1NMUB

Mbp-l30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/ribosome
molecule keywords maltose-binding periplasmic protein
publication title Inherent Protein Structural Flexibility at the RNA-binding Interface of L30e
pubmed doi rcsb
source organism Escherichia coli
total genus 34
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1nmuB00
2OHWA 3ON1A 1W2BF 3NK6A 2BO1A 1N8RH 1QVGF 3VI6A 3NVIB 3CCVF 1VQ6F 1ZWZA 3LWRC 3NMUC 3OBYA 3OBWA 1Q82H 1RA4A 4X3LA 1VQPF 1YJWF 3LWVC 1VQKF 3CPWF 1VQMF 3CCJF 3G71F 1JJ2F 3OW2F 3G4SF 1YIJF 1DT9A 3I56F 2I6DA 3I55F 3LFOA 3SIVA 1NJIH 3SIUA 1Q7YH 2LBWA 3CC7F 1T0KB 3IR9A 3CG6A 2AIFA 3E20B 1RLGA 3PAFA 1X7PA 5G4UC 1X52A 1QVFF 5GANK 1K8AH 3J80M 5GINC 1Q81H 2JNBA 1CK2A 3CXCF 2ALEA 3CCMF 1PXWA 3CCUF 2HVYD 3CMAF 3G6EF 3CCRF 3MCAB 3N4YA 3CCEF 3CCLF 1KD1H 1S72F 2OZBA 1E7KA 5IT9M 5A2QM 1CN7A 5G4VC 2KTUA 3WXMB 3JAMM 3J81M 2OTLF 2VGNA 2CZWA 2KTVA 3RA5A 3JCMM 3CCSF 3NVKE 3V7EA 1W41A 1YHQF 3AGKA 1VQ5F 3LWQC 1VQNF 1YJNF 1KQSF 2OTJF 3HJWC 1H7MA 1VQOF 1W42A 1KC8H 1GO0A 1K73H 3CCQF 3O85A 4TZZA 2WALA 1GO1A 3CC2F 1W40A 5DCVA 1XBIA 1NMUB 2FC3A 1YJ9F 1X7OA 1VQ4F 2QA4F 1YITF 3N4ZA 4NUTA 3CC4F 1SDSA 3LWOC 1VQ9F 4X3MA 4BW0B 3J7AR 2QI2A 3CPQA 2VGMA 1M90H 1YI2F 1GZ0A 5GIOC 3V7QA 1VQ8F 3CMEF 1VQ7F 4BY9D 4LCKA 4C4WC 2QEXF 2LBXA 5GIPC 3VMFB 1Q86H 1W3EX 3NK7A 3GYQA 5EO3A 3RA6A 1VQLF 3FFMA 3CD6F 5EWRA 1IPAA 1M1KH 3HAXD 3PLAC 3E1YA 1K9MH 5FJ4C 3LWPC 5GAPK 5FLXM 2KG4A
chains in the Genus database with same CATH superfamily
2OHWA 1W2BF 5CA0A 5HWEA 4BVSA 3I3FA 4ZK7A 1QVGF 5IYZA 3NVIB 1ODEA 4KWEA 2R6R1 4I50A 2HP0B 2UYNB 2RHHA 2DYYA 4ZI7A 1VQVA 1YJWF 3HTNA 1Q8RA 1JJ2F 1Z5VA 1XRGA 4PWTA 5EYPB 1YIJF 5AVMA 3LFOA 3SIVA 3JASB 4C82A 3SIUA 1Q7YH 5EAZA 2VAPA 1XHOA 4XCQA 3IR9A 3CG6A 3HKBB 1RLGA 4O2BB 3PAFA 1X7PA 3S0WA 5G4UC 1X52A 3HKDA 5GANK 3RYFA 1K8AH 3WGKA 2OTMA 2JNBA 4X1KA 2ALEA 3V4DA 4YJ3A 3LYBA 4BT7A 5LYJA 1NQ3A 3LDTA 3CCEF 1FFXA 3C8LA 4O2AB 1S72F 1KNKA 2Z1UA 3OONA 5IJ0B 5JQGB 3S06A 2H8CA 3JATB 1W5AA 1DBFA 4YJ2A 1FSZA 1W55A 4BVRA 5LP6B 2VGNA 5J2TB 4B62A 3CCSF 4IIJA 3NVKE 2KGWA 4BT3A 1W581 2CHSA 1SA0A 3E22A 2ZOVA 4B45A 4FFBB 3HKEA 5LXTA 2HQSC 4C8EA 3O85A 4ZHQB 4TZZA 5CB4A 1GO1A 2HS3A 3CC2F 5DCVA 3IMPA 2QA4F 5HY2A 4NUTA 4O4IB 1R1MA 3LWOC 1VQ9F 3S02A 3J7AR 1XV2A 1GZ0A 3KIZA 1VHAA 5LP6C 3RYCB 3V7QA 4C4WC 3CMEF 1KNJA 2AMTA 5GIPC 2YYEA 2HS0A 2Z01A 1W3EX 3VMFB 1Q86H 3GYQA 3UT5B 3CD6F 4X20A 2QTPA 4NWOB 4O4JB 3HAXD 2K1SA 2ZAUA 1TUBB 3E1YA 5C8YB 4ZOLB 4O4HA 5FLXM 5CA1A 1RQ2A 4G88A 4IHJB 3U0OA 2CSLA 3N2GA 2BO1A 5FNVA 4LNUA 4TV9B 3JVHA 3WJPA 4F6RB 3EORA 5BMVB 2RB9A 3RYIB 3JAWB 4C8GA 3C9SA 1ZWZA 5HY0A 3LWRC 3CCVF 1OAPA 5J2UB 2LBTA 3JAKA 1Q82H 3MCQA 4BT4A 5LA6B 1COMA 4X3LA 4EB6B 4NQ3A 1VQPF 3LWVC 1VQKF 4I55A 2F9ZC 4ZHYB 3F0GA 3CCJF 3G71F 3OW2F 5HY4A 3I56F 4ZHVA 3I55F 1NJIH 4DRXA 3C9TA 3FD5A 4O4LA 5MN5A 2GLZA 5JH7A 3MDOA 1T0KB 3ELCA 1JY8A 2AIFA 3E20B 2N48A 4I4TA 5JCOA 3HKCA 3D00A 1TVKA 3DC2A 1Q81H 3CCMF 1CK2A 2HVYD 3KJKA 1PXWA 3CCUF 5KMGB 3CMAF 3CCRF 3KE1A 3MCAB 4WBNA 3FD6A 4U3JB 4X1IA 3I7TA 3C9RA 2V9YA 4X1YB 2HRUA 5ITZA 4E6EA 2KTUA 3K0TA 2UYKA 2PMPA 1JFFA 1VK3A 2Z1FA 3B6NA 3RYHA 1UI9A 4TV8A 1IV2A 3WJQA 3VOAA 3C9UA 5HY1A 3LWQC 3CB2A 2CWJA 5EZYB 3ZO8A 1VH8A 3HJWC 3P10A 1T0AA 5LXTB 1GO0A 3N2KB 2I6RA 3CCQF 3P0ZA 1GX1A 3WJRA 3D01A 1OFUA 4TUYB 3MQWA 1XBIA 2FC3A 1VQ4F 5LOVB 3N4ZA 2UZHA 3M4SA 2ZF8A 4G4VA 4X3MA 4BW0B 2ZVZA 3TD4A 5GIOC 2YXZA 3D54A 4BY9D 2HP0A 2QEXF 2LBXA 2UYNA 3QTYA 3FBAA 5EO3A 2W8BC 1H47A 2BTQB 2H8EA 1M1KH 5HP8A 2RHOA 3PLAC 5EYPA 5GONB 4BT6A 2Q1XA 2Z1EA 3JASA 1QU9A 5KX5B 5EIBD 3LMEA 3VYTC 4ERHA 4RQOA 5JVDB 3JARB 3FPIA 1W5BA 4B46A 3VOBA 1N8RH 3HKBA 4O2BA 3VI6A 3ZP7A 5IJ9B 1VQ6F 2CVLA 3JALB 3TD5A 3OBYA 3OBWA 3WGMA 4HNAB 1U40A 3R0PA 1RA4A 3WGJA 4EI8A 4O2AA 3CPWF 3IEQA 2DT4A 5IJ0A 1H48A 5JQGA 1DT9A 3JATA 2I6DA 4EI9A 4BT2A 2RHLA 5CA0B 1IV3A 3CC7F 5LP6A 5J2TA 1UFYA 2PHNA 2HP3A 5IYZB 1QVFF 5GINC 3CXCF 2P6YA 4I50B 2IQQA 4ZHWA 4FFBA 2CW4A 4BT5A 4WBNB 4ZI7B 4X1IB 3CCLF 1KD1H 4ZHQA 3K12A 2OZBA 3WGLA 3L7QA 5MN4A 3BYQA 5IT9M 1CN7A 5ITZB 5G4VC 1RQ7A 2RHJA 4DXDA 1YGYA 4O4IA 1U3LA 1W5EA 3JAMM 3J81M 3RYHB 3RA5A 2KTVA 3JCMM 3IKEA 2BTUA 3HKDB 3RYFB 5JCOC 4C8IA 3M1XA 4G4YA 2EWCA 4X1KB 1X25A 3T80A 4YJ3B 1VQOF 2B33A 1W42A 3UT5A 4U39A 5LYJB 1U3PA 3P4EA 4O4JA 3VTIC 1FFXB 1TUBA 2WALA 5C8YA 4ZOLA 4BVTA 3MBMA 1YJ9F 2Q1YA 4G4XA 4IHJA 3CYPB 3CC4F 5MN6A 1SDSA 3ESJA 3F0EA 4YJ2B 2G9IA 4TV9A 4F6RA 5BMVA 3RYIA 2VGMA 4IIJB 3JAWA 5EB0A 5J2UA 1VQ8F 1QAHA 4LCKA 1SA0B 3E22B 4G4WA 3ZP4A 5LA6A 4B5CA 4EB6A 2GVIA 2MQEA 3FFMA 4RHAA 2L26A 3HKEB 5EWRA 1IPAA 2HS4A 3Q8HA 1Z5WA 5CB4B 5FJ4C 5GAPK 2LCAA 2VAMA 2KG4A 3ON1A 3GHZA 3NK6A 3WPXA 5B8FA 3NMUC 3CYQA 1W5FA 1J7HA 5KMGA 4M8IA 3VYSC 3IKFA 3S03A 2BTOA 4U3JA 5HXUA 4X20B 2CHTA 1VQMF 3QHDA 3VO8A 4X1YA 3G4SF 1JD1A 3K14A 4O4HB 5CA1B 3KHNA 2ZVYA 3IEWA 1PF5A 3K2XA 3N2GB 2LBWA 3DDNA 1W59A 5EIBC 4LNUB 5FNVB 2GZLA 5EB1B 3QUWA 3J80M 5EZYA 3JAKB 1U43A 4EI7A 3KJJA 3G6EF 2HX0A 3S0HA 3N4YA 3N2KA 4I55B 1SZQA 3F0FA 3VCZA 3M84A 1E7KA 1ONIA 3GTZA 1JN1A 4TUYA 5A2QM 2Z1TA 5LOVA 3WXMB 4DRXB 4O4LB 2OTLF 2CZWA 2IG8A 2VXYA 5JH7B 4R40B 3V7EA 1W41A 4I4TB 1YHQF 3HKCB 3AGKA 1VQ5F 1FNJA 1TVKB 1VQNF 1YJNF 1KQSF 1YQNA 2UYJA 3ZOPA 2OTJF 3VIUA 2R751 1H7MA 2ZODA 3ERNA 3V3TA 3F6MA 1KC8H 1K73H 3TD3A 3HWUA 5GONA 2HRYA 1W40A 1IV4A 1NMUB 1RLUA 3VYUC 1X7OA 5KX5A 1YITF 2NMUA 2VAWA 2AIZP 1JFFB 3JARA 4C81A 5JVDA 3WGNA 3WPWA 4BVQA 3RE3A 2QI2A 3CPQA 4TV8B 1M90H 5IJ9A 5HXZA 1YI2F 3JALA 2H6LA 3RYCA 1VQ7F 1W57A 1CLIA 1QD9A 4HNAA 2FGYA 4G4ZA 3NK7A 3RA6A 1VQLF 1FNKA 1IV1A 2IAFA 3F0DA 2UYPA 5HP7A 1K9MH 3S0YA 3LWPC
chains in the Genus database with same CATH topology
2OHWA 3ON1A 1W2BF 3NK6A 2BO1A 5HWEA 4BVSA 1N8RH 1QVGF 3VI6A 3NVIB 3CCVF 1VQ6F 1ZWZA 5HY0A 3LWRC 3NMUC 3OBYA 3OBWA 1Q82H 1RA4A 4EI8A 4X3LA 4NQ3A 1VQPF 3LWVC 1YJWF 1VQKF 2F9ZC 5HXUA 3CPWF 1VQMF 3CCJF 3G71F 1JJ2F 3OW2F 3G4SF 1YIJF 1DT9A 5HY4A 3I56F 2I6DA 3I55F 3LFOA 4EI9A 3SIVA 1NJIH 3SIUA 1Q7YH 2LBWA 3CC7F 2GLZA 4XCQA 1T0KB 3IR9A 3CG6A 2AIFA 3E20B 1RLGA 3PAFA 1X7PA 5G4UC 1X52A 1QVFF 5GANK 3D00A 1K8AH 3J80M 5GINC 1Q81H 2JNBA 1CK2A 3CXCF 2ALEA 3CCMF 1PXWA 3CCUF 2HVYD 3CMAF 4EI7A 3G6EF 3CCRF 3MCAB 3N4YA 3CCEF 3CCLF 1KD1H 1S72F 2OZBA 1E7KA 5IT9M 5A2QM 1CN7A 5G4VC 2KTUA 3WXMB 3JAMM 3J81M 4BVRA 2OTLF 2VGNA 2CZWA 2KTVA 3RA5A 3JCMM 3CCSF 3NVKE 3V7EA 1W41A 1YHQF 3AGKA 5HY1A 1VQ5F 3LWQC 1VQNF 1YJNF 1KQSF 2OTJF 3HJWC 1H7MA 1VQOF 1W42A 3V3TA 1KC8H 1GO0A 1K73H 3CCQF 3O85A 4TZZA 2WALA 1GO1A 4BVTA 3CC2F 1W40A 5DCVA 1XBIA 1NMUB 2FC3A 1YJ9F 1X7OA 1VQ4F 2QA4F 5HY2A 1YITF 3N4ZA 4NUTA 3CC4F 1SDSA 3LWOC 1VQ9F 4X3MA 4BW0B 4BVQA 3J7AR 2QI2A 3CPQA 2VGMA 1M90H 1YI2F 5HXZA 1GZ0A 5GIOC 3V7QA 1VQ8F 3CMEF 1VQ7F 4BY9D 4LCKA 4C4WC 2QEXF 2LBXA 5GIPC 3VMFB 2FGYA 1W3EX 1Q86H 3NK7A 3GYQA 5EO3A 3RA6A 1VQLF 3FFMA 3CD6F 5EWRA 1IPAA 1M1KH 3HAXD 3PLAC 3E1YA 1K9MH 5FJ4C 3LWPC 5GAPK 5FLXM 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  3ON1 A;  1W2B F;  3NK6 A;  2BO1 A;  1N8R H;  1QVG F;  3VI6 A;  3NVI B;  3CCV F;  1VQ6 F;  1ZWZ A;  3LWR C;  3NMU C;  3OBY A;  3OBW A;  1Q82 H;  1RA4 A;  4X3L A;  1VQP F;  1YJW F;  3LWV C;  1VQK F;  3CPW F;  1VQM F;  3CCJ F;  3G71 F;  1JJ2 F;  3OW2 F;  3G4S F;  1YIJ F;  1DT9 A;  3I56 F;  2I6D A;  3I55 F;  3LFO A;  3SIV A;  1NJI H;  3SIU A;  1Q7Y H;  2LBW A;  3CC7 F;  1T0K B;  3IR9 A;  3CG6 A;  2AIF A;  3E20 B;  1RLG A;  3PAF A;  1X7P A;  5G4U C;  1X52 A;  1QVF F;  5GAN K;  1K8A H;  3J80 M;  5GIN C;  1Q81 H;  2JNB A;  1CK2 A;  3CXC F;  2ALE A;  3CCM F;  1PXW A;  3CCU F;  2HVY D;  3CMA F;  3G6E F;  3CCR F;  3MCA B;  3N4Y A;  3CCE F;  3CCL F;  1KD1 H;  1S72 F;  2OZB A;  1E7K A;  5IT9 M;  5A2Q M;  1CN7 A;  5G4V C;  2KTU A;  3WXM B;  3JAM M;  3J81 M;  2OTL F;  2VGN A;  2CZW A;  2KTV A;  3RA5 A;  3JCM M;  3CCS F;  3NVK E;  3V7E A;  1W41 A;  1YHQ F;  3AGK A;  1VQ5 F;  3LWQ C;  1VQN F;  1YJN F;  1KQS F;  2OTJ F;  3HJW C;  1H7M A;  1VQO F;  1W42 A;  1KC8 H;  1GO0 A;  1K73 H;  3CCQ F;  3O85 A;  4TZZ A;  2WAL A;  1GO1 A;  3CC2 F;  1W40 A;  5DCV A;  1XBI A;  1NMU B;  2FC3 A;  1YJ9 F;  1X7O A;  1VQ4 F;  2QA4 F;  1YIT F;  3N4Z A;  4NUT A;  3CC4 F;  1SDS A;  3LWO C;  1VQ9 F;  4X3M A;  4BW0 B;  3J7A R;  2QI2 A;  3CPQ A;  2VGM A;  1M90 H;  1YI2 F;  1GZ0 A;  5GIO C;  3V7Q A;  1VQ8 F;  3CME F;  1VQ7 F;  4BY9 D;  4LCK A;  4C4W C;  2QEX F;  2LBX A;  5GIP C;  3VMF B;  1Q86 H;  1W3E X;  3NK7 A;  3GYQ A;  5EO3 A;  3RA6 A;  1VQL F;  3FFM A;  3CD6 F;  5EWR A;  1IPA A;  1M1K H;  3HAX D;  3PLA C;  3E1Y A;  1K9M H;  5FJ4 C;  3LWP C;  5GAP K;  5FLX M;  2KG4 A; 
#chains in the Genus database with same CATH topology
 2OHW A;  1W2B F;  5CA0 A;  5HWE A;  4BVS A;  3I3F A;  4ZK7 A;  1QVG F;  5IYZ A;  3NVI B;  1ODE A;  4KWE A;  2R6R 1;  4I50 A;  2HP0 B;  2UYN B;  2RHH A;  2DYY A;  4ZI7 A;  1VQV A;  1YJW F;  3HTN A;  1Q8R A;  1JJ2 F;  1Z5V A;  1XRG A;  4PWT A;  5EYP B;  1YIJ F;  5AVM A;  3LFO A;  3SIV A;  3JAS B;  4C82 A;  3SIU A;  1Q7Y H;  5EAZ A;  2VAP A;  1XHO A;  4XCQ A;  3IR9 A;  3CG6 A;  3HKB B;  1RLG A;  4O2B B;  3PAF A;  1X7P A;  3S0W A;  5G4U C;  1X52 A;  3HKD A;  5GAN K;  3RYF A;  1K8A H;  3WGK A;  2OTM A;  2JNB A;  4X1K A;  2ALE A;  3V4D A;  4YJ3 A;  3LYB A;  4BT7 A;  5LYJ A;  1NQ3 A;  3LDT A;  3CCE F;  1FFX A;  3C8L A;  4O2A B;  1S72 F;  1KNK A;  2Z1U A;  3OON A;  5IJ0 B;  5JQG B;  3S06 A;  2H8C A;  3JAT B;  1W5A A;  1DBF A;  4YJ2 A;  1FSZ A;  1W55 A;  4BVR A;  5LP6 B;  2VGN A;  5J2T B;  4B62 A;  3CCS F;  4IIJ A;  3NVK E;  2KGW A;  4BT3 A;  1W58 1;  2CHS A;  1SA0 A;  3E22 A;  2ZOV A;  4B45 A;  4FFB B;  3HKE A;  5LXT A;  2HQS C;  4C8E A;  3O85 A;  4ZHQ B;  4TZZ A;  5CB4 A;  1GO1 A;  2HS3 A;  3CC2 F;  5DCV A;  3IMP A;  2QA4 F;  5HY2 A;  4NUT A;  4O4I B;  1R1M A;  3LWO C;  1VQ9 F;  3S02 A;  3J7A R;  1XV2 A;  1GZ0 A;  3KIZ A;  1VHA A;  5LP6 C;  3RYC B;  3V7Q A;  4C4W C;  3CME F;  1KNJ A;  2AMT A;  5GIP C;  2YYE A;  2HS0 A;  2Z01 A;  1W3E X;  3VMF B;  1Q86 H;  3GYQ A;  3UT5 B;  3CD6 F;  4X20 A;  2QTP A;  4NWO B;  4O4J B;  3HAX D;  2K1S A;  2ZAU A;  1TUB B;  3E1Y A;  5C8Y B;  4ZOL B;  4O4H A;  5FLX M;  5CA1 A;  1RQ2 A;  4G88 A;  4IHJ B;  3U0O A;  2CSL A;  3N2G A;  2BO1 A;  5FNV A;  4LNU A;  4TV9 B;  3JVH A;  3WJP A;  4F6R B;  3EOR A;  5BMV B;  2RB9 A;  3RYI B;  3JAW B;  4C8G A;  3C9S A;  1ZWZ A;  5HY0 A;  3LWR C;  3CCV F;  1OAP A;  5J2U B;  2LBT A;  3JAK A;  1Q82 H;  3MCQ A;  4BT4 A;  5LA6 B;  1COM A;  4X3L A;  4EB6 B;  4NQ3 A;  1VQP F;  3LWV C;  1VQK F;  4I55 A;  2F9Z C;  4ZHY B;  3F0G A;  3CCJ F;  3G71 F;  3OW2 F;  5HY4 A;  3I56 F;  4ZHV A;  3I55 F;  1NJI H;  4DRX A;  3C9T A;  3FD5 A;  4O4L A;  5MN5 A;  2GLZ A;  5JH7 A;  3MDO A;  1T0K B;  3ELC A;  1JY8 A;  2AIF A;  3E20 B;  2N48 A;  4I4T A;  5JCO A;  3HKC A;  3D00 A;  1TVK A;  3DC2 A;  1Q81 H;  3CCM F;  1CK2 A;  2HVY D;  3KJK A;  1PXW A;  3CCU F;  5KMG B;  3CMA F;  3CCR F;  3KE1 A;  3MCA B;  4WBN A;  3FD6 A;  4U3J B;  4X1I A;  3I7T A;  3C9R A;  2V9Y A;  4X1Y B;  2HRU A;  5ITZ A;  4E6E A;  2KTU A;  3K0T A;  2UYK A;  2PMP A;  1JFF A;  1VK3 A;  2Z1F A;  3B6N A;  3RYH A;  1UI9 A;  4TV8 A;  1IV2 A;  3WJQ A;  3VOA A;  3C9U A;  5HY1 A;  3LWQ C;  3CB2 A;  2CWJ A;  5EZY B;  3ZO8 A;  1VH8 A;  3HJW C;  3P10 A;  1T0A A;  5LXT B;  1GO0 A;  3N2K B;  2I6R A;  3CCQ F;  3P0Z A;  1GX1 A;  3WJR A;  3D01 A;  1OFU A;  4TUY B;  3MQW A;  1XBI A;  2FC3 A;  1VQ4 F;  5LOV B;  3N4Z A;  2UZH A;  3M4S A;  2ZF8 A;  4G4V A;  4X3M A;  4BW0 B;  2ZVZ A;  3TD4 A;  5GIO C;  2YXZ A;  3D54 A;  4BY9 D;  2HP0 A;  2QEX F;  2LBX A;  2UYN A;  3QTY A;  3FBA A;  5EO3 A;  2W8B C;  1H47 A;  2BTQ B;  2H8E A;  1M1K H;  5HP8 A;  2RHO A;  3PLA C;  5EYP A;  5GON B;  4BT6 A;  2Q1X A;  2Z1E A;  3JAS A;  1QU9 A;  5KX5 B;  5EIB D;  3LME A;  3VYT C;  4ERH A;  4RQO A;  5JVD B;  3JAR B;  3FPI A;  1W5B A;  4B46 A;  3VOB A;  1N8R H;  3HKB A;  4O2B A;  3VI6 A;  3ZP7 A;  5IJ9 B;  1VQ6 F;  2CVL A;  3JAL B;  3TD5 A;  3OBY A;  3OBW A;  3WGM A;  4HNA B;  1U40 A;  3R0P A;  1RA4 A;  3WGJ A;  4EI8 A;  4O2A A;  3CPW F;  3IEQ A;  2DT4 A;  5IJ0 A;  1H48 A;  5JQG A;  1DT9 A;  3JAT A;  2I6D A;  4EI9 A;  4BT2 A;  2RHL A;  5CA0 B;  1IV3 A;  3CC7 F;  5LP6 A;  5J2T A;  1UFY A;  2PHN A;  2HP3 A;  5IYZ B;  1QVF F;  5GIN C;  3CXC F;  2P6Y A;  4I50 B;  2IQQ A;  4ZHW A;  4FFB A;  2CW4 A;  4BT5 A;  4WBN B;  4ZI7 B;  4X1I B;  3CCL F;  1KD1 H;  4ZHQ A;  3K12 A;  2OZB A;  3WGL A;  3L7Q A;  5MN4 A;  3BYQ A;  5IT9 M;  1CN7 A;  5ITZ B;  5G4V C;  1RQ7 A;  2RHJ A;  4DXD A;  1YGY A;  4O4I A;  1U3L A;  1W5E A;  3JAM M;  3J81 M;  3RYH B;  3RA5 A;  2KTV A;  3JCM M;  3IKE A;  2BTU A;  3HKD B;  3RYF B;  5JCO C;  4C8I A;  3M1X A;  4G4Y A;  2EWC A;  4X1K B;  1X25 A;  3T80 A;  4YJ3 B;  1VQO F;  2B33 A;  1W42 A;  3UT5 A;  4U39 A;  5LYJ B;  1U3P A;  3P4E A;  4O4J A;  3VTI C;  1FFX B;  1TUB A;  2WAL A;  5C8Y A;  4ZOL A;  4BVT A;  3MBM A;  1YJ9 F;  2Q1Y A;  4G4X A;  4IHJ A;  3CYP B;  3CC4 F;  5MN6 A;  1SDS A;  3ESJ A;  3F0E A;  4YJ2 B;  2G9I A;  4TV9 A;  4F6R A;  5BMV A;  3RYI A;  2VGM A;  4IIJ B;  3JAW A;  5EB0 A;  5J2U A;  1VQ8 F;  1QAH A;  4LCK A;  1SA0 B;  3E22 B;  4G4W A;  3ZP4 A;  5LA6 A;  4B5C A;  4EB6 A;  2GVI A;  2MQE A;  3FFM A;  4RHA A;  2L26 A;  3HKE B;  5EWR A;  1IPA A;  2HS4 A;  3Q8H A;  1Z5W A;  5CB4 B;  5FJ4 C;  5GAP K;  2LCA A;  2VAM A;  2KG4 A;  3ON1 A;  3GHZ A;  3NK6 A;  3WPX A;  5B8F A;  3NMU C;  3CYQ A;  1W5F A;  1J7H A;  5KMG A;  4M8I A;  3VYS C;  3IKF A;  3S03 A;  2BTO A;  4U3J A;  5HXU A;  4X20 B;  2CHT A;  1VQM F;  3QHD A;  3VO8 A;  4X1Y A;  3G4S F;  1JD1 A;  3K14 A;  4O4H B;  5CA1 B;  3KHN A;  2ZVY A;  3IEW A;  1PF5 A;  3K2X A;  3N2G B;  2LBW A;  3DDN A;  1W59 A;  5EIB C;  4LNU B;  5FNV B;  2GZL A;  5EB1 B;  3QUW A;  3J80 M;  5EZY A;  3JAK B;  1U43 A;  4EI7 A;  3KJJ A;  3G6E F;  2HX0 A;  3S0H A;  3N4Y A;  3N2K A;  4I55 B;  1SZQ A;  3F0F A;  3VCZ A;  3M84 A;  1E7K A;  1ONI A;  3GTZ A;  1JN1 A;  4TUY A;  5A2Q M;  2Z1T A;  5LOV A;  3WXM B;  4DRX B;  4O4L B;  2OTL F;  2CZW A;  2IG8 A;  2VXY A;  5JH7 B;  4R40 B;  3V7E A;  1W41 A;  4I4T B;  1YHQ F;  3HKC B;  3AGK A;  1VQ5 F;  1FNJ A;  1TVK B;  1VQN F;  1YJN F;  1KQS F;  1YQN A;  2UYJ A;  3ZOP A;  2OTJ F;  3VIU A;  2R75 1;  1H7M A;  2ZOD A;  3ERN A;  3V3T A;  3F6M A;  1KC8 H;  1K73 H;  3TD3 A;  3HWU A;  5GON A;  2HRY A;  1W40 A;  1IV4 A;  1NMU B;  1RLU A;  3VYU C;  1X7O A;  5KX5 A;  1YIT F;  2NMU A;  2VAW A;  2AIZ P;  1JFF B;  3JAR A;  4C81 A;  5JVD A;  3WGN A;  3WPW A;  4BVQ A;  3RE3 A;  2QI2 A;  3CPQ A;  4TV8 B;  1M90 H;  5IJ9 A;  5HXZ A;  1YI2 F;  3JAL A;  2H6L A;  3RYC A;  1VQ7 F;  1W57 A;  1CLI A;  1QD9 A;  4HNA A;  2FGY A;  4G4Z A;  3NK7 A;  3RA6 A;  1VQL F;  1FNK A;  1IV1 A;  2IAF A;  3F0D A;  2UYP A;  5HP7 A;  1K9M H;  3S0Y A;  3LWP C; 
#chains in the Genus database with same CATH homology
 2OHW A;  3ON1 A;  1W2B F;  3NK6 A;  2BO1 A;  5HWE A;  4BVS A;  1N8R H;  1QVG F;  3VI6 A;  3NVI B;  3CCV F;  1VQ6 F;  1ZWZ A;  5HY0 A;  3LWR C;  3NMU C;  3OBY A;  3OBW A;  1Q82 H;  1RA4 A;  4EI8 A;  4X3L A;  4NQ3 A;  1VQP F;  3LWV C;  1YJW F;  1VQK F;  2F9Z C;  5HXU A;  3CPW F;  1VQM F;  3CCJ F;  3G71 F;  1JJ2 F;  3OW2 F;  3G4S F;  1YIJ F;  1DT9 A;  5HY4 A;  3I56 F;  2I6D A;  3I55 F;  3LFO A;  4EI9 A;  3SIV A;  1NJI H;  3SIU A;  1Q7Y H;  2LBW A;  3CC7 F;  2GLZ A;  4XCQ A;  1T0K B;  3IR9 A;  3CG6 A;  2AIF A;  3E20 B;  1RLG A;  3PAF A;  1X7P A;  5G4U C;  1X52 A;  1QVF F;  5GAN K;  3D00 A;  1K8A H;  3J80 M;  5GIN C;  1Q81 H;  2JNB A;  1CK2 A;  3CXC F;  2ALE A;  3CCM F;  1PXW A;  3CCU F;  2HVY D;  3CMA F;  4EI7 A;  3G6E F;  3CCR F;  3MCA B;  3N4Y A;  3CCE F;  3CCL F;  1KD1 H;  1S72 F;  2OZB A;  1E7K A;  5IT9 M;  5A2Q M;  1CN7 A;  5G4V C;  2KTU A;  3WXM B;  3JAM M;  3J81 M;  4BVR A;  2OTL F;  2VGN A;  2CZW A;  2KTV A;  3RA5 A;  3JCM M;  3CCS F;  3NVK E;  3V7E A;  1W41 A;  1YHQ F;  3AGK A;  5HY1 A;  1VQ5 F;  3LWQ C;  1VQN F;  1YJN F;  1KQS F;  2OTJ F;  3HJW C;  1H7M A;  1VQO F;  1W42 A;  3V3T A;  1KC8 H;  1GO0 A;  1K73 H;  3CCQ F;  3O85 A;  4TZZ A;  2WAL A;  1GO1 A;  4BVT A;  3CC2 F;  1W40 A;  5DCV A;  1XBI A;  1NMU B;  2FC3 A;  1YJ9 F;  1X7O A;  1VQ4 F;  2QA4 F;  5HY2 A;  1YIT F;  3N4Z A;  4NUT A;  3CC4 F;  1SDS A;  3LWO C;  1VQ9 F;  4X3M A;  4BW0 B;  4BVQ A;  3J7A R;  2QI2 A;  3CPQ A;  2VGM A;  1M90 H;  1YI2 F;  5HXZ A;  1GZ0 A;  5GIO C;  3V7Q A;  1VQ8 F;  3CME F;  1VQ7 F;  4BY9 D;  4LCK A;  4C4W C;  2QEX F;  2LBX A;  5GIP C;  3VMF B;  2FGY A;  1W3E X;  1Q86 H;  3NK7 A;  3GYQ A;  5EO3 A;  3RA6 A;  1VQL F;  3FFM A;  3CD6 F;  5EWR A;  1IPA A;  1M1K H;  3HAX D;  3PLA C;  3E1Y A;  1K9M H;  5FJ4 C;  3LWP C;  5GAP K;  5FLX M;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...