3WGMA

Staphylococcus aureus ftsz t7 mutant substituted for gan bound with gtp, deltat7gan-gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVGANLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural change in FtsZ Induced by intermolecular interactions between bound GTP and the T7 loop
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3wgmA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3wgmA01
5KMGB 3HKCA 1OFUA 3RYFB 4TUYB 4I4TB 4XCQA 2RHJA 4YJ3B 3HKDB 5GONB 5JQGB 1W59A 3JATB 4TUYA 5J2UB 3HKEB 3HKBB 4I4TA 5J2TB 4WBNB 3C8LA 4TV8B 3HKDA 1Z5WA 3WGJA 5JQGA 5LXTA 3HKBA 3HKEA 4WBNA 2XKAA 3JARB 5IYZB 2Q1XA 3WGLA 5EYPB 2R751 4F6RB 3WGNA 2R6R1 4YJ2B 5IJ9B 5LP6B 5M7EA 3JAKB 3RB8A 5JH7B 2BTQB 5LOVB 5IYZA 2VXYA 2XKBA 4O4LA 5ITZB 1W581 5IJ9A 4YJ2A 4ZHQA 5JH7A 2BTQA 5LOVA 2RHLA 3WGMA 4B46A 4ZI7B 5ITZA 4O4JB 3VOAA 4KWEA 5MN6A 5JCOC 5MN4A 4HNAA 4TV9B 4U39A 2VAWA 2VAMA 3CB2A 4ZI7A 4O4JA 5LXTB 4IHJB 5CB4A 1FFXB 4O2BB 4TV9A 5EZYB 1TUBA 4X1YA 4B45A 5IJ0B 4IHJA 1FFXA 4O2BA 5EZYA 4O4LB 3JASB 5CA0B 5LYJA 1JFFB 5IJ0A 1RQ7A 3M89A 3JALB 3WGKA 4ZHQB 1RQ2A 3N2GB 3ZBPA 3JASA 5CA0A 1JFFA 4X20B 5C8YA 3JALA 3N2KB 3VOBA 4HNAB 3R4VA 1RLUA 3N2GA 1W5EA 1FSZA 4X20A 5CB4B 2VAPA 3N2KA 4FFBA 3ZBQA 4EI7A 4DRXB 4X1KA 1TUBB 5CA1A 4X1YB 3VO8A 4EB6A 4EI9A 2Q1YA 2RHHA 4ZOLA 4DRXA 5FNVB 3RYCB 4X1IA 2RHOA 3RYIA 4O4IB 5LYJB 4LNUA 3RYCA 5FNVA 3VO9A 5JCOA 4O4IA 5C8YB 3UT5A 4E6EA 3VPAA 5KX5A 1W5FA 4I50B 3E22A 4O4HA 3V3TA 5MN5A 4FFBB 4IIJA 3M8KA 2GVIA 4I50A 3JAWB 5BMVB 5KMGA 4X1KB 3ZIDA 3RYFA 5LA6B 4EB6B 5CA1B 5EIBC 4YJ3A 5LP6C 4DXDA 5BMVA 3JAWA 4ZOLB 5GONA 4X1IB 4M8IA 3JATA 4O2AB 5LA6A 3RYHB 2BTOA 3RYIB 5J2UA 1W5AA 1W5BA 4I55B 4LNUB 1TVKB 4U3JB 5J2TA 4TV8A 3RYHA 4O2AA 1Z5VA 3UT5B 4I55A 1TVKA 4U3JA 4EI8A 5KX5B 1SA0B 3JARA 5EIBD 5JVDB 5EYPA 3E22B 3HKCB 4O4HB 4F6RA 5LP6A 3JAKA 4IIJB 1SA0A 5JVDA
chains in the Genus database with same CATH superfamily
3SVLA 2GEFA 3DR5A 3TG8A 3DBRA 3ZWAA 1C4XA 4RDIA 4NYIR 1DEAA 3BFVA 3HR8A 3CCMF 4E7PA 4QHTA 1UBJS 3OFJA 4GNRA 3O92A 4M22A 1CUUA 5G40A 3HCCA 4EF6A 1JQ5A 1UDCA 1BMTA 4KQ1A 2SCUA 5DEOA 1DAOA 1USUA 1FLNA 1BHQ1 3SPXA 3PDIB 2FPGB 4YT5A 5HF6A 3L4KA 5BPHA 2RB9A 3Q7IA 4HF7A 4EGCB 1KO7A 3GH3A 3IURA 1I14A 2ZUBA 1MRSA 3CFYA 3LUJA 3SHWA 4RIGA 3B52X 5BYBA 5BURA 1PL0A 4GUDA 4X8MA 5F1PA 1T9AA 3KLOA 2RARA 4MVWA 1XSEA 2NO1A 4FEGA 1H7MA 2IAFA 2ECKA 3QYFA 4KXQA 2XB8A 5DGDA 4AKIA 4AC9A 2Z9BA 5HIAA 4YUVA 3OETA 2P2DA 4OBXA 3H9GA 4AP9A 1ZD4A 5DE3A 2QRZA 3QVGA 3T7EA 1LPSA 2XR1A 2VAWA 2ODPA 2WUEA 5ALKA 4Y6LA 4FKZA 1UBNA 5A71A 1QWSA 2QG9A 1TIKA 2WHPB 2VJDA 3P2IA 4N01A 3CKMA 1S7CA 4TKUB 4MS1B 4Z53A 2PPLA 2O1EA 5IJ0B 1FQWA 1P73A 2ZTLA 5EUQB 4AZ3B 5KVVA 3P10A 1UFYA 4F38A 3RTAA 2WU4A 4LGMA 4NJMB 3UXHA 3TMYA 3JPWA 2P1RA 2VRCD 5CXSA 2C7PA 3JALB 4TXNA 1NUHA 3T95A 1OH8A 1XA4A 3M5WA 4EZIA 1KGSA 3AVPA 4NZNA 4PICA 1GU0A 3L1UA 2H92A 3GHYA 4LGYA 1EYZA 4WIAA 4G4VA 1W57A 5EIOA 5EKSA 1E7QA 2CVZA 4Q3DA 2FSVC 1GA6A 3F47A 5L6LB 5ADUS 4MJXA 5HRUA 4IH4A 2OM6A 2AT1A 2EJCA 3G0DA 2VPQA 2ZDQA 4MJ3A 4US1R 5F7OA 5JBNA 5EGNA 2W6JA 2J0UB 4C3ZA 1CS0A 4MICA 1FDWA 5FNVB 1GKLA 3TKAA 4XQEA 3CJTA 2XEDA 3ELDA 1XLWA 2I2WA 1DKPA 2HQSC 5TR9A 1E3TA 1EB9A 3BUSA 4O0LA 4WV3A 5JJKA 2CL6X 1SB8A 4LHVA 3K1AB 1JHOA 2Q2WA 2QE6A 2W9XA 3DEIA 2HA6A 3GRVA 3PRYA 4G2TA 4H7HA 3IMKA 3NXKA 2K2WA 2VA8A 1GKUB 3TRHA 3K0SA 4GMKA 5LB2A 5TC4A 3OE1A 1V8BA 4W7HA 3EVNA 2RG7A 3QVVA 4BRWA 2QT0A 1NTRA 2IXEA 3GTZA 4CQNA 1OIWA 1QF7A 1QX3A 1GPDG 2XAUA 3GLQA 3ORYA 1LPAB 1NXOA 1TJ4A 1TMYA 4LTDA 2BGKA 1XROA 1JIVA 2O3JA 3TNYA 3B20A 4R9SA 4W5JA 1W5TA 2GK3A 3MAJA 4MUMA 5BNIA 4M6WB 1I7NA 3PXDA 4GDFA 3O21A 1WXHA 1W8DA 2V97A 3CN9A 1T5BA 2C7GA 3I1FA 1JQAA 3CLUD 1LF0A 3HWWA 4LXXA 1A97A 3UTCA 4BXOA 3UNXA 2R97A 2ZIXB 3EEFA 3EIQA 3MTAA 1ZM4A 5SYMA 4K9SA 1PYGA 4A9AA 3V7EA 2GH1A 3R3SA 5HM6A 3BWMA 3CNNA 1BMQA 6ADHA 1DWUA 1XCLA 3UCFA 1I7QB 4DDUA 3WK8A 1X1RA 2P2SA 3RIEA 3B60A 2R1VA 4BPBA 2XCOA 1U2PA 2UXBB 1M1YE 1YZVA 4UFPA 4QHSA 1VPTA 4R8RA 5E0OA 3WO1A 2PUGA 3GRCA 1XZDA 1YU6A 3HP7A 4B33A 3KB1A 2BSQA 1K9VF 2HC9A 4B5CA 4P1ZA 1UBRS 4BNKA 3VYSB 2QLTA 2JGLA 1ACJA 1TM7E 2W11A 2BAGA 3AG5A 4AY5A 4MUYA 2HBYA 3FTPA 2H29A 3P5SA 1V26A 3R5KA 3HCRA 1PNOA 3N87A 5AJYA 2GK7A 3L8EA 1C14A 3UANA 1PR4A 4LKRA 1P0IA 3B48A 3G13A 5DHAA 4ARZB 4D0NA 3COPA 1QBKC 4N82A 3NYIA 1THMA 1UMCB 1KZHA 3I2IA 3R6DA 5K4AA 5K6AA 3A4VA 1PG2A 4KPEC 2D4AA 5TJHA 2WAAA 5AW4A 1KOFA 5KYTA 3C6KA 3VJRA 2XMRA 3VH1A 3BREA 4B84A 2V9PA 2NLOA 3A1UA 3WL3A 4EJSB 4F2DA 5JXGA 1L4LA 4X64B 5J40A 1L4HA 5K01A 4JA2A 1NIJA 4JJEA 4XAQA 4UU8A 2P2NA 1MD9A 3VU0A 1ODFA 2F9ZC 1NLFA 1Q84A 1U4SA 2C2BA 3FSRA 3SNHA 1O4WA 2B78A 4W8HA 5CEEA 1J7KA 3B1YA 3RUFA 1UQRA 5U9CA 3V4ZA 2VCEA 1DADA 1NPTO 4ND2A 1I94B 2HNBA 2P6YA 3EGEA 4DWJA 4RVSA 2FKAA 1KXJA 2HJGA 4PPYA 2FMTA 1NUAA 2PTHA 2R7KA 3GU3A 4I4LA 1VJ1A 4YLEA 5KNDA 3D54D 2O7QA 2QP3A 4UXJA 4YUXA 3HYTA 3CRMA 5EWMB 4AJIA 2QRLA 3I3OA 5FPSA 3L49A 4WKNA 4WWHA 2JIRA 4KGXA 3WBFA 4IH1A 1XX6A 3NR2A 1M0SA 1LPPA 2IHBA 1RAHA 4Q3NA 4XOUA 4YCAA 5FFNA 5GJCA 4MYSA 3OO1A 4YCNA 3QUSA 1R5BA 4LNUA 2ZYSA 1LFAA 4EYQA 4CQMD 3DEJA 1NT2A 4KDFA 4LXQA 2DHCA 3KR1A 2PO5A 3O4FA 5DGCA 5ISMA 4QG7A 1DAHA 4BGEA 4C4PA 2F3TA 3OZIA 4L22A 3LDTA 5JDIC 3OFSA 3EZ9A 4LFBB 3LKDA 4CR6A 4WBNF 2UXCB 2G6BA 4B76A 1MNAA 2EYUA 2DGDA 2LWIA 3G79A 4FFVA 1O7JA 3NRCA 3RR2A 5BSKA 5HJ5A 1RW4A 4CMEA 1B23P 2A3NA 1HURA 1SEVA 4IZIA 2ATEA 2BEWB 2UZ1A 3O8OA 4YGYA 5EINA 3S6JA 4BLVA 3AETB 3K2IA 4J90A 1KYYA 4FFRA 1E2IA 4GKVA 3VISA 5IZ4A 5JMTA 6Q21A 4DTIA 1XZLA 1Z0JA 2A7QA 1NR5A 2A1UA 3OT5A 4TS9A 2VBGA 3MC1A 3A6LA 4RVOA 3RVNA 3U7RA 4MQEA 1UWCA 3PL5A 5J43A 3I0ZA 2PWAA 1HDZA 2AZMA 1PLKA 1XTQA 4HXGA 3DPUA 3NAZA 1SQSA 2V0NA 2XNCA 3FNFA 5JY6A 1GG9A 3KP1A 1W76A 3M6XA 3OJXA 4Y0AA 4ZDKA 1TEHA 1LBEA 1Q74A 3IOBA 5CRIA 1SXJD 4PPFA 1U3FA 1S2GA 2HIMA 2N46A 3MUNA 3UOWA 5AD1A 4CKWA 1QIEA 1E5XA 1F9EA 1KJQA 1QNLA 4ZOEA 3ZE1B 4ONEA 5TDHA 2D74A 1N5LA 2KMLA 5LZ2A 1U02A 3OKFA 4Q1CA 4K0KB 3ZZ1A 2V45A 2ACWA 4O1IA 2Q5QA 1QB8A 4RVDA 3WK9A 2AEEA 4EYOA 1U99A 3KJNA 4OFBA 2HF9A 3WDKA 1UADA 3D6HA 4HDMB 4OATA 3SZ3A 1VQOF 4ML3A 4HQNA 3CG6A 3UV3A 4CKYA 1KYVA 4N8EA 1BYUA 2OSVA 2QJRA 2X86A 1AUQA 1NLZA 2GZ2A 2GO7A 1W581 1E3LA 2BY4A 2A4KA 4OGKA 4X63A 1S72F 1NM5C 2QI9F 1Q0LA 1Z2CA 4AKTA 1WXQA 4UNQA 4CG1A 4AXXA 1ZNQO 1Q12A 1E8MA 1FNJA 2GZMA 1GITA 1WMAA 1V8DA 3IIJA 3K72B 4LZWA 1Y7LA 1C7ZA 2DERA 1JX6A 1FMCA 1XZKA 3A6KA 1A98A 2XKJE 3A3NA 4TKMA 5F98A 1N6HA 3QNMA 2ZBGA 1QZXA 1Q1GA 1RRFA 2QZJA 2WM8A 3DBHB 4FMDF 4P58A 1H6AA 2QRJA 3ZY6A 1SH7A 1MLDA 1KHTA 2XX3A 4HAIA 4GP6A 1E1LA 1ODLA 4JJ4A 4ALJA 2D1RA 2OV2A 4KXUA 1OLXA 2PU7A 2FG5A 1BEUB 1CJBA 4M37A 2R7LA 3MTGA 4S1PA 3HWSA 4GYWA 1C4WA 3QPVA 3UMCA 3ZPXA 3QNUA 1GZ6A 2FK7A 3GJ4A 4PX3A 2IYAA 2RC5A 2X15A 5IJWA 2WG2A 2OHGA 1XMXA 1JFFA 2GI4A 2RGYA 1Q1NA 2CMKA 3LOQA 3QWBA 4EGJA 5TE9A 5BMOA 1RLUA 2QG4A 3PKJA 5AVQA 3U4GA 1T4DA 3PUJA 2W8BA 3CZPA 4CFYA 1DX6A 3NRBA 2HA7A 4UEOA 3ROFA 4BUCA 1AKVA 3CY6A 4N0PA 5KYYB 2VJNA 5KQMA 3RK4A 2W43A 3PFWO 1SQ5A 3TLCA 1HSZA 1FU4A 5IKMA 2Y05A 3C6XA 3I0MA 3I01M 5C1IA 5HRCA 2YFYA 3ZCUA 1V48A 4WK2B 1BZYA 1OR8A 4M1EA 3VZRA 4YX9A 1NW4A 2VJMA 5CLHA 4YEDA 5EWJA 5BUCA 4BCDA 4AJ1A 1NMXA 2DT5A 2PGOA 3NONA 2QVYX 4OHVA 4QZVA 4BAUA 3M1AA 4KUHA 2A9OA 4YGXB 5F1OA 5TNXA 4CM1A 4E22A 1MQ9A 1SVWA 1ZOLA 2HMVA 5JRDS 4NICA 5SY6A 2V9ZA 2VDQB 5LA6B 1IM8A 1UFOA 4J9VA 2M6KA 3EH1A 4PCAA 5JANA 3D6NB 3ZWDA 1C3OB 4RY8A 3G0HA 3T0GA 3Q8HA 3LNTA 3MOGA 2HGZA 4CU2A 1MEJA 2QTVA 2WSYB 3AC0A 1VQ1A 1YQNA 2WF9A 4GECA 2HOQA 1QUFA 4BOYA 3ERCA 2EZ9A 4N3NA 3IB6A 3LT2A 4AIIA 1QG0A 4OREX 1ARZA 3PC4A 4TS1A 4K1LA 5REQA 3Q8KA 4HAWA 1X7XB 2AFIE 1JG7A 2O1WA 4ZIRB 2B61A 3VDQA 2O0HA 3GLGB 1S5PA 4MNTA 4OAQA 4BP9A 1E0KA 5DOZA 1J5PA 3KWLA 1ISJA 1L7AA 3VRHA 4YLYA 1W36B 3WK5A 5IZCA 2G8LA 2JLZA 3IYLW 1ZM9A 4YMWA 1E2PA 3R0PA 4A16A 1UJ5A 2C1XA 3RKRA 2HL6A 5C80A 3TWOA 3HDQA 4WBNB 2XYGA 1R00A 4CPDA 2RB5A 2Y67A 2I7VA 1QMPA 4UZEA 4EQ6A 1Q14A 3M3PA 5JD6A 2VAXA 2CF6A 4NU8X 3ADKA 3TW8A 3G0OA 2C2GA 4YHBA 2O9JA 5IC6A 2QD1A 3WGZA 3QFRA 4IEIA 3GDFA 2O8DA 1K7SN 4EYGA 5ALPA 2PZEA 2D1TA 2VDLB 2BDTA 3L4EA 3ZZUA 1YHYA 3URKA 1G3QA 2IFTA 1PVOA 3CEAA 1GPJA 1CK2A 1GPUA 3GUVA 3L77A 2AR0A 1WZEA 2YVUA 4ZQCB 4AUMA 1GGNA 4TMKA 2JFXA 1FYXA 2OORC 4HTFA 2QLJA 3S7ZA 1U1FA 4WHMA 1OXSC 3HU3A 3GLFB 4P54A 2J30A 3O4JA 2QTWB 2Z6QA 2LR0A 2POCA 4PBRA 1X2BA 2W2QA 2B9VA 4AJ9A 3Q5DA 4DLVA 3QEBZ 2Z8YM 3IEPA 4G0XA 2BEUA 4R8VA 5DGIA 4GZ5A 1AS0A 3BF8A 1XDUA 4IGKA 1K8YB 4J4HA 4EA9A 3KSDO 3PT5A 1W0JA 2FDRA 2R87A 4ZCTA 2JAWA 3TIVA 1CUYA 3OMXA 1B93A 1JB9A 2WIFA 3C70A 3CLTD 2O8BB 1NQTA 5LQSA 4C7KA 3BB4A 1KI2A 2H85A 3LPAA 4Q9DA 4I46A 5ECDA 1DTSA 4EFDA 5ELXA 5BSTA 2PSJA 5J47A 2I7XA 3NUZA 4LOLA 4N18A 2RGGA 5F51A 2YY7A 3VJLA 2Q3FA 4XI9A 2X2OA 2OHJA 3E23A 4JAVC 4L5JA 5CTJA 1ZS9A 3W9UA 3IUYA 2QTFA 1CB0A 4CBVA 3C8DA 5CT9A 5DI9A 3D4OA 3MJCA 1JHQA 3GQBA 3FFWA 1BQ4A 4KVZA 3ZXXA 3UAXA 5IT9A 5SZJA 3HSSA 3B8EA 1GPMA 1WXEA 4WCFA 3G9XA 3SR0A 4F60A 2H31A 5C8ZA 3ELUA 2DULA 2IHJA 2RONA 4FMDB 2FFHA 2W2KA 5WRFA 1ZKMA 1NATA 2UAGA 2BRUA 4O3FA 4PYOA 3K9FC 3U80A 1H23A 4EY3A 4LY9A 1J49A 2HKIA 3EBOA 3QLJA 2QM8A 1H6CA 3ROKA 4UHBA 4IIJA 3BWXA 1IXRC 2C98A 4JXKA 2W98A 4BNIA 4YFVA 2NQ8A 4L76A 3V7YA 5IT5A 5HS4A 3DTVD 1K4MA 5JR3A 2IZ7A 2QYOA 4ZHVA 3K70D 1IDN1 3Q8XB 1UK6A 4R40B 2BTOA 4J43A 3T1QA 1AJEA 1P1CA 4F8EA 1ZMBA 1QRUA 1E1MA 1GQOA 3GBVA 1J22A 3KQQA 4GYKA 2JCSA 5C4MA 5EMMA 3CE9A 3WMEA 1YIDA 2RJNA 2WSSD 3PGLA 1N8KA 1W47A 3E4CA 1C3LA 4X44A 5A4JA 4AKGA 3OA2A 1H8HA 4MW4A 1YHNA 2EGHA 4JUBA 1WQ1R 2QP9X 4NXMB 4F5DA 2DU8A 2WWRA 2ZJ2A 2XWBF 5DP1A 1X9GA 3GDWA 3L0YA 2AOTB 1NC1A 1P31A 4LJ6A 3LWVC 3EB9A 4CM8A 1BXKA 1K6XA 2HWUA 2R44A 5AVOA 4F72A 4F4FA 4Q7KA 3BM5A 3KXPA 4QFDA 3HKBB 1HYHA 1FFBA 1BFDA 1JLLA 1RQLA 4E6PA 3IQIX 4I4NA 5IAOA 2W2MA 2BM1A 3H1EA 3AR6A 2VWGA 1WOMA 4B3TB 1KJZA 3KXDA 4HX5A 4BLSA 1EK6A 3CX7A 4HWRA 4RA6A 3CVUA 4LRQA 2Y3IA 3PDIA 3R8XA 2FPGA 3CC4F 2A5JA 2HMSA 2AW3A 2C29D 3ASVA 4RKEA 1AA9A 2TSYB 5JS6A 1CJUC 2CK3A 5IM4F 5HE8A 5HCNA 3BSWA 1RBZA 4PC7A 1V5IA 2PS9A 5DHRA 4B85A 4ZRMA 3WL5A 1GYPA 5A6VA 2ES4A 5ALOA 2G4VA 3CC2F 3DVQX 4GM0A 4Y67A 1A3CA 4D2IA 2IS2A 3DR3A 4PG6A 2O05A 1RA4A 1VMAA 5IMSA 4CIAA 3BGIA 2PUFA 5FLKA 4PANA 5EXSA 1NYRA 5KNBH 1P2UA 3PPYA 3Q10A 4I5DA 1J25A 4HK4A 1RP7A 4IIHA 2V1UA 3DE3X 5I9LA 3AF5A 3SXJA 2WHPA 3KPWA 1UEIA 1KQPA 4IXWA 4TKUA 2HNKA 3OZEA 4MS1A 4BNFA 1VMEA 5IJ0A 4I1YA 1SZPA 1Z62A 3C6MA 4Q9NA 5HE9A 1RI1A 1RQ2A 1YOVB 4J4TA 1AK2A 4NJMA 1KYTA 1XMOB 3HJFA 3TSOA 3QHPA 3FCAA 2V1XA 2Z5VA 3JALA 3VR4A 3JQ7A 2JDID 4M88A 4B74A 5L45A 4C2UA 1JR6A 3F7TA 2X77A 1EGHA 1HMYA 3VIUA 5CB6A 1EBUA 1DZ3A 3N8HA 4NBWA 4C4YA 4COKA 4C78A 1EIWA 1EFTA 2CLLB 4HN4B 2DR0A 2WA2A 5KHLB 3MEQA 4KCGA 3WV4A 4EG8A 3OEHA 3PD7A 2F9MA 1RWKA 2ZG6A 1BGVA 4OQZA 4DB2A 2J0UA 3N2EA 2QVBA 2N42A 1BQ3A 4EPXA 1IXKA 3VXKA 3PIIA 1XEFA 5FNVA 5TVKA 3SKYA 2H16A 5AKJA 4IX1A 3FCEA 3VR3A 3GJ6A 1KDTA 4DLKA 1C1HA 1NKSA 1TEVA 1V37A 1EEXB 2O4CA 3D8UA 4N6OA 3EIFA 3PHIA 4PEVA 4X1OA 4YCCA 1EHYA 3INYA 3STWA 3K1AA 5FL7A 3U61B 3NVDA 2VT6A 3D4PA 2LE0A 4Y9UA 4A23A 4G5YA 1P44A 2EATA 3FGZA 5JROA 3C1UA 1J0DA 2IHKA 3RT1A 3NIFB 3B5IA 4KXWA 4NFHA 3GJ5A 1NAIA 1UP7A 1YR8A 4RQOA 3K9WA 1Y7PA 3MFYA 1TYEB 2IH4A 4N9QA 1SXQA 1E2GA 1AQLA 4M7WA 2C3PA 3RU3A 1ADCA 1WF3A 2ZR7A 1J33A 3DMYA 2YNMD 2HH9A 2R6HA 3T5PA 4ZJZA 5EYPA 1T9GR 3O6VA 5TSDA 2FRVA 2QPLA 4URXR 2Q8QA 3F9IA 2UXDB 2FWMX 5FUBA 1YR6A 1QHIA 2G17A 1ZM3A 2AMVA 1RYZA 2BHTA 1U3UA 1PQYA 2QN2A 3CKKA 3EXIB 3WC4A 4YONB 5BXQC 4FFNA 3A05A 1QG2A 3ORQA 3UVEA 1EG7A 4DDHA 5BRNA 3QU4A 4MV3A 1G17A 3JRXA 5ALNA 1H69A 1ILWA 3C8LA 4RQBA 2IDMA 1BXGB 5ETJA 4U7JA 4QBGB 3BDIA 3B2NA 3HSYA 4GVLA 4X7BA 3ROGA 2C5FA 1KHHA 3ET5A 1FLDA 4FN5A 3NVIB 1FX1A 2E1RA 2Z01A 2VHTA 1BDJA 2ZIFA 4WOCA 2QAGA 3GC6A 3WGQA 1WB4A 3E1YA 1WLSA 2GHTA 1PUXA 1N2OA 2W58A 2ZSUA 4EA8A 1Z47A 3E70C 3C4VA 3GJ0A 4RSHA 2X4DA 4HUQA 1AQIA 1TJPB 5D5HA 5H70A 4EMSA 2O5EA 2ECFA 1FW8A 1U1IA 4IDHA 3ILYA 2UYPA 1P6QA 5DNCA 5EB0A 2GCGA 2GYYA 3PJFA 5AW0A 4PGFA 2VAMA 4ARZA 1OAPA 2B6HA 2BELA 2Z83A 2HXGA 5DNAA 3NM6B 5IJAA 3UM9A 2C00A 1UMCA 3IHTA 4BQSA 3MFQA 1E1DA 1EVJA 5C8YF 3Q2OA 1U28A 3W9SA 1ZDMA 5K0EA 1VMDA 3DE2X 1SVOA 5AVSA 3CKYA 2E4YA 1GXSB 2GVZC 1P5HA 4C5BA 2VKTA 5FA5A 2LP4Y 1OPRA 4WH0A 4LYJA 1IEXA 3CBGA 3THOA 1KR5A 1X86B 1J9EA 4NG5A 1Z7GA 3DVLA 4EHFA 8MHTA 3KQSA 1MJ5A 1ILEA 1ONBA 3QMWA 5B3JA 3RA5A 4ZEWA 3PLAE 5JS1A 2FN4A 1KZ4A 3V6MA 1GILA 3KWJA 1COWD 5JAUA 3NS7A 4M1ZA 2X9QA 2W00A 3AUAA 1LI7A 1N9GB 5EWMA 4LXIA 4Q03A 1CIVA 1Y4UA 2ZTUA 5I9BA 1E1QA 2A57A 4IMPA 4R3NA 4BU0A 4EGSA 3F7MA 1QH0A 4FFDA 2LDXA 3HUFA 1JW9B 1HNNA 3TDKA 4FOLA 4GBED 4P32A 2FK8A 5FLYA 4OYYA 1Q50A 3BWEA 3HFSA 1MVOA 3I28A 4JP5A 1U0HC 2BL4A 3LG2A 4EB8A 3NCHA 2EF1A 3EQ6A 2YMQA 4TM8A 1YZLA 5TGDA 4RU1A 3HN2A 4CYMA 5I7UA 4B3SB 1VLVA 1IUOA 4TVBA 4QJIA 3OCUA 1G42A 4AF7A 3LWQC 1OT3A 3EA4A 3JWHA 4NFSA 1R9JA 4PSDA 3JD3A 2Q6OA 3U16A 1PZMA 3GDHA 3LPNA 1XZNA 2IIBA 2BPOA 4TTRA 4E2XA 2WW8A 1UANA 4CMAA 5BVHA 4HATA 3FOAA 1JTVA 2BEWA 4PRLA 2PXAA 4C81A 3CNLA 3AETA 3E53A 3HJHA 3LT5A 1R2QA 2RHGB 5AJUA 4IV5A 3LD9A 4ECAA 5ADHA 1BTOA 1VJDA 2BMJA 1MJHA 1B2LA 3AXTA 2UUAB 3SBEA 3QX7A 3I6BA 2HSEA 4C4WC 4QTZA 3O7WA 4AKSA 4EGAA 3PWZA 2HADA 3ZEAA 4DB4A 2IS6A 1ONIA 1BCRB 2BFDA 4GHWA 1GO2A 2H57A 4HNSA 4O2BF 5LBIA 3SHVA 3V3KA 1X70A 1QRDA 4TXLA 5A02A 4KBFA 2XCRB 2IX9A 4L73A 3SOZA 4DLRA 4HB4A 1ZPDA 1XDSA 3UK0A 1GR1A 4BWFB 3BS4A 1U8CB 1Z06A 3K0FA 1TMKA 5LKAA 1SRRA 1XNJA 4ZP1A 5EHNA 1R6TA 3O26A 2IXAA 1TMOA 4MMXB 4YTEA 1NVFA 2E82A 1NV9A 3GGDA 2CVHA 4Q1FA 4WDQA 4XTCS 4YRFA 1D6NA 4C0HA 3GLHB 3AR3A 2OLJA 4IDQA 4BBAA 4XVRA 1K0FA 2P9HA 3M5CA 4ZHQA 3HA3A 2EKLA 4JJFA 5CAEA 2ZZKA 2ZAGA 4B43A 4CR8A 4HP8A 4X8HA 3PV0A 3JD2A 3EGCA 1KJ9A 2JK0A 4A5SA 1KH2A 6LDHA 2AIRA 2W6JD 4JLKA 3AF3A 3LW7A 1G2PA 3C3KA 3KYDB 4NKRA 4UW9A 3T3GA 1V5GA 5JYCA 5GZ1A 3LOPA 4MHOA 1NHWA 2CYAA 3F5MA 3FD5A 3H97A 4B9AA 4DC0A 3LBYA 2OGWA 1SGWA 3DBHA 3FG9A 4GOKA 3UY4A 1NW5A 3EUFA 2XGGA 5JY1A 3O82A 1W2GA 3MMSA 2AH5A 1JSRA 2H1LA 1EG2A 3FMVA 3FNGA 4CHTA 4J0KA 1QYDA 4XCVA 2QN3A 5ENVA 2H11A 4MK4A 4NP6A 2DXIA 4C8GA 1E9RA 3LA6A 4HGQA 2YS6A 4LCJA 2YY6A 3U4IA 4M49A 5ER9A 1GG5A 3OPQA 4O2AF 4ZV4A 1VPEA 4RZIA 2V65A 1ZVJA 2ODQA 2ZWAA 2VZ8A 1HH4A 2HS0A 4RLQA 2F55A 4G5XA 4TT3D 3BHIA 5B2ZA 5EAZA 1SXGA 3RK0A 4JEMA 2L42A 4KE9A 4C4XA 3WJRA 1IM2A 1Z2AA 1ORHA 4EI9A 3AM3A 3SYTA 3F6PA 3LX6A 1ZUWA 1DOHA 3A25A 2WOJA 3WE7A 5KYYA 4HDOB 2DTXA 1HC7A 2HZBA 2ZR9A 3KTAB 1UAAA 4JUIA 4OQDA 1HE5A 1YVEI 3OZTA 3UG7A 4INAA 3LQYA 3FYUC 4QKQA 5C8YB 5KJEA 3UT5A 3EVTA 1FTWA 4ZXFA 3L18A 4FR0A 1U0EA 1ZGZA 2AKAB 2BBWA 1W0CA 2QTCA 3U0VA 4LXYA 5EUBA 2HQBA 3ZW9A 4DV5B 1U3CA 4UMFA 2JGDA 3CZMA 1OPXA 2P30A 1OI4A 4ED9A 5CDSA 2IYXA 1RJFA 1Z4PX 2ZTVA 3CLUC 4LC9A 4AL4A 3QI7A 5TMPA 1V7ZA 5GOZA 2XQVA 2EP5A 4O8ZA 4MITA 4PPQA 4ZVPA 5TARA 4Q39A 2QW8A 5LA6A 1OAAA 2QT1A 3MVEA 3QE0A 3TBFA 3VC2A 2Q9BA 5JS7A 1TVKB 4JOSA 1G8PA 2Q27A 3V8VA 4AICA 1ISMA 1IDOA 3Q40A 1VKHA 2B4TO 1NQAO 4OO3A 1ZVQA 4JT4A 4M55A 3OTGA 1UBMS 2VEOA 1E99A 5LXTF 2XXAB 3K31A 3R5HA 5HIJA 3RC9A 4F06A 3R74A 2ZT7A 2HY7A 5AW9A 1LD3A 1P0QA 3WBKA 3X1YA 3CVVA 3FFAA 3H0CA 1LPOA 3GGPA 2CV2A 3JZDA 4ZKEA 3HDHA 3DM9B 2P6MA 4E4TA 2PSDA 2H1HA 4FYXA 5IAKA 1YBHA 2AQKA 5HZHA 3QWHA 1XZPA 4H18A 5AMXA 3CR3C 5J1TB 4JLDA 1N2SA 4WBNA 1QRTA 1CQXA 3BCUA 2DCMA 1LS6A 1EJBA 1MNQA 3G9UA 1E4EB 1EGVB 4YJ2B 1S3IA 4O59O 3DLIA 1I3CA 3ZHOA 3ZY5A 1JFSA 3KSRA 4H31A 2QYSA 1C0PA 2RGBA 2P35A 4FNOA 3D59A 4QC2A 5KNDD 3WGMA 1FRVA 4MAAA 2QSJA 3WRWA 3GUUA 5DJ5A 3V1TC 2QAJA 5JCOC 4P4TA 4AJEA 1XTRA 4BO8A 2D5AA 2XUGA 3DEKA 1BX3A 3IPRA 4MWEA 4O2BB 4BL5A 3GFGA 1K92A 5JSZB 2PGDA 1AT1A 3ICEA 3ZJ5A 1U0BB 4F4JA 2ACEA 1RCFA 2IJGX 4DUGA 3ON1A 4WE3A 2A1TS 2WG1A 4ZQBA 5HJEA 1CY2A 5EPOA 2VJOA 3AIOA 4QTYA 1JEYB 5B5SA 4H1WA 3KJKA 2Z4TA 4LWZA 2NZ2A 3L6CA 4C1NA 3CNBA 3TSCA 3FSEA 4EAAA 4PAQA 2Q0HA 4QOJA 1N6PA 2PZJA 1G5FA 2ALEA 1E96A 1X7DA 2BFCB 3M1LA 1VCHA 2UU9B 4FCCA 1U2GA 5CLGA 1RPAA 3C48A 2JI7A 4L8FA 3HU1A 1HT3A 1R4MB 3UPUA 1YCDA 4LCKA 1Z9BA 1ZU5A 5ARBA 4ZK6A 3U56A 1S2LA 2VF8A 3AP2A 4L57A 5D84A 4ID3A 1F3OA 3CUVA 4B32A 1NMQA 4OA8A 1L5GB 4ZI2A 1YQQA 4LHZA 1YFZA 3KC2A 1K6MA 3O0TA 2ZJOA 1SM4A 3KFVA 2KG4A 4PLPA 2UYQA 3H0KA 4Y2SA 5F4BA 2FEPA 4LZNA 2DPMA 1YQWA 4I8DA 1W5FA 1RXSA 2YL2A 4NCXA 2IBMA 1DT9A 5B57C 3RSHA 2ZBVA 3Q3JB 2I76A 1JT9A 4R68A 5CJJA 3T3HA 4QASA 3M82A 3V8NA 3ZH9B 1PT5A 5C1BA 1TGYA 2XSZD 3M8KA 5K6RA 3R76A 3TEMA 3NDBB 2PUCA 3BG5A 3WLHA 3JVDA 3I1IA 3TLGB 1C0EA 2OKCA 2XDYA 4GRIA 4OEHA 1KEPA 3WMXA 4O2AB 3VH2A 5IDYA 1KBQA 3AHEA 4HQLA 4UVIA 1A9ZA 5IH7A 5FJIA 4Z7JA 5KKCA 3FWHA 4RHAA 1MZVA 3BRCA 1SXJC 4R40A 1UKBA 3TXYA 2QTPA 5AI5A 1BN6A 1F8GA 2QRPA 1CQJB 1Z25A 2WF7A 3CNHA 2EGUA 4MA4A 2W2LA 4ZT7A 4YXWA 1DBRA 3YASA 1B1CA 5JI2E 5JT1A 3SIWA 1RRCA 4JI5B 3EHDA 2AWNA 4LX0A 3G1TA 1PEYA 4JI3B 3QBJA 4ERHA 3RSQA 4CKEB 2PWPA 3P20A 5LQNA 4QLOA 2FX5A 1SBCA 1V4BA 4D79A 5DW3A 4IKOA 4Z4GA 1JAHA 1O6ZA 4PIMA 4ZQIA 1E0SA 1N8SA 1Z88A 3VUEA 3ZHZA 1TT5B 3OCZA 3MA0A 5CVJA 1E3EA 3CEHA 1DLIA 3UJPA 2K2QB 5BSFA 2OA0A 3ZVKA 2F3PA 4FLEA 4JS0A 4OQEA 3HKBA 1ZN8A 2AMFA 3DZFA 4ZPXA 3WNBA 3ZVRA 1TJ3A 1WXXA 2BLNA 3T06B 5BW5A 1QIFA 1XRRA 5KNBD 4F8YA 4FMPA 1WO8A 2QE7A 1Q7GA 5EJ8A 1G3IA 3OWXA 3KHNA 1B0AA 4QEDA 1KAMA 3W4KA 4URZR 2PNFA 2EX1A 3AU9A 4NDAA 2YJTD 2FA9A 1T2AA 2SKEA 4OXXA 2EZTA 4RW0A 4C7OB 4UAUA 2VPTA 4B17A 4E1VA 5MN4A 1ISSA 3W79A 1KNQA 1VQ5F 1K7YA 3EULA 5LXTB 3W6UA 1L9KA 4AN1A 3LVQE 3RANA 5CXUA 1QG4A 3WK4A 3FPSA 3ZO8A 1ULAA 2PGIA 3BT7A 3F0DA 3CX3A 3T9CA 1R4AA 4F4IA 2GYUA 3GPIA 2DZDA 3PD1A 4I2VA 3TD4A 1Q44A 3EFOB 5ALUA 3TKYA 1HDYA 3OM0A 2L2QA 3RTDA 2BKEA 2P1DA 1N2JA 1XAIA 2XUPA 1JKMA 2QORA 2VK8A 2OKGA 3WGKA 5E1DA 3SEFA 3OBYA 3F67A 4NQRA 1BE0A 4MI3A 1AXGA 1OBOA 1VB5A 4ENPA 3H11A 3HWX1 3SU8A 3W5IA 2F1IA 1ZIPA 1E3QA 1YOVA 3AL3A 2NMVA 2FPPB 1SN7A 2WA1A 1VQVA 1CY4A 1T4CA 3FMOB 4AMYA 1Z2DA 2ARKA 3I76A 4RDCA 4QTXA 1DEXA 3RA6A 4ERNA 2P75A 3BE6A 3JZFA 3IPLA 4A3SA 3B3GA 4DCNA 3LRXA 1EWTA 3DOEA 4TRNA 1YL7A 1A9XA 1M2GA 3OCYA 3ZE7A 3PDHA 2OY0A 1QH8A 1RYEA 4Y6OA 5HTKA 1RLIA 2ZQZA 1N7HA 1E58A 2IZ6A 2YRXA 4IJWA 1DKQA 3OIGA 8ATCA 4NUTA 5HGXA 1H8EA 1CEYA 4EENA 4LTNA 3HB9A 1K4YA 1J2YA 3RIXA 1WHTB 4LJ9A 3WKEA 1QK4A 2C9YA 1DRWA 2P68A 2WUDA 1QXSA 3KPUA 1X1AA 3NRJA 1TYAE 4HNQA 3UH0A 4DCJA 4I1SA 1FJ2A 1SVUA 2I8LA 3G9QA 4O1HA 1DBWA 1W87A 4K86A 3EZLA 3VU8A 5BUSA 3S8EA 3FNBA 3IOEA 4D02A 1Q15A 4J3NA 4CM3A 1Y8AA 3AF4A 4YAOA 3K71B 3AVOA 2HJVA 4M46A 3WWEA 3ESDA 1PR3A 2CLEB 1P5ZB 1FJHA 5M2QA 3HY4A 1EDEA 1U63A 1T8SA 1ZOSA 1YDGA 1JIUA 1F1JA 5F73A 3BRQA 3OUZA 4Z3KA 4LV8B 4FZJA 3ZGYA 2PS0A 2QMOA 3SM9A 5BYAA 1X80B 5I7HA 1RADA 3I34X 1FFGA 5EIXA 5E6UB 2V7XA 5KPDA 2I4RA 1S2DA 4XPIB 1U3DA 3DB2A 1IIRA 3ROXA 4OJTA 3GAZA 4ARSA 3NTRA 3PR1A 3NHUA 2QTRA 5AM0A 3DCNA 2OL4A 4KXYA 1U4OA 3WYAA 3D6AA 1EVLA 5JMOA 3L0ZA 3UMYA 1OXMA 1UXKA 4OYLA 4YWJA 3BAZA 1NP3A 3Q2KA 4ZOBA 3GNLA 4PLTA 1YB7A 2PBRA 3PJDA 4EPTA 1T5DX 2XDWA 5JQGB 1OI2A 4I5GA 2O2SA 2Z2XA 5BNTA 1GGJA 1DJQA 3G3EA 3GUZA 1JKFA 1BW9B 1G18A 5JYDA 3H5TA 1BG6A 5JH7F 1G8FA 1W0JD 2GZRA 3KE8A 4M0FA 4UOQA 2GEUA 4RULA 1BXGA 1ZK0A 1KMMA 3C5CA 2VWQA 1Z6PA 4NV1A 3DMRA 5B6JA 5GV8A 3R1IA 5E7JA 2RMKA 5FA8A 1SBQA 2X5NA 1SUWA 2X8LA 3I9FA 2WD9A 2XKBA 4KX5A 4DJFC 1QVAA 5HQ3A 1ST3A 2GK6A 4FXOA 1AK1A 1SCJA 3W7VA 3K9CA 3S1SA 3V8QA 1ND5A 1NLUA 1YJBA 1CRQA 2QJFA 3AHJA 2VDPB 2ZIVB 4YRGA 2FZLA 2J9FB 2PMKA 2IUTA 1EUZA 1UINA 1Z6AA 4IRMA 1YR1A 4HXEB 4NBVA 5KC9A 1KSHA 4IO1A 3HB1A 4UTZA 4HNAA 4WFKA 5HUJA 2PLWA 3OICA 4D8VA 3CLTC 3GFPA 3N75A 5EI5A 4TZTA 4RL6A 4NCKA 4UE2A 5LR6A 3CWZA 3SY8A 3NDRA 1M2VA 1PNTA 1U3VA 3FUXA 5IP5A 1DPFA 2V6JA 1I3OA 3GEHA 1ZYUA 3FUCA 4N3BA 1YR3A 3OD1A 2Z1MA 3FCOA 3EWIA 3I45A 1NR1A 1ZONA 2R6CA 5G3ZA 3S55A 1H2XA 2J09A 3TBHA 5DYNA 3ZWYA 3IKTA 4KR6A 5BMVF 2J6IA 3ZCXA 5I4CA 1E2LA 1X52A 1OXXK 2HSJA 2WICA 1NOIA 3MJSA 5HHTA 4DGQA 4XSVA 4HV4A 1GXSA 4KNWA 5FNZA 4CEJB 2PR2A 1PF5A 3AY0A 3NHRA 3R4VA 4HQOA 4QDKA 5JE8A 2X23A 2FZWA 2V0GA 3G4SF 2OBBA 4EHNA 1NI3A 3HJRA 2GJ8A 4EKDA 2KTVA 3AJDA 4AW9A 3HU5A 3C3AA 1OUMA 2CZCA 4MO2A 4RGYA 3T15A 4V0KA 5G53C 3MMNA 5AW8A 3IE1A 4KRFA 2EJUA 5CGQB 2Q0QA 1V9SA 3IQEA 1UZUA 3CX4A 1MOQA 3JR7A 3LUDA 2EC5A 4RIIA 3E5MA 2HZ7A 5KCZA 3R0JA 5JW6A 2AL7A 1C0LA 1JDPA 2J3IA 3B1FA 3P19A 4EFMA 3U1BA 4F4DA 4I4TF 1PD0A 1UXGA 3OHMA 1G2QA 4OKIA 5I4KA 3K70C 4MRMB 1QCYA 2CBGA 1YJAA 1E8DA 2IDKA 4KO8A 2AE1A 3DDWA 3GDGA 1ULSA 4P7GA 2FAXA 1VCIA 1XOIA 2UZ0A 2OECA 4WAUA 2QENA 2ZVDA 2BGMA 1V9LA 2C3YA 3QVKA 3U3JA 3WYDA 4AM8A 4FOOA 4DJAA 4A82A 4JSRA 3ZOZA 1MXHA 1YJCA 2HWXA 4JMLA 4BNVA 2F9FA 3MUOA 1CZOA 4G4SP 4EKEA 1KJNA 4JJIA 1FUEA 1RP1A 3GA0A 6REQB 1NOJA 2WAMA 3ZBUA 4Z86A 4YRPA 3ZOPA 3LMEA 4W99A 2Q4RA 3TCNA 3OE4A 4FE4A 3FR8A 3W3AD 1A8PA 1I01A 1JXQA 1OGJA 2BKVA 1KI8A 2I2XB 1J5XA 2WE7A 2WJVA 3BBPA 3ED5A 2GM3A 3AKEA 2CXRA 1RRMA 3H9QA 4KE7A 5ERGB 5AW5A 4UHDA 3TTVA 1U1GA 2ZIGA 5DHFA 5EA2A 3CCVF 1VXRA 5TMDA 5HY0A 3S03A 1DC4A 2OHFA 4C8IA 1M34E 1S9HA 1VG9B 2H2AA 2PM8A 4GX1A 4MO9A 4W8GA 4BX9A 4F96A 1RHKA 2ZLBA 3LI2A 1X0XA 3CISA 5BSVA 3EWSA 3PI6A 3I5UA 3S8YA 3HYRA 2A5DA 2A9PA 4K6KA 3QP9A 3BQNB 1E2MA 3B5EA 3S2EA 4BRUA 3KKKA 3RPEA 4O4LF 5B36A 3NC1C 1EK5A 1LUAA 4ZEMA 1JZSA 2ZJ5A 4EO4A 1JS1X 3JARB 3NWJA 3TSYA 5KPJA 1NQ5A 4F6RB 5DHPA 4PFKA 4QJ3A 1Z7WA 1UWKA 4WFJA 5C5EA 4BEWA 4GRDA 4W5RA 2BFMA 1IWBB 3L4SO 4MW2A 3K8OE 2RBEA 1J2JA 4HLNA 4B3HA 4DCSA 4YCLA 4URWR 4CT5A 4KDCA 1CZRA 3U1VA 2BFAA 5AVUA 1KWKA 3MTJA 3U5ZB 4NNJA 4U1RA 4NYMR 1QM5A 3PQ5A 1T1IA 2FHSA 5H3CA 1H42A 4D56A 4RTLA 3B3QA 4N54A 5JNVA 2I9KA 1V35A 1JVNA 1ZOIA 2FPRA 4I5FA 3WB1A 5A4FS 5LYJF 3GCDA 7AT1A 3HPRA 4QICA 2HYIC 1EVZA 2IXDA 1Y1RA 2JCYA 1CRZA 1W96A 3AF0A 1Z68A 3G6KA 5FBHA 5KOHB 5JCPA 3DYVA 3BJEA 3KYDA 4V0OA 1N7JA 1R5NA 1PQWA 5K0JA 3VKHA 2EQBA 3AYZB 3OJEA 4KRYA 5DT2A 2A1IA 4UFNA 3EIOA 4V38A 1JF8A 2ANBA 3WQHA 5A2GA 2GRUA 3TTXA 3RK1A 1Y3AA 2NU7B 4KQHA 3ONWA 1T25A 3LRPA 4KYTA 5HJ2A 1U40A 1I0IA 5CG2A 1JR4A 2L19A 4RPIA 3I2YX 4GL2A 1W5SA 2GTIA 5ESWA 2E21A 3AU8A 4PLWA 2QPOA 3ICCA 1NWCA 4K6CA 2GEKA 4GWLA 2WIAA 3DP7A 2WUWE 1SCDA 3AM4A 3U4AA 5FPTA 3ABIA 4BKQA 4LA4A 4E09A 4YUAA 1ZWLA 2D3WA 3DEFA 3ENNA 2C9MA 5IEBA 2BFFB 3P0JA 4TMYA 5BW6B 3C3CA 1Z6GA 5FF9A 1LVHA 2FUG1 1TW2A 4A8JC 1EDOA 4JC4A 4EUSA 5LD2C 3EPHA 4OUDB 2JL1A 1I0ZA 3SVZA 2QLNA 2UYHA 3RFCA 3BZBA 4P5EA 1FUUA 4KPYA 1AGPA 1V1RA 3KTAA 3RI3A 3PZBA 2XZLA 4XYGA 3QXSA 2QROA 4HGZA 5F2EA 3WRXA 3KG2A 5J2TF 4EFKA 2ZKLA 1QE0A 5E6RB 5EKXA 3N2YA 5BMVB 5BQXA 3PFBA 4GOLD 1FFEA 3N76A 4JFAA 1HT0A 3CPEA 2HU2A 3RVKA 2BDEA 3FOEC 4Q4LA 2F1KA 4DEXA 1FDUA 2PT9A 1I1HA 3DGEC 2WSBA 2JJ2D 2QUZA 4KSBA 3JD1A 2B3TA 3VNRA 1KYWA 1UMDB 3KJEA 4XD7A 3SC6A 3CF0A 3WA7A 1TVKA 1C1XB 5HJ7A 3JQGB 2ID7A 3R6LA 1MKYA 3N74A 3BWCA 4MVJF 1VHLA 4UM8B 4OD0A 3QH4A 4HLUA 3ZWNA 4GMXA 1E1RA 1JFVA 2O0LA 4QE3A 4FI3C 3SC2B 4E4YA 4R3WA 1L5LA 1VDMA 4HEQA 2VPXA 3Q7TA 4I4TB 1I1OA 2GPWA 4PWTA 3GJQA 3KVVA 1PK9A 5J1SB 2CJPA 2ONKA 1MB0A 4A15A 4KPFC 4MAMA 1U2DA 4NBTA 4Z9AA 3T3IA 1W4LA 3GJXC 4ZDIA 2GBLC 2IE0A 2YN2A 4N0QA 2DYYA 1G2OA 2GLXA 3VTFA 2PJZA 5HRAA 1ECBA 1ZQ9A 2QR2A 3LFOA 3ND6A 1G38A 4LOHA 4CNQA 1UJNA 3M6FA 5HNKA 1HFKA 3DXYA 4E7OA 2Q7DA 2M1XA 1R6XA 2JFYA 4DV1B 3KB2A 2BE9A 4WASA 3VZQA 4YJ2A 3CYFA 2W6OA 1CSEE 1YR2A 2RDMA 2XOEA 1P3Y1 221PA 3ELWA 2MQEA 3QQPA 3VNQA 1PEAA 1J20A 2I99A 2X3UA 4RS3A 3PQDA 5DV9A 4F5EA 4YCSA 1OTHA 1KRXA 2ZCVA 1R9MA 4R1NA 5EZYF 2YC4C 2NTYC 4TKVA 4DYVA 2Y1EA 1OJ7A 2JG3A 4G1UC 1TK3A 2WYVA 4QU0A 1CT9A 1CB7A 1WCXA 4CLOB 4YAIA 4M98A 5JNTA 1OFTA 5I9SA 1M2JA 2R66A 3C2QA 1ADYA 4KXFB 2HK8A 1QE3A 5KYKA 4O2BA 2ATCA 2P65A 4IWXA 4TXMA 5FHRA 2CHQA 3LFTA 2GEDA 4O4LB 1TRKA 1D9ZA 1RZRD 4K3VA 3OPVA 1WKVA 3K9QO 4XUCA 2WKWA 4V39A 1S2NA 3GUHA 4EOGA 5BOSB 2IW3A 2JVIA 4JLPA 1JEYA 2Z9CA 5LQKA 1MB9A 5DX1A 5JDCC 1KS2A 2ZAOA 4RK4A 1L5HA 5BORA 1N0UA 2IV7A 2WJHA 5C32A 1SCIA 3QHQA 4TX1A 1Q11A 4WKOA 3F49S 1E6CA 3A3YA 3FJOA 5CK4A 2VJPA 3S1AA 3K0AB 4Z3DA 4NK4A 4KIGA 4A10A 5K2MA 7REQB 4N0MA 3R3ZA 1C1YA 4IMIB 1GNPA 5LYJB 1HORA 2DQKA 2MMGA 3GG2A 3K7EA 4JIGA 4AJ4A 3A58B 3R9XA 2C9ZA 3TNLA 1K8QA 4MRVA 2ZIZA 2VSNA 1X1DA 1XN4A 3G5LA 4URUR 4C6TA 3QSYA 2HHLA 1MV8A 3CCFA 3OOJA 4G4SO 5HKLA 3ROZA 3TR5A 4S2UA 2LZ0A 1NBWB 1MDFA 1SOUA 3SBXA 1SKYB 2IE8A 1ZQ1A 2HI0A 5I3ZA 4BX0A 1KJJA 3SIPA 2A5LA 4D9MA 2DPYA 1R27A 4NJEB 3BWYA 3G2NA 3TLGA 3ER8A 2JEOA 4FOSA 3OOEA 4RD6A 2C8VA 5DPMA 2YJGA 1TZJA 4O2AA 2AS0A 2XLBA 1A9RA 1WB9A 5K09A 1AS3A 5TMEA 3Q8LA 1EWKA 4RMGA 1OGIA 3TEJA 3VPCA 3WAKA 1LPBB 4NCJA 1CQJA 4JCOA 4UM9B 2ONJA 4QGGA 3KRTA 1WSWA 3C3XA 2ADMA 1UIRA 2Q3JA 2H63A 3KPYA 4W4TA 3FPGA 5CT8A 3VKVA 4TYPA 4AO8A 1XZ8A 1B0PA 4C4SA 2CB0A 3REFA 3MTQA 1Y81A 2HRYA 3V1LA 3WGOA 4CKEA 4JGIA 5ERYA 5K3SA 3DVAB 5J2TB 5AVKA 2MJLA 2XUDA 4OMDA 1DG3A 5ALQA 1GCUA 3ZKAA 1PR6A 1T36B 4QXMA 3W2IA 1MX3A 3GPCA 1H5QA 3IBSA 3QVOA 2YMPA 1M7HA 1YI2F 3IV6A 4AQYB 1TT5A 4YDRA 3D7MA 4YP1A 1W3EX 2IDJA 4G5FA 5DCUA 3DW1X 5FBVB 5ABPA 4HS9A 4XWOA 3GO4A 5EE5B 5G1NA 1DV2A 3DXZA 3F97A 4ARIA 1NBAA 4F92B 1KTVA 5COAA 3LVFO 4QUDA 3NHFA 4RACA 4RIHA 1CRLA 1R37A 1H65A 3A70A 1N2XA 3KKQA 4BAGA 1V45E 1O2DA 4UQLA 1HOXA 1ORRA 1PW7A 2XGOA 5AI4A 1C9KA 1KEUA 2E5WA 2X14A 2PEYA 4Q24A 2FPSA 4IIXA 1DRKA 1JHPA 4AMUA 3F6CA 3DOFA 4ZHSA 4C7OA 1I30A 1RLGA 1ODCA 1STOA 2HLPA 3FUTA 3HL4A 3WOHA 2LBWA 2ZSIA 1VSBA 2J3EA 3Q3HA 1N0WA 3IOMA 4NS4A 2I4LA 1JJIA 1K9MH 3CD6F 3I9KA 3LUPA 3EQ9A 3PNOA 1LLDA 4ITRC 1UFQA 3GAAA 2V55B 5F77A 4F7WA 2C61A 3P0EA 2IUFA 1E9AA 1G8MA 3G0GA 3IVRA 4LYDA 4O5OA 1BDHA 5JQWA 1WW3A 1TPYA 3BL5A 3QU9A 4D8XA 1YDWA 5ADWA 2OK7A 1JLRA 3EFOA 2YRFA 3JWJA 3GY0A 1GTMA 4GVXA 1UJMA 3DZHA 2UYCA 3AY7A 3FYCA 3PDWA 2Y66A 4DIDA 1I8TA 1NVEA 1YOBA 1D1QA 3K05A 3TLMA 2NUPB 2FDCA 3DBIA 3I42A 1C4KA 4L08A 5TPZA 3TOCA 3I8XA 2FUEA 3HCEA 3IJRA 2FPPA 1Z3CA 5EIWA 2ZE5A 3GEPA 3FFXA 3N9IA 2RJOA 3PHJA 3RS2A 3CRW1 3X1WA 2ODTX 1O9GA 4BO3A 1R6DA 3CWQA 5CDUA 4IWNA 3R41A 5F2KA 3ZWWA 2WF8A 2GJSA 3G2OA 4ZVOA 1AO0A 2Q3CA 1PVVA 2QW0X 5EMKA 4LBYA 3GJ7A 4WX2B 4E51A 4FBMA 3B7PA 4BFVA 1IFXA 1QP4A 4YI3A 3SJ7A 1Q7BA 4DCUA 4OI4A 1W85B 2QMHA 3I5YA 5TRTA 1ZUHA 1IJEA 1FTQA 1NRIA 5LWQA 5FX2A 1GDDA 2FPLA 4QUJA 3S1LA 3S27A 1WHTA 4I9FA 3LW8A 4TLDA 4CCYA 2O6HA 5MFPA 4M8SA 1MAAA 1W94A 3BL6A 2ORYA 4ZYYA 1JLSA 3EDCA 4PVCA 4F93B 4ME6A 2JCVA 2CUTA 1WDKA 1S8AA 2IF0A 3WLNA 3L8DA 4Y9DA 3BAFA 1IRXA 3BD6A 3OZDA 4QDUA 2KPOA 3HR4A 1C4OA 3C39A 3AR5A 1XTUA 3KSMA 3TLKA 3KHSA 4U3JB 1WEHA 1D5WA 1TA9A 5IUKC 3V48A 1R9GA 4IVRA 3OLCX 2P5YA 2E6KA 4GBJA 1P29A 4REQB 4HQKA 1KMIY 3T94A 2HCJB 4BLTA 3J80A 1KOJA 5ALEA 2CXNA 2HP3A 2LCFA 3A1FA 1XNHA 3NAMA 3R3HA 2ZAMA 2GESA 2PRKA 1FY2A 1Z35A 1RWOA 4FNAA 4HQRA 1GSIA 5E1BA 4DEVA 2E87A 4ZWNA 4MINA 3EAQA 1EUCB 4OP1A 4X6LA 2ZJ0A 2LKDA 5MF6A 3SFVA 1D0VA 1Z36A 2AVDA 2C4MA 3WDMA 2EBWA 2EERA 2C2WA 3FPEA 3G1WA 4J7UA 1Z37A 2ERYA 2NZJA 3CT4A 3V34A 4IINA 3BWVA 3AUSA 4C8EA 1W46A 2H06A 2NIPA 3ENKA 4PSVA 4U6SA 5JQGA 1Q7EA 4BNNA 4BGIA 2DWCA 5AW6A 1A8IA 4OHYA 4KR0A 4MUHA 4FT2A 4BO9A 1P5FA 1BW9A 1FTSA 1V2GA 3F0EA 1W55A 1WY7A 2G04A 5DCYA 1JP7A 2Y1CA 5LOVB 1JNYA 2J5BA 4R9RA 4B40A 3EJ6A 4RABA 2HYDA 5G0TA 3CSSA 3P71T 1TKRA 2P9EA 3IPCA 1M76A 2GHIA 3DLAA 4WKBA 2CHGA 1RI5A 1KS9A 1YKFA 3MK31 2CNLA 4HWPA 3MM4A 4MV4A 3ORSA 4R2WA 5DGHA 1FYDA 4KTTE 4MLCA 1LQUA 3MS7A 4A6XA 5CFQA 3BQMB 1WUKS 2Y76A 4G86A 4GH5A 2QX8A 3NQ41 5LC1A 5F9MA 1LNQA 2BBTA 2WOOA 3Q9UA 3M9WA 3AIKA 1AKUA 1NBEA 1NVMB 5K45A 1BU5A 4LISA 3IT2A 1T4MA 4W1PA 2H2GA 1EGQA 2H8GA 4L4YA 3U09A 2A0KA 1OE0A 3DWGA 5KDLA 4D43A 1JU4A 1CKEA 3AQ4A 3QU2A 4QBTA 5FA6A 1UPBA 5L9AA 4EHLA 3U4QB 1B6SA 2P2CA 4N7BA 1NFQA 2FR8C 3FKSA 1BVUA 1U3GA 4BX2A 3C85A 8LDHA 3I3FA 4QUEA 3BXPA 2QMYA 2O8CB 3OSUA 4GM1A 1T2VA 4PBTA 4K2HA 2FR0A 4RVNA 1D2CA 1RSZA 5BN5B 1JN1A 1XMJA 2ZJYA 1UH5A 2OQIA 4O2LA 3EPLA 4CEJA 2XT6A 1CUAA 1LU9A 2DFLA 4RJ2A 3GEMA 4A26A 1RJ9B 1XBIA 3LXUX 3MCZA 3THWA 4J1QA 2CDCA 2GNOA 2NVUA 2ZETA 1TGVA 2CEKA 1NV8A 3GCGA 3NTLA 1S3SA 2W8ZA 3VUFA 1DAIA 1ZH8A 1GFIA 2W2LD 1WQ4A 5IARA 1RI4A 2EBUA 3IRVA 4ZVMA 2LCAA 3RHFA 2FE1A 2DX7A 3FWPA 5DFAA 3SEZA 4F04A 1K75A 4CL8A 3B8HA 3EOZA 4UNSA 2J4DA 2B82A 3NASA 4I1RA 1U9JA 5LN1A 2A0WA 3TTSA 1PQPA 1CUIA 4OCZA 4Q0MA 1CV2A 2P91A 1RLOA 4W8OA 1QVVA 3KSBC 3LSYA 1G63A 1KFCB 4X92A 3ZWPA 1R0SA 3WMFA 4DLLA 5A3RA 3DT6A 3Q6NA 4MRMA 5I9NA 1YCHA 1BJTA 2IYTA 2YZ7A 3H18A 4L74A 3X44A 4JGBA 3G82C 3FGOA 4TN5A 3RTGA 3B36A 5LP6C 3A7DA 3K6JA 3L0IB 3BMCB 3MINB 5E3HA 4FB4A 3L0SA 4HY3A 4KQWA 4OFWA 4AMZA 1S1CA 2QQ5A 1GA1A 5ARCA 1CUEA 3HZRA 1D4FA 1XCPA 3CF2A 1EXDA 4QVKA 3OJLA 2PEZA 5EWLA 2GWHA 2O2HA 4P4UA 4B71A 5M29A 4FGSA 4HDKB 6REQA 2I6XA 5JHHB 1NZJA 3MLAA 2HCBA 3C5WP 3OURA 5FLEX 2NXJA 3R5JA 2PU5A 2OCYC 4L95C 3RSZA 2Q4TA 4IOKA 2ROQA 3EASA 3OBIA 4PZCA 5AK4A 2IP1A 2FN9A 3UWDA 3WIEA 3GLIA 4D9HA 1MC4A 1WDWB 2YV1A 3FGPA 4RMNA 4EBFA 1J1IA 1VGVA 4PWYA 4LRTB 3ZXYA 4X85A 3B6EA 4YMIA 5FJ4C 2CCJA 3D5QA 2WABA 2CVLA 5C52B 2DBRA 2JGNA 3NTOA 2H51A 4ETIA 1W59A 3JATB 3MCTA 1BWRA 2ZW9A 1BHJA 3BEDA 3H2BA 3I72A 3MRTA 5E1OA 3RS0A 4F3YA 4BGDA 5JISA 1NVVQ 3J81M 3AFHA 1DMRA 1SDSA 3A28A 3RJ5A 4RD1A 5CBPB 2O57A 3KHTA 5JAHA 2W8BC 4INZA 4Q18A 2GN2A 3PA8A 4PO9A 3KCNA 5TX7A 4Q7JB 4YP5A 1CEXA 4Q02A 4OAOA 4F3TA 4X45A 5FBKA 1GPKA 5BV7A 5ITZB 2QEXF 3NBQA 5EXDA 3V6LA 4IKPA 4UCWA 3PWKA 3OECA 3GOHA 5E4JA 3EG5A 4AJKA 5HCUA 1KYQA 1N2EA 1SVIA 4EDHA 2B1GA 2VYFA 5JAMA 2OBLA 1IVSA 2RGRA 2G1UA 3OHSX 3ETGA 4U4AA 1XCMA 2FH5B 2VHZA 4ZAWA 4EY7A 4H16A 3BRSA 3ZH2A 1P7VA 1F0KA 1JHYA 3F9RA 3GRRA 2CCGA 1JBKA 2EV9A 2ILVA 2IHYA 3MNFA 1Z0IA 2BGIA 2O2DA 3R0XA 5LYYA 4AMVA 1H8ED 2OO3A 4ND7A 1ZOPA 3Q5EA 1ZIYA 1AHNA 3K16A 1LBSA 1QV7A 4KQKA 4ZT2A 2IELA 4D9KA 3L6EA 1NHGA 1SFRA 3O8BA 1AGRA 4G9BA 4N3AA 1OHHD 3N58A 1ICIA 1SD1A 4YQYA 5IAJA 1QFJA 3NMUF 4HX9A 5IVPA 2WVGA 1DQSA 3REGA 1IN7A 1JR3A 1K9SA 1R0WA 1ZJ4A 3JXEA 3M6WA 3H5NA 3QF4A 4EF4A 4CEIB 4CL3A 2X8AA 5EP4A 4E03A 3UWPA 4ND6A 3RV4A 1NQUA 3CEMA 1R88A 2LKCA 4EI7A 1N7IA 2BSAA 5ARDA 4ZU3A 2CV1A 5AVWA 3OPYI 1N2CB 2XPCA 3DT8A 4XDYA 1GZUA 2B69A 3OFKA 3X2SA 3WKBA 4FWBA 5ALJA 5KOHA 2YYEA 1M6NA 1KSJA 3U13A 5AVZA 4H6XA 5IZCC 3HCDA 4WL0A 3PJEA 5D6OA 1TYBE 4JSYA 2BFFA 2OAP1 4I50F 2XQFA 3SF0A 4DCGA 1IB0A 1PIWA 5L3RA 1JYEA 4J0EA 5L4LA 1XF9A 5BVGB 2H18A 3P8ZA 1P0PA 2I2AA 3I2HA 4OUDA 3AVQA 1V8PA 1G8SA 1WETA 4RHFA 4RTJA 5TQVA 5J2UF 4ZK7A 4CGZA 4FHDA 3VKGA 3VR6A 5B6PA 2Y77A 2WHEA 4F2PA 2QZZA 3GCWA 3R3UA 2CD7A 2XODA 4RSMA 2R00C 3OZ7A 5FR2A 2W2OA 3PE6A 4LE2A 3OQ1A 5E6RA 5LQMA 1QK5A 1AC5A 1QPZA 2DLDA 5BMVA 5A6SB 3CYQA 3N2ZB 4GW3A 4ACAA 4IQ8A 3DKPA 3HU2A 1G66A 1TK2A 2NQ2C 2FOLA 2QD2A 1E7KA 1UT8A 3A9UA 4BLUA 2ON6A 2Y9MB 4MWZA 3N6VA 2W7TA 1XZFA 4XARA 4B4KA 4DPKA 5CB4F 4LBVA 4UBNA 1F38A 1UMDA 5IJZA 2C2OA 2I4TA 3OMWA 4PGAA 1DWOA 4L8LA 1ZGJA 1C1XA 5GIOC 5D3MB 4LNHA 5GIOE 1ML4A 4ZQHA 5E95A 1Q0UA 3CVJA 2IWRA 3S68A 1ZHOA 1IYZA 3MWKA 3RVBA 1GV1A 3CCQF 2ZQYA 2B20A 1QSGA 1UXJA 5AVVA 1QZ3A 4NS1A 2IS1A 4JLVA 5ELLA 4BEVA 3KOWA 4E15A 3G2JA 4N41A 4I4TA 1UAGA 1L7XA 4GNKA 4GQIA 5I3CA 3I64A 5I7RA 3VNBA 3CRZA 2YWJA 3IB3A 2IEIA 4IEEA 2OMKA 3UXYA 1WPXA 4L4XA 2CNDA 1LDYA 4GIBA 3SZGA 2VO1A 3VR5A 3TRJA 4L0MA 3L0CA 1A95A 2GLZA 2B1RA 1J0EA 5M7EA 3D2BA 2UVQA 3NFRA 3RM3A 2I1LA 3D1LA 5JZ9A 2VHCA 1UQTA 3GVXA 3KQYA 2IY9A 2NU6B 1WB6A 2WM2A 3NVKE 1XZBA 1WEKA 2D5IA 3D0OA 3P2YA 4Q7EA 1F8YA 4ECEA 3BH7A 4GEGA 4Z4EA 5I4IA 1U1EA 4EUKA 4PQFA 4D57A 1UXOA 2DM6A 2J3JA 2XOKA 4L5YA 3O94A 3CGGA 1R0YA 4E5UA 1G21B 5BQ3A 1GHTA 2DSNA 2GBPA 1J42A 3PWTA 4MV8A 2VZEA 3FUVA 3FPLA 3HHPA 3RG8A 5GZ6A 4KPUB 1JPUA 1AU9A 2A58A 3ZVNA 2PMCA 2O19A 1WIWA 3F8TA 2NAPA 4HLCA 4OKNA 4CLOA 2XBMA 5FTNA 5AI6A 1T6XA 4QGAA 1UBOS 3LF2A 2XUIA 1G6KA 4RBNA 5HKAA 1Z2OX 2NADA 2XE7A 3JQFA 3M89A 2VHVA 2WWVD 3RWOA 3ZHCA 5BSGA 2ZJBA 3QA9A 2OCGA 4LDRA 1WXFA 4W82A 5FTJA 2OXTA 3SS7X 5GOTA 4MQBA 4YT8A 4KUGA 5TB5A 3TKLA 4GZ6A 1EEHA 1M2NA 1XIVA 3IAFA 4NENB 4X6UA 3KU4A 4YS6A 1UCFA 3QSGA 4PSCA 4UAVA 1FQJA 3RT7A 3VC1A 4LYFA 4JQSA 3EVCA 2R65A 2NOAA 4I6JA 1SIBE 4UVHA 4B81A 5K6TA 1MO3A 3BGSA 2P4UA 3FOZA 4HZIA 3H16A 4ZO4A 1GAEO 1KDZA 1F48A 1U04A 2IYLD 4RDXA 3KLPX 3F78A 3CMEF 4MP3A 3W04A 1KNJA 3DOOA 3JYQA 5HGJA 1GPBA 4KC0A 1F1BA 1Z0FA 1E63A 2AI1A 2FSVA 2O1XA 4R84A 4B3XA 4CMBA 4G65A 3VV2A 3A6JA 2D0OB 4I3FA 4DMUB 5JAIA 4JR1A 4PCVA 4YBRA 3ZD6A 4B2PA 2O8FA 3K20A 2E3JA 2FQWA 2GDJA 2P3QA 4TZ0A 3LM8A 3B85A 4MI9A 5FCDA 4HWSA 3G0CA 3UK2A 1LLUA 2Q6IA 4HYEA 3AJ8A 4V1CI 4DSAA 2BFWA 2PK3A 4DG9A 3GX1A 3SMQA 2DHRA 2HQSA 3E9NA 1U7OA 1KPIA 4V0NA 1JIXA 4PONA 5DLQC 3UMJA 3CVYA 3HE3A 2VATA 1PP4A 3H5WA 5DYYA 1GWNA 1FP4B 3S40A 4L3WA 1XNGA 2VLBA 3L06A 4B6OA 1NVTA 3HBMA 5JCXA 2IYPA 4I81A 4MV6A 1KI4A 1CZLA 1Q91A 2X8JA 2Y6VA 3AZOA 5J9FA 3D8RA 4A8HA 5K9ZA 4DSUA 2NSYA 4DRYA 4ITUA 4BNLA 3C1TA 4LAFA 1N5RA 1Z8DA 1CZUA 1X7YB 3DZKA 4IHQA 2R85A 3J81k 2WQ6A 4NONA 4RIEA 4RKYA 3E9MA 1LX7A 3ZUGA 1L7QA 1OFUA 1C29B 3DV0B 3IEXA 4XW2A 1AB5A 1V7QA 3TNJA 3UMSA 4JP1A 2O3UA 3IQXA 1G6OA 1HA3A 2JJQA 3OEYA 1N3LA 5J2UB 2G7MC 4PV7A 3ZV4A 3CUKA 1HYBA 4A6DA 2BO1A 2BISA 1RRGA 2ZYIA 1KY5A 5EXXA 1XLVA 3FX2A 4C03A 4MSUA 4EUFA 3W6ZA 2CSLA 1XR3A 3LBNA 5JXWA 5KQPA 3TB6A 1WSBA 5DF1A 4V3BA 4C2TA 5TY0A 3OQPA 1LRJA 2D2IA 3O2QB 2L69A 4GYYA 4QWWA 1QOZA 4IDDA 4WZBB 3T9BA 1PYOA 3VNSA 1J0AA 3ZX5A 5DI3A 5FWXB 5E0KB 4ARVA 2Y93A 4B34A 1A8HA 2B4YA 3WAGA 4ZI7F 2X2FA 4PYRA 4F46A 1PW5A 3ETEA 5K8LA 3ESYA 4QJ5A 2HSDA 1U4NA 2HJWA 4Z8YA 1AMOA 2VJAA 1QCDA 2I0FA 1UK7A 3I2KA 3OG9A 1QJCA 4U7GA 2FEMA 4KEAA 4L1KA 3RUCA 4I1VA 5BNFA 1U5CA 4D99A 3V4LA 1OXBB 3L0DA 3V7WA 4BZPA 4MR7A 5JWOA 4BVRA 2BW0A 1Z2EA 2C3MA 2V7UA 1MA0A 2O3TA 4B7UA 3MGAA 2FW0A 3H2JA 3B6ZA 5FADA 1IONA 5AJTA 4QQFA 3ZDYB 3U62A 2KB0A 4PPNA 3VVMA 3M81A 3NJRA 4DLBA 4D98A 1GZDA 2PHNA 1L7RA 1XNQB 3JQRA 2NGRA 3EZ6A 3PX7A 1XZJA 2GFQA 4M76B 2V96A 1JHRA 5DVZA 1UUFA 3TLJA 3TIIA 2B34A 4RSGA 4RLSA 4ER3A 2G0AA 1M54A 4KHZA 5T3UA 1Z29A 2JFUA 3G85A 1DUIA 4C20A 2IYFA 1L8XA 2PLRA 3P5BA 4QXAA 3DE1X 3JU3A 3L7MA 1GTG1 3UMMA 3T3DA 2XJ9A 4DMFA 3DKVA 2W6CX 1FXWA 4MYDA 2G9NA 4E1AA 3WPWA 4M7OA 4K9KA 1L4MA 3R9WA 4BMPB 1NSFA 5CVCA 1PJ4A 3QEMA 4RMIA 3P9PA 1V8FA 1T2CA 4BFWA 4Q6BA 2XGJA 3GGCA 4G24A 2YVQA 1U3PA 1CLUA 1K27A 1X8LA 2EKBA 4XD7D 5B1YA 3UBMA 2WZBA 2COKA 1Q1ZA 2EW2A 3COZA 3EGDA 4BO2A 2G08A 3UENA 1QC5B 4PLFA 1Y33E 4JYPA 3DULA 4E2YA 1EX6A 1M8GA 3DDCA 1FRNA 4E13A 3F5DA 4GSKA 4MRAA 4XVQA 4YJDA 2WMOB 1YQ9A 2UUOA 1W85A 4QLBA 3IKEA 5FTLA 3TGPA 1VHQA 1TXGA 2VUSA 4YNBA 3QIVA 3FSGA 3UN1A 4BECA 5C7YA 2PZKA 1V96A 4QOSA 4BFTA 1VMKA 3ONFA 2P0EA 1B2RA 1I6KA 4MW1A 2J0QA 1PGQA 1IPAA 4B3IA 1ZNZA 2GEBA 5ALMA 3HO6A 4D7AA 2G0TA 5FOSA 2KBEA 3E9DA 4FXPA 3S2GA 3VYRB 2MR5A 4TYWA 1AUXA 4KDRA 1NBMA 1QWOA 4X97A 3NBKA 3A9RA 4HC4A 4DM7A 5JDIA 2RGDA 3SEQA 4GOOD 2VUHB 1HMPA 3A26A 5IHPA 1VE7A 2BMWA 2IEDA 3DSRA 4UBLA 4DQXA 3EXFB 3F6MA 1GOTA 1VG0B 1AV7A 2J0EA 3F6RA 4MMZB 4U3JA 4V0MA 3V97A 3OC0A 3KEMA 3EFHA 4B6RA 2IVFA 2WU3A 3T4PA 4XWYA 3O83A 1OFHA 1PFYA 4R5MA 4REQA 3P7MA 4J16C 2PX3A 4H1TA 1X92A 1U28C 3D4BA 1QTIA 4PAOA 4ESOA 1UK8A 2QRVB 5H4GA 4EJSC 3FD6A 2XMBA 4J0FA 4MWTA 4N03A 5CM8B 4PCUA 3VCZA 3BFPA 1EUCA 1KC3A 2PX8A 4PR0A 4RH1A 5HW0A 3J7AC 1H48A 2CLIB 4KP7A 4EATA 3LECA 3A4YA 5FLXA 5JRZA 1BC5A 1WUYA 1E20A 1SC1A 1L7BA 1RC8A 4BFXA 2HHJA 3SJBA 1TJNA 3V1KA 1N8TA 1Z0KA 3EQZA 5I7FA 3ADBA 3PGKA 5BSRA 4A0HA 3RB8A 4F4HA 2PQ2A 5TS2A 2VH2A 1VPLA 4P4SB 2F9LA 4DCCA 2WHRA 1WKCA 4BN0A 1SVMA 4RPGA 3CZ9A 2H2IA 1HQKA 5LOVA 2EHDA 1IJFA 2WV7A 2ZM6B 1FP2A 4HNUA 1YQXA 2JLXA 1F5SA 3BEOA 4N7JA 5EMNA 1IAVA 3E20B 1TM2A 2PJDA 3EIWA 2C20A 3D6TB 4NEQA 5EHQA 1TO2E 2QVCA 4FEAA 3M2TA 5CM9C 2NYVA 4BT4A 4KYVA 4UE6A 2G36A 1PWEA 1KAEA 3LXMA 4K05A 3PYMA 4BVBA 3GMTA 3U17A 3N6XA 1BMFD 4PQGA 4FK8A 4Q3CA 2GSDA 2F64A 4UJ3A 1KFJB 1NM5A 1SU7A 2WSLA 2OYSA 2QTAA 3X1DA 5SY4A 3D7KA 2FSGA 1XRSB 4OP3A 5C51B 4IOJA 3V9PA 3IDFA 4N6GA 3GZNA 5C8DA 4MVJM 1O77A 3HJCA 4KO2S 5HIMA 2ZWOA 2X6TA 2V5AA 4EBBA 3U4QA 2CFSA 3LYAA 3WFIA 2BKAA 3AV0B 2UUCB 2PFSA 2O8CA 1L7NA 1XTZA 3D7NA 2F7SA 5ER6A 2FG6C 4QFMA 1SY7A 3VNVA 5JASA 1NA5A 2A7XA 2OPBA 3DP9A 3AFIA 3IVGA 5IULC 1DAFA 5CCDA 3QX3A 1QE5A 1P4GA 2I6QA 2YN4A 4M89A 5KAPA 1CJTC 3HY6A 2O8VA 3SVTA 4BQIA 3ZCVA 2ZROA 1JEAA 4HRXA 4BNXA 5E3JA 2P78A 3GEGA 3DZBA 4TVOA 1TYZA 2IC5A 4MYHA 4YB8A 2PZGA 3TI9A 5BSUA 4A8TA 4G37A 1N6LA 4QLAA 2R1UA 2VRWA 4BWYA 4I08A 3AKZA 2PCLA 2IUUA 5U4XA 4IDGA 3FYDA 5DSXA 1ODTC 2FDXA 2OCPA 2ZS8A 1FVFA 2ZU0C 1OXVA 4AZTA 1CJCA 4UAGA 3NUQA 4BV9A 4BE9A 2VHUA 1P4RA 1CNMA 1OOEA 2FSFA 3G7UA 4JOQA 4KN5A 4KMMA 3MXTA 4II3A 4Q9LA 5EN4A 4NSNA 4LW8A 1NUUA 4CMGA 2BMFA 4EX7A 5L3QB 2PX6A 3T99A 3CF6R 4R2XA 4CF5A 3L7KA 4MRNA 1ZK4A 4QOHA 4HDQB 3OQHA 2JFVA 4UCFA 1T9BA 2X41A 3KX2A 4JLSA 2CW5A 1US8A 1YS4A 2HCRA 1A7JA 2JGFA 2CXUA 1JKXA 4HDKA 4LBWA 5AK3A 3ON5A 5E1MA 3R7SA 4S05A 1I32A 1NP6A 4GGPA 1B1AA 2QN7A 2VP0A 4UEQA 5DIZA 3ZWKA 1NIPA 3FBAA 3RASA 1XFDA 3B6KA 1P4JA 1P18A 4AFNA 3TAHA 1WV1A 4AY3A 4Q7QA 3B2QA 1RRKA 1JSLA 1R18A 1KDVA 3MD0A 3QPCA 3VX3A 1AKMA 1J24A 1PR2A 2ZE7A 1DAGA 3QTBA 4YUWA 3BMQB 3EF1A 2B36A 4FS8A 3M84A 1EI9A 2W6NA 4EW3A 2IZZA 2JFOA 2PGNA 3L8HA 3T9DA 1Z2NX 5CBPA 1GZSA 1WOYA 1YMQA 1YQGA 3KCQA 4CL2A 3CCJF 1ZCZA 2ZJFA 2QW1A 3PPXA 3NV9A 2B30A 3FROA 3TJRA 2YC2C 1HWYA 4MVJH 1Q0RA 3AILA 5DWQA 4A2CA 5ITZA 1HLGA 3EVFA 3M70A 2FYTA 1NPDA 1UBLS 2IY8A 4G8JA 2QXUA 3TRKA 3VMMA 5D00A 3FB1A 1Q8RA 3O74A 1UQUA 2FMXA 3RC1A 3V7QA 1Z34A 2QRQA 4GPTA 3LWOC 1MUUA 1TC1A 3U3MA 3ZWXA 4C21A 2YV4A 1H0RA 3TRDA 1E3SA 4UVGA 5D2CA 2WWHA 3NHLA 3P27A 8OHMA 3ZGZA 4DE5A 1QAMA 1PJRA 3LS2A 3H9BA 5KYWB 4QU5A 1QVRA 7MDHA 1WPGA 1MJGM 4PYKA 1KQNA 5BQFA 4KU4A 3N4ZA 2CN1A 4YMHA 1R0KA 7YASA 3WP0A 4OP2A 4X20B 1SZJG 1BOOA 2VF2A 4GFDA 2D2XA 2I5PO 3K15A 2C5AA 4LJ4A 4P31A 2BCEA 3EARA 3VJMA 3DQQA 2YIMA 3BD7A 4N12A 3WISA 4J3JA 2EKPA 1JV2B 4QAJA 2J3LA 5KNCH 3H8VA 2C2YA 3U4HA 5JCZA 4WOKA 4X1KA 2ZI9A 2PMEA 3TM5A 1KOGA 2CY0A 2FFRA 3IP9A 3L92A 1PDVA 3NEPX 2B0CA 2I1VB 3QIAA 4L5CA 2BP7B 4LCBA 5F52A 4E32A 4ISBA 5F7JA 1LJLA 1YAHA 3GLGE 3KJGA 1GQQA 4KAAA 2PRSA 1DUVG 1SCAA 2FZ4A 4L3VA 3U81A 5K05A 4QGBA 1QPGA 5GM1A 1HF3A 2D0PB 1M6HA 2PLAA 3GGOA 4MV5A 1GTRA 2LUOA 3TTTA 1VHAA 1W0KA 4KX3A 4OFZA 3I5MA 1Z0UA 1ZCAA 1BE1A 5FXMA 3AVXA 3DOJA 1LW6E 2ZWIA 3ZKWB 3U39A 1C81A 3L7BA 5FBZA 2EIHA 4E70A 1P2SA 3HJTA 2QN8A 4EVRA 6CHYA 4QOGA 3MELA 1P7YA 3JS5A 3OIYA 4LFCB 1EM8B 3ZIDA 2AN9A 3QUBA 2NUTA 2R48A 2FMKA 1MC1A 3OE7A 3A2NA 1H6BA 2Z0MA 2GAOA 4P22A 1JBEA 5IYZF 3WJ7A 1OT5A 2XQGA 5EE1A 4X1IB 1DXYA 4P4GA 3EEIA 2JNWA 1KDRA 1F60A 1AMUA 1XQWA 5HFJA 4Q93A 1OQAA 4AD8A 3FWZA 3M4JA 1KQ3A 3F0TA 2FW6A 4TMXA 5A6SA 5I7SA 2JGAA 1ZXBA 3ETHA 1L8OA 1GGVA 4G0QA 3PENA 1R6VA 1IZ0A 2VPZA 1V39A 2QPTA 2FMFA 2ZT5A 2JNBA 1ICEA 3DMHA 4RCVA 3U4CA 3VM6A 5HZGA 2BUAA 1WULS 4JT2A 1DKOA 2V7PA 2VTDA 2C1EA 2IXFA 3PPIA 4H35A 3IC5A 1CU1A 4J7CA 4QHYA 4DG5A 5F76A 4K46A 2OOSA 5F35A 2JIDA 4WTOA 4N5MA 5AT1A 1Z7EA 2JZOA 4JELA 2HDOA 3WA6A 5BWBA 4MLDA 5F1YA 2B5VA 4ZICA 3PF8A 1VLMA 2XADA 3TH5A 4CIWA 2D06A 4EJ2A 3ZW7A 3IP5A 1GG2A 4TTPA 1EFPB 1MH9A 1X7WB 4MULA 4N0EA 4D9NA 1ACLA 1U94A 4QDOA 1U2GC 1T3SA 3N86A 4L16A 1ENZA 3PPVA 2NZUG 4IG4A 4BIMA 1BQEA 3NFYA 2YWBA 4O4JF 4XFKA 5AXDA 4OHZA 5GINE 2MSLA 5B1IA 2QI9C 4M9XA 3FTNA 4NYMQ 1G5PA 5A5VA 3PIDA 1Q7YH 3LX4A 4XWGA 4D4LA 2EJWA 1EFVA 5KSZA 3V9AA 2VJCA 2EZ8A 3ST7A 4ALKA 5IWAB 1TU3A 2L18A 2C5SA 5AVMA 2JEZA 2ZRAA 4OBBA 4BV8A 2ID4A 3SQWA 3EK2A 3N0XA 4FIDA 3BKXA 1G9TA 3QRWA 1R5JA 2RGEA 4IIGA 1RPJA 1G21A 4IOMA 4NU6A 4ZODA 3BX1A 2JEYA 3PJRA 3MW8A 4YRCA 2RD2A 3ZK7A 2NV0A 2X0KA 1T5IA 3F0FA 1CBUA 3BTVA 1SVSA 2R96A 3C3DA 4G0OA 3AFMA 4RJIA 4UARA 2Q7XA 2Z1EA 1IK4A 1G4HA 4JB8A 1GPWB 1TLFA 1XDGA 2J3HA 4NIMA 5H80A 4D3SA 4BNDA 1ODJA 2H3EA 2PWYA 3MWEB 4GO1A 1J8YF 3VOBA 1FLAA 1U1DA 3ZI0A 1OROA 1CQWA 2HIHA 3SSOA 2EU8A 4MLPA 4MW5A 1IZYA 3HA7A 2ERXA 3IUSA 3SE0A 2OTJF 4ZGBA 2IH5A 1E2EA 3OF5A 4K6GA 3ND5A 2D8AA 3N8DA 2DJIA 2F3QA 2R8YA 2OZVA 2WDPA 4P6VF 1OB5A 3ICOA 4PYLA 5FTMA 4Z8XA 1AK9A 2XWQA 1RVDA 2OP0A 4BQEA 1AMNA 2YV5A 1GPH1 1UM9B 4HGNA 1TZCA 3VX4A 1SWVA 1JLMA 5I9MA 3OD5A 3NP7A 3MN1A 4D4HA 2A4MA 2FRDC 2GAAA 3BVPA 4BC1A 4DIUA 5HXZA 2AQHA 3GT4A 4RPJA 4HBGA 4OHKA 8ABPA 2WHQA 2PTGA 1U8UA 2QD3A 2VSYA 3AR8A 3W8FA 3H84A 2FWJA 3QVXA 2LTAA 1A27A 4ZYUA 2HBRA 3KKNA 4GX2A 1C9YA 3H1AA 3TPCA 1P1HA 2C7RA 2ZAUA 3QU7A 1BSVA 2Q8NA 1M8KA 1VIDA 5CX4A 4MIOA 1SC6A 4A2PA 4PG5A 5JSHA 2I66A 3WZMA 1K86A 3OLQA 3JQAA 2BFEB 5JJ5A 3L7CA 3Q6MA 1GTL1 2JAQA 2RIRA 4JYMA 4KGVA 2J7PA 4KMSA 4ZVRA 1KQGA 1LDGA 5GADl 4MJLA 3PUKA 1KEKA 3EG9B 4MW9A 3WIDA 2CVQA 3E22B 1TVMA 1Y1SA 2HA0A 4H7KA 4NH0A 1OZ0A 5HMMA 4AO7A 1AY0A 3AEYA 2PJRA 4YQEA 4OHPA 4DXAA 2AJCA 3I9MA 1GTVA 2VSOA 3E81A 2Y9PB 3M9LA 4HH0A 2AK3A 1E66A 1GRNA 1DC3A 2X3YA 3CH7A 5SZHB 3F7OA 4LY6A 3TS1A 5AW3A 1P33A 4