IY8A 1R5OA 4GS5A 5FI5A 3V7NA 3VO9A 1TO1E 3N2LA 4YT8A 4B3FX 3GA7A 2EP8A 2B83A 1KK2A 2IXBA 3MS2A 1GNVA 4KO2S 1H8HA 3HA7A 5HQ3B 1W1IA 1L3CA 3Q40A 5EFOA 4ZTZB 4M99A 4RNCA 4GWGA 2DR3A 4KG7A 2PVPA 4A03A 2A57A 2WC1A 3SLRA 4XSGA 2AC7A 2FR8A 3I6BA 3RC1A 5GIPE 5CAEA 1PWZA 3OZCA 1D4ZA 4E2XA 2O8EA 2YIDA 3DVRX 4G1BA 2QUAA 4RW0A 1VZ2A 1KAEA 2HDNB 1MJGM 4CM1A 2BFOA 3UWPA 2XXJA 3V7UA 1SCUB 4XLLA 4EABA 1HT2E 4G07A 2AZ4A 2P9JA 4B6EA 2IU0A 3OZFA 3IJ5A 2VRWA 4QBFA 1D07A 4CMKA 5CB4A 2CLLB 4BP1A 1ZP6A 4UD2A 1G2OA 2PZJA 1Q1AA 1S2LA 2EVWX 3FVQA 5JZMA 4P4UA 2CXUA 1KBQA 4RWEA 5F1YA 3VHLB 4JI8B 3LHSA 4DSUA 2Y1CA 4ENRA 4H3HB 4QECA 3QU7A 1SKUA 2WJVA 3JPWA 2ZWMA 1LWOA 2NU8B 1DS6A 3OX4A 1UDRA 1Z0JA 3L7OA 1Y1QA 2QJFA 3JS5A 1XTSA 1Z33A 3KJIA 3N2ZB 3I09A 3REOA 1GPJA 2CFSA 2W6ID 1M1UA 1X7ZA 2QNRA 1MN6A 3PUXA 2QUBA 2VGNA 4KQEA 2YS6A 2VPXA 2ZUCA 2BDEA 3N8IA 4DB4A 1SK9A 1O97D 2VZ9A 5G1NA 1RRVA 3K2EA 2Y77A 3MFQA 4HRXA 1T9CA 1GPAA 1Z5UA 4U9HS 3RS8A 5AW6A 1ACJA 2GEKA 3CZ5A 3TWOA 3WMEA 2CEAA 5BYAA 1CEQA 4AX8A 2WHRA 2X0EA 4EUKA 1R4AA 2O5VA 4QC2A 2FCAA 5F5LA 4J0HA 5FBZA 2G1PA 1Q20A 1PFQA 4ON9A 3WAGA 3CC4F 4BMOB 1T2UA 5DM0A 3TMKA 2JBWA 4IDHA 1HKHA 3MVEA 1AGNA 1IN8A 2B8WA 2VNIA 1XALA 3PGMA 4KO1S 3H75A 3VI6A 1ZGGA 2EEPA 2GQ0A 4FYIA 3REQB 3HO8A 2ZB3A 2GZMA 1SUIA 5AHRA 1AHIA 1M1YA 4F6LA 1TTPB 5JARA 2Z3VA 4Z4IA 1LD3A 5L3RA 4REQB 1B2RA 4TV8F 4D56A 1KVQA 4G5YA 1U11A 4EHIA 1R0SA 8ATCA 2NP7A 3T6KA 3E48A 3A28A 3HCNA 4X1YA 5DW3A 1TM3E 4O8ZA 2W6CX 1HDXA 5KI6A 3W2GA 2QMUA 3CUTA 4IGFA 3ZDXB 1OZGA 2Z8XA 3B5IA 4F1WA 3D6NB 5HIKA 5IDXA 5HKBA 1SXPA 2E4WA 2PO5A 3L07A 3RIEA 2VP2A 4QFMA 1DWQA 2M98A 2CK3A 3HXMA 4KZPA 1A5BB 2UYNA 4KXMA 4YRDA 3PXGA 3QFTA 4KOAA 3RJ5A 1JBKA 2G71A 2OAQ1 2VT7A 2JH3A 2OGSA 4D41A 4HG2A 4KXFB 4XR4A 1CNEA 1Q81H 3EIEA 2IHYA 3RHZA 2FPSA 1KJNA 1RWVA 1S8OA 3SNKA 1APBA 4IP0A 1PR4A 3PDUA 2GEJA 1V45E 5ITZA 3VHRA 3H2KA 2ORYA 4Q4AB 4UBLA 1W4BA 2YXLA 1SVNA 2FUKA 3CLTD 2R7KA 3WWOA 3MG9A 1B23P 3ZVKA 1V8BA 4HDMA 4UMVA 3U4HA 4GI5A 4KAAA 4U8HA 4HOYA 1A5AB 1SC1A 4OSEA 1XDWA 4EVRA 3U7FB 3KYCA 3ZHSA 7GPBA 3M5PA 2XUZA 1NQAO 3RSZA 5C8ZA 1O95D 1C0IA 1TMYA 1C0PA 3W8FA 1JU4A 2ZAMA 3G59A 5BNFA 1N36B 1A8HA 4LWOA 2CHUA 5TXGA 3BB4A 1YV9A 2AHRA 3KJQA 1SD5A 2FUNB 4H1VA 4J2OA 5JRJA 2RB9A 1UDCA 3J81M 1LBHA 1SUBA 1XRRA 2EBFX 2JFBA 3OCXA 1GQRA 3P2EA 2OZPA 3AUJB 1C9MA 2R8RA 4LZNA 4QUJA 3TTVA 3NVDA 4CM9A 4DA7A 5CM8B 2Q1SA 1UL1X 1VL0A 4PLPA 4ACBA 3EGOA 4I0WB 4H6VA 4P33A 4CIVA 5BSWA 2GN0A 4KIJA 5JSFA 2PUVA 3L0SA 5ALRA 2ZRJA 5ALYA 3VC2A 3VFDA 1R8QA 1RPJA 1Y4SA 1YBAA 2BZSA 3AR4A 1NM5A 3NTRA 1H5NA 1IB6A 2GSDA 3C5CA 4RD3A 1KRWA 4NXMB 2DC1A 2IX9A 3WB2A 3YASA 4N39A 5K8UA 1AS3A 5AVUA 3RAEC 1V2GA 4M0CA 3DCIA 3H2HA 4XGNA 1Y34E 5ADHA 3KQKA 3GYBA 3WWCA 3TEJA 1VXOA 5A0VA 4WN9B 4G9BA 1VYTA 4NZPA 2B36A 2WWFA 5ILQA 1Z56C 3UCFA 4CQLA 3EODA 5IT4A 1SUPA 1J90A 3FF4A 5KCZA 5LLDA 3FOFC 1AO3A 4KI7A 4Z3DA 4JLBA 1D5WA 4J29A 1D0SA 2W5UA 3LT0A 4CODB 3R6TA 4NONA 2P4HX 3BDVA 5KMGB 1M2OA 3KQLA 3R5HA 5CYOA 1IJEA 4EUNA 1VL6A 1QRTA 5FNVB 1JDPA 2JHCA 2O1WA 1MP0A 2Q99A 3ZZUA 4BATA 4OIMA 4IYRA 3SP1A 4R7TA 4A6DA 4N5HX 2OOKA 1SHUX 2OCBA 5M3BA 1VLVA 3ZBPA 2MWMA 3BGOS 5K09A 1VL1A 4IIXA 5CVDA 2IA5A 4FFVA 4E14A 3LNTA 2POQX 5H9VA 2XOKA 4EYEA 3PEUA 4HQKA 3LWBA 3HE3A 4RDCA 2XDAA 1Y82A 3HUTA 4UPVA 3I32A 5E6SA 1FRVA 3F78A 4F2PA 5BSVA 5JXIA 5ED0A 1XZLA 3MJRA 1K75A 1DWPA 2BLNA 4UNPA 4ZQIA 1MIOB 3SBOA 1M0EA 5IEJA 2E18A 2Y05A 3A70A 1KU0A 3G2JA 5YASA 2I3ZA 3AVYA 1Q7TA 1NXQA 2OZKA 3VPHA 3FLMA 1EUDB 5ALQA 5EPOA 2B7LA 3PI7A 4HEQA 3TL6A 4NBLA 3KQOA 2B8JA 1JH9A 3E58A 1L5HA 2YN2A 4RQBA 5JROA 3TLXA 3AIOA 3IDFA 3AF2A 2D1TA 1YL5A 2WWHA 4M0EA 2GBCA 1TZKA 3CRQA 3M3DA 1CRLA 2ZUWA 3ON5A 1EVEA 2HLPA 2OEPA 3CG6A 2OQ2A 3KKOA 3KOYA 4V38A 2RB5A 4ZI7F 1JR4A 3H4IA 3WGZA 2V0GA 3IVRA 4HAWA 2W2KB 3N5CA 2NUPB 4GZ3A 1URPA 1E2FA 2ID9A 1EWKA 2C77A 2D1QA 2P6UA 4FR5A 4IHQA 4ES6A 2YMQA 3ZP4A 3CISA 3OOHA 4WINA 1JU9A 2DSNA 2DT4A 5LDDC 3K8ZA 3WPWA 4CV1A 4JYPA 3AT1A 1ADFA 4KI0A 4RL4A 5AVRA 3JVEA 4UC0A 4MHOA 4XGKA 3GROA 3T8YA 2QTVB 2IZOA 3OZWA 2EF0A 1L4EA 4UM9D 3DBOB 1RYEA 4IDFA 4YMIA 4BX3A 1AKTA 4MHSA 1NKVA 2GASA 2HS0A 1L7QA 5EP2A 4YRRA 4PLTA 3CO0S 3DBIA 1IRXA 1K8YB 3O8LA 4RGBA 3ZKAA 3VH3A 3UK7A 1BRMA 3TD3A 1QZZA 3G2IA 1BJKA 3IR6A 1LPMA 1P1CA 4MR7B 3UB2A 3UT5B 2CFTA 1PAUA 3B52X 1GFSA 1P1JA 1PZMA 2Q6OA 3E5HA 2QROA 3EDCA 3QF7A 4FQ5A 1W48A 3TL2A 3U2QA 2FFRA 2R25B 1KFJB 3IELA 4G88A 1JXOA 2P27A 2VAMA 3OLQA 5GM1A 2WYIA 1DMSA 2EW8A 1VE5A 2E6KA 1L4MA 4WJLA 2B9EA 3JVVA 4F7DA 5JZOA 4YCLA 2J0UB 1NMZA 3GDHA 2FP4B 2DQKA 2WT9A 2PL5A 3SFVA 2FW8A 4PIPA 5D8DA 4H7HA 1KY3A 4L72A 2V7QA 1Y6JA 1L5YA 5KB3A 3FHTA 1RHJA 4O29A 4RE6A 4Y2YA 3BA1A 3A1UA 4LXTA 4QNMA 2QWXA 5KOJA 4B17A 2NQTA 3EGVA 5REQA 2GLZA 3K20A 2NACA 3Q2IA 3KZVA 3LYHA 1PFWA 4RVUA 4W5OA 1F38A 4DDHA 1DU4A 2OG2A 4A8JC 3BK7A 1VBNA 2JFYA 3C48A 1WQ3A 3AZOA 3G49A 3MLEA 5C8YF 1GGEA 2BMWA 1Q16A 3L40A 5AKZA 3HTNA 3K2XA 3TD4A 1DAHA 4DLAA 5EGNA 1W40A 2WSBA 2PGOA 3OCZA 3USES 4KE6A 5ED4A 4CI0B 2W22A 5EHQA 2BTUA 3LY5A 2PBLA 3IR7A 3OKAA 1PFVA 1WJGA 2XDQB 5BN4A 3TXAA 2FSFA 4EB3A 4V02A 1G3QA 3IAEA 1SXIA 1IU9A 2KMLA 3HFGA 2ZTLA 5LBIA 2WSYB 2EBHX 1RJEA 1JDVA 4N18A 5JH7A 2O0MA 4B7CA 5C53B 1PBNA 3ERNA 4C2AA 2ZE8A 1N92A 3FGPA 3I2JA 2I8AA 2UYHA 2CMFA 4YBZA 1IAVA 1OF1A 4M22A 5A9SA 1DKOA 3L6BA 3C3DA 3K8QA 2F3QA 4Q1AA 2ODTX 3WXMB 1L4HA 3KSUA 3KAKA 4TTPA 1BSVA 2GCEA 2I34A 2XKJE 4M60A 1W5SA 4JHLA 1EH5A 5HQ3A 1ZMBA 3CNLA 1JH8A 2WTAA 3PI6A 5GGXA 3ZE2B 4GRIA 3NHAA 4LVOA 4R54A 5DHTA 2ATEA 1KC3A 2EIXA 2EJCA 2V5UA 2W48A 1G5HA 2WINI 3CUKA 4DNQA 2B2CA 4QU9A 4RD4A 1H8HD 1XP5A 4WNYA 1EM8A 4XQCA 4MDEA 5IANA 1KAQA 2O52A 3G23A 3HYRA 4F2WA 3WHIA 2PEYA 1FVHA 3QMPA 1DWOA 3MMNA 2GDJA 2PX2A 2YXEA 4CMEC 4EA9A 3L8DA 4WASA 4BP8A 3KOXA 2Q4RA 1RAFA 2J7PD 2OZBA 2HRDA 2C4TA 3ETGA 1I3NA 4H1TA 2WZCA 4HN2A 5L6LB 2P7HA 2ZJ0A 1NXVA 2YBEA 4FC6A 4HGZA 4PX2A 3T38A 2C3MA 2I66A 3IDOA 1CEYA 1FP6A 1I4DD 1WW2A 2R6ZA 3H84A 3KWLA 4EX6A 1M76A 5C37A 3R5XA 5CR9A 1XZJA 2IH4A 2M6RA 2VJQA 3AU9A 2PAAA 3B89A 3KTOA 3ZCPA 1KMHA 4OU5A 5A9SB 2DB3A 4O2BF 5EJEA 4REOA 3SMVA 2PQ6A 1M2JA 3H8JA 4CT4B 2ISQA 3RS5A 4YV0A 1DDIA 4RKFA 3PPYA 1XZFA 1IY8A 3CWQA 4TWIA 5HKKD 4E6EA 2W2NA 3BBLA 2IS2A 3G0OA 2I4OA 5ARCA 2YHIA 3TQRA 3GY0A 4M7PA 2BBSA 4EUHA 2DWQA 1OUMA 1PZEA 3EULA 1R5BA 2O0HA 3I3OA 3SJZA 2LV8A 3A2MA 3ECCA 1UJMA 5CMLA 1W88B 4JI5B 2DEUA 8LDHA 3BXOA 4QBGB 5FHQA 4JSTA 1W4ZA 3PC4A 1HE1C 2IEBA 1PXWA 3OOYA 1PP4A 1ESEA 2HJWA 2I62A 4YP1A 2HHHB 4KIUA 4KIGA 3KJGA 3IBCA 3V8PA 4K7JA 2H8GA 3OLVA 2Q5OA 1QQAA 5DK6A 4Q3EA 1VIDA 2HJVA 5AO9A 5B1IA 3V97A 1D2GA 1D2RA 2JK1A 2HEGA 3B6EA 3E23A 1A8UA 1EFVA 3FDZA 1H4TA 5C3UA 1M8FA 4FHCA 4DCUA 3L4JA 5LWQA 4UTXA 3KM0A 1UC5B 3PUKA 1JQKA 4QDKA 2PRYA 1KORA 1JFFA 3ZVNA 1F8GA 3I9LA 3LP5A 4CL2A 1DG1G 1GEEA 1RABA 3GZNB 3LK7A 2ZCVA 3D8BA 2C29D 5KO2A 1GG8A 3RUPA 2YJ6A 3QOYA 1LPBB 2DKOA 3SX2A 1JKFA 2QN1A 5J5AA 4DJFC 2WT4A 4K03A 4XUCA 5JYEA 1I7SB 2GJAA 1RCTE 3SKYA 4A0SA 4EB6B 2R8PA 4PBRA 1G7RA 3ISVA 5E7MA 1LX7A 3U3ZA 2GK3A 4BNTA 4H31A 2DYKA 2Q8NA 1EK5A 3GJZA 1G4UR 3TLEA 3HPQA 2IK8A 4NMXB 2FLWA 1GKLA 2F4NA 1Q11A 2AG5A 2XB4A 3ACBA 4QVGA 3UA4A 3ZBQA 4IJQA 1E9AA 4IILA 3AETB 5A6SB 1ZUNA 3DLIA 3I05A 4IV8A 3GRRA 3NOQA 4C3VA 3I1YA 2YWBA 3BL8A 5FEMA 6ADHA 4MX8A 3H65A 3FUXA 3SIUA 1LU9A 1D6SA 2HLDA 3OY7A 4PF1A 4BMNA 4N49A 3R8FA 1SBTA 4OVKA 1AUVA 2XR1A 4IS2A 1PTKA 2WD9A 4TX1A 1OXKB 1U0HC 1UT5A 2XY4A 2VRNA 5JVDA 3O8QB 1FU7A 2B0CA 1K3FA 1C1HA 1NOKA 1QPGA 3WJPA 1VDMA 3D1JA 5H0IA 3UJ9A 2NTEA 3DZFA 3IP8A 3QVUA 4BTEA 1E3WB 2OOSA 3PPVA 1TM2A 3KZCA 3ZCXA 3GQVA 4GKJB 2FFHA 3DDHA 4GR4A 8MHTA 2HQBA 4UZEA 1MO5A 2YMLA 2VHZA 2CCKA 2OCLA 4Z6KA 4L7QA 2GZHA 1X7XA 4HGOA 3W7AA 3DLHA 3KVNA 1XP8A 4G0UA 3FMVA 5HIIA 2P3SA 5LMUB 1XDGA 3RNOA 5FV4A 4D26A 4KQ1A 1MTZA 3WLPA 1ZL0A 4D9JA 1T8SA 1TVMA 2PWPA 3J7AR 4RJ2A 5F5NA 3GJ7A 3FGOA 5H68A 2OO7A 1Q77A 5K0CA 4IM7A 1XEXA 4EMTA 3WL3A 3A4MA 4FR2A 3GH1A 2XRFA 4NKRA 3G5LA 1T2FA 1F2VA 9ATCA 4AICA 3Q7EA 1D04A 3C8LA 1EVZA 2O2YA 3GYGA 4B6RA 4CIWA 1RLJA 2RIRA 3OTGA 4WZAE 2VJKA 1N3LA 5K8CA 2ZF8A 3ZWQA 2A92A 4M9CA 4NESA 4MP6A 5LP6B 1AQUA 1FVOA 3BUSA 3C3YA 4ZK6A 3LGAA 4GH5A 5FQNA 2R3SA 2BHTA 4UDOA 1KFEB 1WDLA 3O4RA 4KN9S 2QYHA 4IDQA 2JCYA 3D31A 4GRDA 2OA0A 4XX1A 3KP1A 3THSA 4YCJA 1M6WA 3IVMA 4IHJF 1SOWA 1QIFA 3HACA 2R6R1 4D3ZA 1TK3A 4KR3A 3KPYA 2EQBA 4BZQA 1TZMA 3DT6A 4FGKA 1U4NA 1WMFA 3E2MA 1UXIA 2C9CA 1ADBA 1L7VC 1UJCA 1Z7WA 1RI4A 3UQZA 1XMOB 3Q3EA 3E9EA 4AVYA 5JANA 3IIKA 2JZNA 4KUGA 5I7SA 4XD2A 3DE0X 4P83A 3ZKWA 3JCMM 1EUCB 3ZI0A 5KDLA 4YUYA 5LQJA 3V8NA 2OCAA 4S3MA 2PM8A 3AWIA 3CCJF 5A0FA 3RC9A 1Y1PA 2D1RA 2PT9A 2P35A 2QW0X 4A10A 2ZITA 3KKPA 3O8OA 1MJFA 3IQXA 4N5NA 4TVKA 4EA8A 5JSQA 5CD1A 3WJAA 4CYMA 4N65A 2RCNA 3AVTA 3IVCA 4JJIA 4P58A 3PDJA 1ARZA 3ZU5A 1GZSA 2WJJA 1RWQA 3NWOA 4EHKA 4XEHA 3O82A 1T0HB 2HP0A 1LBQA 2V7VA 3Q0EA 4UTRA 1Y80A 121PA 3SS7X 1WTCA 3RAFC 1XFDA 1M73E 1ST3A 2B4TO 3C45A 3GWZA 2IYSA 4URUR 3FTNA 3P9PA 1L7XA 4LFCB 3WVNA 2XB6A 1EEHA 1YR8A 3WNDA 1ZISA 3AESA 2I91A 3SE7A 3Q8KA 5HJ5A 1TMOA 4E33A 3B2EA 5FHRA 2OT3B 5HIAA 3EEOA 2E4AA 2WLTA 4FSDA 1X7WA 1XPRA 2QXTA 5E8RA 4ID9A 4FWBA 1EX1A 5FULA 4HFNA 4MGHA 3CPEA 4U7JA 2QTMA 2QN9A 4BNVA 4UM9B 1FYWA 4HQOA 4FS3A 2V6IA 2X4GA 1V8FA 3DEYX 1QVVA 1OPRA 2QX4A 3CKKA 1Q2UA 3O4FA 2XCIA 3GJRA 4E22A 1U2SA 1B0AA 1V1JA 5AUNB 1H0SA 5AIBA 3K32A 3VOAA 4X91A 2WD7A 2ZK7A 1TVKA 5FWXB 4FFRA 4YAJA 3BH7A 5KU1A 1EVQA 3MJCA 2FWNA 2W2XA 4QXMA 1V9SA 1SKMA 1XYYA 2BR5A 2WJHA 5C51B 3CD6F 1XMVA 3F6EX 3GLTA 3FPSA 3LDGA 3MAJA 4QPCA 3KQSA 4P38A 3R75A 2IZ5A 4JT8A 4P35A 4P3PA 1RJ9A 2X6RA 3U49A 1Z26A 1CDOA 3PRKE 3P9QA 5G0UA 2ORVA 2PLFA 3HM2A 4GW3A 4NICA 1E7QA 3WV4A 3IVAA 2FEWB 2XAUA 4RTPA 4DR3B 2XUFA 3CQ9A 3LJKA 5A4IS 1XV5A 3HDGA 5LOVA 2Z01A 1YZFA 3ACCA 4JNKA 2M2IA 4YP0A 4EBBA 3FVVA 4G2TA 4N41A 5CXQA 2CUNA 4HMPA 6NULA 4ZHYB 4TXNA 2ZTHA 3QK7A 4L2IB 4PZ9A 4D3SA 5EJ6A 2VYNA 1QK4A 1CUSA 5B55A 5AVTA 1CUJA 2XMRA 4KQFA 3MUOA 3GZTB 3AETA 1PNQA 2AMYA 3HO1A 2VSQA 1C9KA 5T6BA 4ZCTA 4QUIA 1RAAA 4C3UA 1GZ3A 1WMBA 2RHRA 3EDOA 3OZSA 1UOEA 5KNCA 2OK7A 3KETA 1XCPA 1OJLA 2J5KA 3MJSA 1SD2A 3CR8A 1HDRA 3QXXA 3RS4A 1H2EA 4N03A 1DOHA 4DT1A 2YQ5A 1KAHA 3F9IA 4EEKA 2LP4Y 3PF8A 1DT9A 1SQFA 3GPDG 4XWGA 2X8JB 4B6SA 4HAZA 3IJEB 3M4YA 4WMLA 1O54A 1QIDA 3RHFA 1DKPA 1N3IA 2HRZA 1E94E 4OXYA 1U9JA 1JBQA 3GO4A 3MOIA 4Y0VA 2R6HA 1MT0A 2F48A 3I2YX 4NCHA 3ROTA 2CJFA 2BY4A 1XD8A 2PGXA 2JAWA 3GK3A 4FGZA 1JLLB 1L8XA 1QG6A 4LX0A 1CUWA 3CA8A 5L40A 2WVGA 3ZR4B 3LL4A 3ESBA 2NZJA 5CT4A 5H02A 4Q9DA 5JRZA 3KG2A 5LN1A 4XJXA 1NKSA 1FNJA 4MWZA 2J5RA 4JC8A 2EWVA 3QEJA 1QYVA 4FONA 2FPGA 1Y42X 3DBRA 2O2XA 4ZVMA 3CC7F 3JQ6A 1Q92A 5DNWA 5FPTA 4ALLA 3HH8A 4O6VA 3Q8LA 1L7MA 2ROQA 1KSGA 1L5VA 3EH2A 1LCIA 4ZAVA 2WK1A 5ECGC 3ZWAA 2UUCB 2A84A 1YONA 4N6GA 1X9HA 3JQBC 4CKZA 2RGRA 1N1EA 2IQQA 1P77A 4JENA 5DU2A 4TWZA 3U17A 2AFHB 1XTIA 2HN9A 2JLQA 4Q6WA 3TR0A 5HYVA 1U3LA 3UKDA 1VL5A 4MWTA 3Q6MA 5BQXA 3VYUC 2PBFA 3KFXA 5K51A 1NMQA 1YFLA 2PJRA 1ODEA 1PHPA 3KEFA 3C6KA 2GK7A 1TUIA 5BQOA 3V4PB 3K70D 3G8CA 1G3MA 1U6JA 1KYXA 2QUKA 3EZ9A 3KT3A 3O9VA 1H2WA 5DBHX 1E96A 3IAM1 5B6JA 1USVA 3LGXA 3URMA 2A5YB 4U02A 5L4LA 5FNVA 1MJ5A 3EUWA 4C06A 1AM4D 2R1TB 4QUBA 2NMVA 1LNZA 2UYGA 3QKRB 4H4EA 5EB1B 1DJQA 2BEKA 3AUTA 2EC5A 1ULAA 1TK9A 5EJMA 3QLUC 1D4AA 2AJ8A 3DMYA 1KZ7B 2VJOA 4FZ3A 3RT9A 3PL1A 4KPEC 1B73A 2PU7A 2PVCA 3AUYA 4RVGA 1EIZA 2ZVPX 4NL4H 4UU1A 2F3RA 1DPGA 3CVJA 4IBOA 2PLWA 2ZUBA 1G66A 3BGSA 5KTOA 1KEWA 2PMBA 3NHWA 2QM0A 3BTOA 4UFNA 1ZSNA 5IP5A 4ZEVA 1JJIA 1CS0A 1B3RA 4YFVA 3CLKA 3BMOB 2ZYWX 5TMBA 1X7HA 1XPOA 2EJUA 3EZ6A 4LJSA 4NCIA 4D2IA 1HZJA 5JHGB 1Q7BA 4FP9A 2JZOA 4BNDA 4LIPD 2R85A 4J0EA 1E2LA 2ZRHA 4BVBA 5H81A 1JT9A 1S2NA 5BW6B 4XYMA 3B1JA 4PZZA 3K9CA 2HIAA 3BMCA 2GWHA 5FOTA 4ZOLB 3P4UA 4MYDA 4YC7A 2Q45A 1WCXA 3E1YA 3NHKA 4NVRA 3IIEA 4LCKA 4G97A 4UXHA 1J5PA 2P1ZA 1KI7A 3I2GA 3KQVA 4UNSA 3OT1A 1DKRA 1Y4ZA 4JBIA 3M49A 4UAVA 3OCWA 1HQDA 1N2CA 3WQRA 3ZDZB 4URWR 1R3DA 3TCNA 5KYUB 1Y33E 1T34A 2HU7A 3OOJA 3OE7A 2SNIE 2BKXA 2ZSFA 3WLTA 2VQDA 5T5QA 3G0BA 1ZIOA 4QYMA 3O2QB 4HS9A 1IIBA 4HNAA 1T6BY 2X5JO 1TYDE 2CMDA 3I8OA 4G24A 4A4DA 4CM7A 4C30A 3S44A 2CWJA 1KA9H 3C15C 4Y30A 2H3HA 4PLCA 3RR2A 1P7PA 2B7BA 2EW2A 3KDPA 2DPHA 2Q49A 3FNFA 3ROFA 4FSHA 3VJRA 4MB6A 4QYIA 3K16A 1XVLA 3TTUA 2BE9A 3EVGA 1Y6QA 3LQKA 2XDWA 2QL6A 5CFPA 5GIOE 2E4UA 4IF4A 4RELA 1R8SA 3H2YA 1QNFA 3S7ZA 3ZCQA 5LOVF 1IWPB 1AH2A 4ZANA 1E4VA 1E5QA 1F5SA 1R88A 4LJYA 1RPAA 1RPTA 4MUHA 3T5DA 2F43B 1JEYA 3FRIA 4HGRA 4UAJA 2WAYA 2PGJA 2HWUA 1Z83A 2P8SA 4ESEA 2GXSA 2EG5A 2HRYA 1FDTA 4N5LA 1R10A 2IEDA 4WH0A 3R5TA 1MJNA 1UKEA 1Q74A 3D54D 3PXXA 3INTA 4EW3A 1XRPA 1D0IA 1UBTS 4QLBA 1NLZA 1IZZA 1XQYA 3RV4A 2P62A 1NXTA 1CLIA 2CXHA 5IKMA 1OILA 4QDZA 4E2WA 4AW9A 2OVBA 3ZJ4A 2GN2A 2WSIA 3LP8A 3FH0A 3WGJA 4CT0A 4MS4B 2W6NA 4CIXA 4PNHA 4I5DA 5EMJA 2KS6A 1LI4A 1PIWA 1GSOA 2VTVA 3AHCA 1Q84A 3D8NA 2ZSEA 3L8MA 4I6JA 5THKA 1EM6A 5LR6A 2VSOA 1OROA 1B8NA 5K4HA 3SIRA 1R1DA 4XR9A 2R6DA 1VLLA 3PNYA 3RODA 3AVXA 1R6VA 1SEPA 2AL7A 3U1BA 1UBHS 1V5IA 3RRNA 2CD7A 5H3HA 3U0VA 4L5BA 4AFNA 2B61A 5HJEA 4QVKA 4DGQA 3L18A 2QSUA 5AKGA 3ZHZA 1W36C 1NRWA 1XKTA 4PM4A 3WLLA 1A4XA 2BR4A 2FWIA 4BDSA 5EG5A 5F2EA 3QKTA 1JKJB 3Q8XB 3TRFA 1P4JA 1LK0A 1PZNA 4EENA 2XGOA 1E0AA 3LYAA 1I51A 3N7UA 4MKXA 2XPCA 1V3VA 1V71A 3IQEA 3EHDA 4MVJI 5HF9A 3TD9A 3G02A 4M86A 4P86A 4QQRA 1KSJA 2JVKA 3PPIA 4POAA 2ZZKA 1XKQA 3I6ZA 1F8YA 1NOJA 2AOUA 2QQ0A 4IFTA 1SQ6A 4PIVA 4Y9UA 2IUYA 1OFGA 1U2TA 1EAYA 2YW9A 4FYMA 4WXEA 2QRMA 3DLBA 3FD5A 1W5BA 2NP6A 3RFCA 2ZRLA 3EWAA 1U02A 4LW8A 4HYQA 1G5QA 1G60A 2H1FA 2V4MA 1GUFA 3JQAA 4RQTA 3HVJA 3IUMA 2C4KA 2NUBA 2ZYRA 4MEAA 4C22A 1KH2A 2YWXA 4IUDS 4WVFA 5IJZA 3JATB 1BRTA 1FQJA 3EUAA 3ZD6A 1Z73A 3CPSA 4S1VA 2O3TA 3N2EA 3I9FA 1T3TA 1J70A 4L85A 2WEKA 2PN1A 3OE4A 5DSZA 4ZO4A 2HR1A 1A5TA 2XADA 2DLNA 4CIDA 1T0KB 1CZRA 3WLMA 5KYGA 4HH4A 2DHRA 3OPVA 4HBGA 2UZ0A 1UK6A 3H9GA 2CDCA 4WL0A 1Z0AA 4AP5A 4PRYA 1QTIA 4R40B 3FLBA 2DQYA 2HK9A 2RGYA 4J1TA 2D8AA 1X13A 1ZM7A 4N40A 1ZMOA 5DM4A 2WHQA 3SF8B 2QG6A 3H6GA 4WSOA 5JO9A 3IPCA 3QPDA 3T52A 1LK7A 4DV4B 1SIOA 3RKRA 5AFSA 3GLFA 1KVSA 3IOCA 3W6NA 4Q4CA 1K73H 4LDNA 3OE7D 4KCGA 4K86A 5K0JA 4Q4HA 5HR5A 5CB4B 2ZUFA 3H4MA 1Q12A 2C00A 4JMPA 4EY3A 4LY6A 4X6UA 1N9GB 1QX4A 3HJGA 4I8IA 2FE4A 4RY8A 4Y9DA 4BP3A 1NJ2A 4YRTA 1TEZA 4JX8A 3Q87B 4B48A 4RA9B 2FLKA 1AZTA 2Y1GA 3CPHA 5AW8A 3HRHA 2GERA 4PSCA 4AN1A 5CEEA 2QM3A 2HP3A 2JCVA 3T3IA 2QV0A 2XB9A 3EEFA 1PFKA 1Y3CE 3AV0B 1J07A 3BWEA 4HNGA 5JQGB 2I71A 2FZKA 2DAPA 1GAJA 2ZAGA 3CV3A 4P54A 5E0KB 4ESHA 5JFOA 1W93A 4AO6A 4OH1A 3CZMA 2IV7A 2AKAB 1N0WA 2PKXA 3C3JA 5EJ8A 1OTXA 2YWEA 3E9DA 3G0DA 2VHQA 4IGEA 3ZYCA 4A16A 3CNHA 1FMCA 1P62B 2QY9A 3KE1A 1QH8B 2R84A 2VK2A 4NQRA 4O8CA 4YAIA 2QTFA 3LWNA 5DNUA 2C5SA 4XDGA 4Z0NA 4AS3A 4DMCA 4Y2HA 3MF4A 4CLOB 2NUTB 3FMPB 4MVJP 5IASA 5JJ5A 4OBBA 4Y2UA 2BFEB 5DJ5A 1FMLA 4O25A 2V9PA 1II9A 3LWOC 2ZU0C 3I3SR 3HSYA 5CGQB 4CCWA 1YHQF 1NNEA 3PJRA 1I6WA 1RTKA 3OFJA 3NH6A 3WIUA 2O8CA 3BTSA 4RWZA 4ZVKA 4WXHA 3ZX4A 4PAQA 4ZEWA 5K4GA 1QSGA 2B6NA 1J0XO 5F9MA 1NC1A 1RM3A 1M7BA 1KI9A 1QAHA 3FDXA 2ID8A 4XM0A 4MCAA 3BA6A 4J16C 4X54A 4CWAA 4ZHQA 3DOCA 3ORYA 1QHGA 3UXYA 5DM60 5L4SA 1D1SA 1T2EA 1AT1A 6AT1A 3OCUA 2JCXA 1NUUA 2QUIA 1K92A 1YHYA 1WXFA 3F3KA 3KUDA 5TPZA 2FN9A 2QENA 5TVGA 4ABYA 4BPRA 5IJ9B 2E7ZA 4F8YA 1JDUA 2VJAA 3U56A 3EC7A 2OWEA 4MWCA 3RWOA 1TJNA 3LVFO 1QDEA 1OI2A 3KSDO 2OLKA 3HN6A 2PAFA 3KBBA 3AHJA 2NLOA 3PWKA 2XMDA 1N8RH 4MRMB 5DWQA 2B82A 4PQYA 5GANK 3T7DA 1RS0A 4YQYA 3QUCA 4OUDB 3DZGA 2IYWA 4JB3A 1U04A 5CVJA 2J59A 5B58T 4EK9A 1IXKA 3R0ZA 5IVDA 1OBOA 3R4CA 2RH5A 4WCFA 3K94A 4ECEA 1M8JA 2GEVA 3ZWWA 4G5SA 1NVMB 2AN1A 5IKPA 3VNQA 4TWRA 2R86A 4Q4JB 4O1MA 3AGPA 1W0JA 2VRBA 4MGZR 4R84A 1FF9A 2OTCA 2E5LB 1RM0A 2E2WA 2QUJA 4J0KA 1RIIA 2WV9A 2VRCA 1W76A 2CBZA 1AHNA 5A9TA 5I8WA 2WVJA 3PXDA 2YC2C 3CEPB 4V3BA 4BOYA 3NB0A 4NE9A 4S24A 5EE5B 4DLZA 3OTWA 2D1FA 2PKYX 3DR3A 3MRSA 2QRVA 5EP3A 4PR0A 2BFFB 1U5AA 3PIDA 2OGWA 2W83A 4OOEA 3R6WA 1E77A 1Y3DE 1WEKA 1K7SN 4BVEA 5CP8A 2RK3A 3RRFA 1HLDA 4MYSA 3ZGNA 3DUFA 3WGHA 4Z4EA 3DM5A 3L6EA 1RQXA 3M5WA 4Q9AA 3MRTA 4EI2A 1XDBA 1EFDN 2WSMA 3BD6A 3EXEA 3QU9A 5SY9A 1NMUB 2HWXA 3DMTA 3P26A 2H17A 1VPVA 2H2AA 2PWZA 2QIOA 2JFXA 2W11A 3FPLA 4LDAA 4NU6A 1VYVA 2H6EA 1JTEA 1V2HE 1DAOA 2UVPB 3GJ8A 3KKZA 3M9LA 1VL8A 3L9XA 3MSCA 2C7GA 1QFYA 1UBJS 3K73O 3COJA 3G6EF 2R48A 3F49S 3M3HA 4NZZA 4YV2A 2RDMA 4C7MA 2D54A 2JCGA 1HH4A 1VQ8F 3EVDA 3WTCA 1JNXX 4YECA 2FGJA 2IDJA 1T0AA 3KPWA 4UUOA 1E6CA 1M1YB 3WIEA 2P6NA 4MWSA 4OJYA 4FUTA 5EJ9A 4PO9A 4II2A 1F1BA 1XT6A 5FR2A 4EVQA 1HORA 2ZJ5A 1W52X 1JIJA 2DUMA 2NV6A 1FFDA 3PNOA 3SKVA 1KEVA 2P30A 1VIVA 5CXUA 1XQWA 3K4HA 4RGYA 2BI7A 3HC7A 2RD2A 3CINA 3C3KA 4I1RA 1IHUA 3VC3A 4BQSA 3I6MA 3HCFA 4RUKA 5CNKA 4AKSA 1EK2A 3M1AA 1XNQB 3MERA 3QF4A 3WGVA 4JIGA 4DRXB 4TL7A 4ZCPA 4YTEA 1EHCA 1U3UA 4MUJA 3RRXA 1E0SA 3IEKA 4ZO9A 4MV0A 3UA3A 1OT5A 1V8ZA 5EE9A 1BHJA 4TV9F 3T7KA 1U8AA 4UUNA 5B4TA 1ABBA 1Q5PA 2CZQA 5GZ3A 2IEIA 4DV7B 3V46A 1DEXA 1SXGA 4LOHA 2DUNA 2JIBA 1QVWA 2IZ0A 1LI7A 3NVMB 2E48A 1G41A 2AWNA 3CW8X 1ORRA 2HA4A 4BXOB 3U60B 1IOWA 1Z6TA 2A1UA 3BSSA 4JHXA 1KQOA 4OAOA 3AESB 4K9RA 3VYUB 4A2WA 1XNRB 1XXHB 2QR5A 3T1NA 4YJFA 3LFOA 1QV9A 1VI6A 3I2FA 1AUOA 1M5TA 1SB8A 3VYRB 4DCCA 2FJ0A 2JAQA 3B3QA 1LZLA 3ZJVA 1C7QA 1UWCA 2L17A 2X0NA 5CDUA 4LHVA 3WB9A 5JISA 2COUA 5CEJA 2AQ8A 1N2SA 2I29A 2NTNA 1FFAA 3MB5A 2PZLA 1IM2A 1X8LA 3L41A 4WKGA 5DVZA 2WOOA 1PV2A 2NXCA 3HO6A 3E9YA 4C5AA 3VMFA 4PG7A 1Y7IA 1E59A 1UFVA 3WPXA 1GO1A 2NV2B 3IERA 2HYIC 3DL0A 3I30X 4MKRA 1SBCA 2FFJA 2HNKA 3KR0A 1EBFA 4UBOA 5FD8A 2UYPA 4S1TA 4LK3A 4RJIA 4BU0A 4DSTA 1IXYA 3FWYA 1GDTA 3M0EA 3MWEB 4K28A 2H0QA 4MI1A 4JCCA 4I81A 4DBLC 3C4VA 1JYSA 5KNLA 5FLEX 5DGIA 1XLUA 5AHXA 1PQ4A 2QV7A 3CGWA 4U2CA 4X6XA 1ZICA 4BNDB 1YO6A 1VQ9F 3A3KA 1WG8A 4HDSB 4KDRA 2GEDA 5LQCA 2PSJA 2FMHA 1T6NA 4I8XA 3IEVA 2BDUA 3G8AA 4MCIA 3ZHVA 3BXFA 3VIUA 1Z88A 5A62A 2R6FA 5KX5A 3VU9A 4MPPA 4W5HA 4PYIA 1HYBA 2IF0A 1CQJA 2WWXA 1VGQA 1Z18A 2AEJA 4QA9A 5EWJA 3DHVA 1N2HA 3HXTA 1ISPA 4GKBA 521PA 3QV2A 2FMKA 1Q3HA 4PLHA 4QJ5A 4EDHA 5KWSA 5AVQA 4IIFA 2UYOA 2IYEA 3T54A 1Z6YA 4F04A 3I83A 2A9JA 5I5GA 13PKA 3AMVA 1XPJA 4B5CA 1RWNA 3WB0A 4R6XA 3AI2A 3GLVA 4M1YA 3F90A 2OV8A 4JZYA 1PQUA 1T24A 4PYLA 1N1GA 1O4VA 2AN3A 4UE6A 2HS3A 1NQOA 2C8KA 2C07A 5AJHA 5AJYA 1UJ2A 5FR1A 4ZYWA 1OIXA 5EYPB 1A76A 1ZJYA 2G09A 3LM8A 3QVVA 3TLYA 1O03A 3GGOA 5IHXA 5A5GA 2QUZA 1VJRA 3OQOA 3BM5A 1ZAYA 1UK9A 3ZC3A 1BA3A 3BXGA 4P7JA 4TQGA 3WWPA 5DE3A 1QUEA 3RV3A