1NMUB

Mbp-l30
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose-binding periplasmic protein
publication title Inherent Protein Structural Flexibility at the RNA-binding Interface of L30e
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein/ribosome
total genus 34
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1nmuB00
1VQKF 1KQSF 1YJ9F 5GIOC 5G4UC 2KG4A 2OHWA 1YHQF 3CCVF 3CPQA 3JCMM 3G4SF 3CG6A 3MCAB 1RA4A 5FJ4C 3CCUF 1DT9A 1KC8H 3SIVA 2OTJF 1IPAA 1YI2F 3NK6A 4X3MA 3NMUC 1GO0A 1W41A 2QEXF 1QVGF 3CCMF 3G6EF 3SIUA 1Q7YH 1T0KB 2ALEA 2AIFA 3NVIB 1NJIH 3OBYA 1W3EX 1YJNF 3GYQA 1K8AH 1Q81H 1X7OA 3J80M 4LCKA 1VQPF 3LWRC 1W2BF 3E20B 2KTUA 1K73H 3AGKA 1CK2A 3ON1A 3CCLF 3CXCF 3HAXD 5EWRA 5G4VC 1VQMF 1YITF 3J81M 5GIPC 3I55F 1K9MH 1VQ8F 1GO1A 2QA4F 3RA6A 1XBIA 3RA5A 1YIJF 3CC7F 5GANK 3CCRF 1N8RH 1H7MA 1VQ9F 1JJ2F 5A2QM 2JNBA 1W40A 1VQOF 3IR9A 1PXWA 3G71F 1GZ0A 3LWPC 3CCEF 2OZBA 5FLXM 3JAMM 3V7EA 3LFOA 2I6DA 3CCQF 3OBWA 1E7KA 2HVYD 2KTVA 2LBXA 3I56F 3LWVC 5EO3A 3CMEF 5GAPK 3CCSF 4TZZA 3V7QA 2VGMA 1YJWF 1NMUB 1VQ7F 2WALA 4X3LA 3LWOC 1M90H 3CC4F 5DCVA 1VQLF 3HJWC 5IT9M 2VGNA 1X7PA 1VQ4F 1CN7A 3VMFB 1QVFF 3NK7A 4C4WC 1Q86H 3E1YA 1RLGA 2BO1A 3N4ZA 3CC2F 3OW2F 4BY9D 3WXMB 5GINC 1Q82H 4BW0B 1S72F 3J7AR 2FC3A 3PAFA 3CMAF 2CZWA 1KD1H 3PLAC 1VQ6F 2LBWA 3FFMA 2OTLF 1W42A 1M1KH 3LWQC 1VQ5F 4NUTA 3CCJF 2QI2A 3N4YA 1X52A 3CD6F 3NVKE 3VI6A 3O85A 1SDSA 3CPWF 1VQNF 1ZWZA
chains in the Genus database with same CATH superfamily
2CW4A 3WJQA 1VQKF 2ZVYA 3FD5A 4TUYA 1YHQF 3LYBA 3CPQA 5CA0B 3P10A 2H8CA 3WJRA 3C8LA 3RYIA 3BYQA 3ESJA 3F0EA 5ITZB 1YI2F 1RQ2A 3KE1A 4C82A 3NMUC 1W41A 3ZOPA 2QEXF 1Z5WA 2AMTA 5EZYB 3CCMF 3FD6A 3G6EF 4B62A 3ERNA 3SIUA 3WGKA 1NJIH 2RHOA 5LOVA 4LNUB 3B6NA 3WGJA 1YJNF 3FBAA 3OONA 1X7OA 4LCKA 4IHJB 4O2BB 1U3LA 1IV4A 3CCLF 2HS3A 5LYJA 1ONIA 4IIJA 4B46A 3I55F 3D00A 5JH7A 2HRUA 4HNAB 4I4TB 4RQOA 4BVRA 4EI7A 5IJ0A 4ZK7A 4X1KB 1XBIA 4BVTA 2Z1UA 1QAHA 4YJ3B 3RYHA 5HY0A 2ZODA 1TUBB 2L26A 4C8IA 4BT5A 4O2AB 3JARA 1W5AA 2LCAA 3CCEF 2CWJA 4B45A 3V7EA 3JAKA 3D01A 4ZOLA 3IKFA 2LBXA 4X20B 3VTIC 4WBNB 2HP0B 5EO3A 3CMEF 5LOVB 3RYCA 1VQVA 2WALA 4EI9A 1OAPA 3CC4F 5DCVA 1YQNA 3JAWB 1VQLF 3HJWC 1X7PA 3GTZA 3VMFB 2K1SA 5MN5A 1SZQA 1Q86H 5LA6A 4DRXA 2CHTA 1RLGA 1XRGA 3IEWA 3OW2F 2GZLA 1VK3A 3HKEB 3PAFA 3S02A 1PF5A 2PHNA 2H6LA 1KD1H 3RYHB 3MBMA 2OTLF 4NWOB 1JY8A 2QI2A 1DBFA 3HKBB 5KX5A 1OFUA 3N4YA 3N2GB 4ZHWA 1SDSA 3CPWF 1VQNF 5C8YB 5CA0A 3V4DA 4FFBA 2ZOVA 5HY4A 2Z1EA 5ITZA 2RHLA 3MDOA 2OHWA 3CCVF 2CHSA 3G4SF 4PWTA 5EZYA 3KHNA 4I50B 3S06A 5FJ4C 4U3JB 1KC8H 5LA6B 5B8FA 4DRXB 3DC2A 4X3MA 4LNUA 1GO0A 1RLUA 2AIZP 1QD9A 4U39A 2BTUA 4O2BA 4ZHVA 1Q7YH 1IV2A 2AIFA 5HXZA 5EAZA 1W3EX 5KX5B 1K8AH 3QUWA 3JATB 4HNAA 4I4TA 3J80M 3LWRC 4X1KA 1K73H 1CK2A 1RQ7A 4FFBB 4YJ3A 2ZF8A 4R40B 5G4VC 2BTQB 3J81M 3VYTC 2Q1XA 1TUBA 3KJJA 4TV9B 1SA0B 1GO1A 2HP3A 4O2AA 5MN6A 2VAWA 5CB4B 1CLIA 1FSZA 3CC7F 5GANK 2RB9A 3ELCA 4X20A 1VQ9F 3T80A 4WBNA 2HP0A 2BTOA 2JNBA 1W40A 3VO8A 3IR9A 3G71F 1GZ0A 3K2XA 2UYPA 3JAWA 3OBWA 3QTYA 1E7KA 2KTVA 1JN1A 3I3FA 3I56F 5AVMA 4BT2A 4G4ZA 5LP6C 5LXTB 5JVDB 3CCSF 4TZZA 3TD5A 2ZAUA 4DXDA 1U3PA 2LBTA 3VOBA 4O4IB 4X3LA 3HKEA 1T0AA 1VQ4F 2UYKA 2HX0A 2OTMA 3M4SA 4ZHYB 2HQSC 1R1MA 2VAPA 3HKBA 3N4ZA 3CC2F 3K14A 3N2GA 2DT4A 4BT6A 1W5FA 1NQ3A 3S0YA 2R6R1 5C8YA 3PLAC 5BMVB 3GHZA 4BVQA 1QU9A 3FFMA 3S03A 2MQEA 1M1KH 4NUTA 3KIZA 3IEQA 5FNVB 1VH8A 3WJPA 3CD6F 5IYZB 2UZHA 5LP6B 3S0HA 2N48A 2HS4A 1ZWZA 4I50A 4U3JA 2IQQA 2HRYA 2Q1YA 4XCQA 5G4UC 2KG4A 3JCMM 2CSLA 2UYNB 3CG6A 3HWUA 2P6YA 3MCAB 1UFYA 1H48A 3IKEA 3SIVA 1IPAA 4EI8A 1W57A 2PMPA 3JATA 1JD1A 2I6RA 1XHOA 4X1IB 4G4VA 1ODEA 4F6RA 2ALEA 4ZI7B 1W55A 3HTNA 3U0OA 3OBYA 3LDTA 3RE3A 3HKDB 3GYQA 4TV8B 3JALB 4M8IA 1Q81H 1VHAA 3JVHA 1SA0A 4TV9A 2RHHA 5CB4A 3C9TA 4BT3A 3E20B 3AGKA 3ON1A 3WGMA 3CXCF 3HAXD 3P0ZA 1TVKB 1W59A 4G4XA 2GLZA 1VQMF 1YITF 5GIPC 2QTPA 1K9MH 5HY2A 3RYFA 3UT5B 2QA4F 3RA5A 1YIJF 5JCOC 2YXZA 1W5BA 4YJ2A 3CCRF 4EB6B 3WGNA 4E6EA 1H7MA 3F0FA 5IJ9B 4I55B 5EYPB 1H47A 1FNJA 2DYYA 4KWEA 5LXTA 5JVDA 1PXWA 1JFFA 3LWPC 4O4IA 1GX1A 1FNKA 3CCQF 2HVYD 4F6RB 1KNKA 4O4JB 3VCZA 3LWVC 5HP8A 5GAPK 4B5CA 2VGMA 4ZHQA 1YJWF 1VQ7F 2F9ZC 1M90H 5EIBC 2VGNA 1YGYA 3TD4A 3NK7A 3E22A 5HP7A 4C4WC 5BMVA 4C8GA 3E1YA 2HS0A 4G4YA 5MN4A 3CYPB 3M1XA 5J2UB 1UI9A 5J2TB 3RYFB 5FNVA 1W5EA 3WXMB 5GINC 4BW0B 1S72F 4X1YA 2KGWA 5IYZA 2FC3A 3J7AR 5LP6A 2CZWA 4YJ2B 3WPWA 1VQ6F 2LBWA 3HKCA 3VYUC 5GONB 3CB2A 3LWQC 3LMEA 2H8EA 3S0WA 1X52A 5EB0A 3WGLA 1JFFB 3NVKE 5CA1B 5HY1A 1J7HA 2VXYA 2UYNA 3L7QA 1KQSF 4C8EA 2G9IA 1YJ9F 5GIOC 2CVLA 4ZHQB 5EIBD 2IG8A 3C9SA 4BT4A 3KJKA 2Z01A 4X1IA 3VOAA 1RA4A 3E22B 4O4LA 3CCUF 1DT9A 2RHJA 2ZVZA 4ZI7A 2OTJF 3WPXA 3ZO8A 3NK6A 4TUYB 3HKDA 4BT7A 3R0PA 4TV8A 5KMGA 3JALA 2EWCA 3VIUA 2FGYA 2Z1TA 1QVGF 3I7TA 4X1YB 5HWEA 3HKCB 1IV1A 3RYIB 1T0KB 1KNJA 3NVIB 2GVIA 1TVKA 2IAFA 3D54A 3V3TA 1FFXA 3UT5A 1X25A 1VQPF 2Z1FA 4O4HA 1W2BF 2KTUA 3TD3A 5EWRA 4EB6A 3F6MA 5IJ9A 4I55A 5EYPA 4C81A 1VQ8F 3RA6A 3FPIA 3IMPA 3N2KA 3MCQA 3JASA 3VYSC 1N8RH 4O4LB 5LYJB 4IIJB 4O4JA 1JJ2F 1Z5VA 5JH7B 3F0DA 5A2QM 1W581 5IJ0B 1VQOF 5EB1B 5JQGA 5KMGB 1XV2A 3C9UA 2VAMA 1IV3A 2OZBA 5FLXM 3JAMM 3LFOA 2I6DA 3K12A 3C9RA 3P4EA 3K0TA 4NQ3A 3Q8HA 5JCOA 1COMA 1FFXB 2R751 3JARB 3V7QA 5J2UA 5J2TA 3ZP4A 3EORA 1NMUB 3LWOC 3DDNA 3JAKB 4O4HB 2YYEA 4ZOLB 5IT9M 1CN7A 2W8BC 4ERHA 3CYQA 1QVFF 3F0GA 5GONA 3RYCB 1Q8RA 2UYJA 3M84A 2BO1A 2NMUA 3ZP7A 4RHAA 4BY9D 1U43A 1Q82H 3N2KB 3CMAF 5CA1A 3JASB 4G88A 2B33A 1W42A 1VQ5F 3CCJF 5JQGB 3MQWA 4BVSA 4G4WA 4IHJA 3VI6A 3O85A 5HXUA 2V9YA 1U40A 3QHDA
chains in the Genus database with same CATH topology
5HY1A 1VQKF 5HY4A 1KQSF 1YJ9F 5GIOC 4XCQA 5G4UC 2KG4A 2OHWA 1YHQF 3CCVF 3CPQA 3JCMM 3G4SF 3CG6A 3MCAB 1RA4A 5FJ4C 3CCUF 1DT9A 1KC8H 3SIVA 2OTJF 1IPAA 1YI2F 3NK6A 4EI8A 4X3MA 3NMUC 1GO0A 1W41A 2QEXF 1QVGF 2FGYA 3CCMF 5HWEA 3G6EF 3SIUA 1Q7YH 1T0KB 2ALEA 2AIFA 5HXZA 3NVIB 1NJIH 3OBYA 1W3EX 1YJNF 3V3TA 3GYQA 1K8AH 1Q81H 1X7OA 3J80M 4LCKA 1VQPF 3LWRC 1W2BF 3E20B 2KTUA 1K73H 3AGKA 1CK2A 3ON1A 3CCLF 3CXCF 3HAXD 5EWRA 2GLZA 5G4VC 1VQMF 1YITF 3J81M 5GIPC 3I55F 3D00A 1K9MH 5HY2A 4BVRA 4EI7A 1VQ8F 1GO1A 2QA4F 3RA6A 1XBIA 3RA5A 4BVTA 1YIJF 3CC7F 5GANK 3CCRF 5HY0A 1N8RH 1H7MA 1VQ9F 1JJ2F 5A2QM 2JNBA 1W40A 1VQOF 3IR9A 1PXWA 3G71F 1GZ0A 3LWPC 3CCEF 2OZBA 5FLXM 3JAMM 3V7EA 3LFOA 2I6DA 3CCQF 3OBWA 1E7KA 2HVYD 2KTVA 2LBXA 3I56F 3LWVC 5EO3A 4NQ3A 3CMEF 5GAPK 3CCSF 4TZZA 3V7QA 2VGMA 1YJWF 1NMUB 1VQ7F 2WALA 2F9ZC 4X3LA 4EI9A 3LWOC 1M90H 3CC4F 5DCVA 1VQLF 3HJWC 5IT9M 2VGNA 1X7PA 1VQ4F 1CN7A 3VMFB 1QVFF 3NK7A 4C4WC 1Q86H 3E1YA 1RLGA 2BO1A 3N4ZA 3CC2F 3OW2F 4BY9D 3WXMB 5GINC 1Q82H 4BW0B 1S72F 3J7AR 2FC3A 3PAFA 3CMAF 2CZWA 1KD1H 3PLAC 1VQ6F 2LBWA 4BVQA 3FFMA 2OTLF 1W42A 1M1KH 3LWQC 1VQ5F 4NUTA 3CCJF 2QI2A 3N4YA 1X52A 3CD6F 5HXUA 4BVSA 3NVKE 3VI6A 3O85A 1SDSA 3CPWF 1VQNF 1ZWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK F;  1KQS F;  1YJ9 F;  5GIO C;  5G4U C;  2KG4 A;  2OHW A;  1YHQ F;  3CCV F;  3CPQ A;  3JCM M;  3G4S F;  3CG6 A;  3MCA B;  1RA4 A;  5FJ4 C;  3CCU F;  1DT9 A;  1KC8 H;  3SIV A;  2OTJ F;  1IPA A;  1YI2 F;  3NK6 A;  4X3M A;  3NMU C;  1GO0 A;  1W41 A;  2QEX F;  1QVG F;  3CCM F;  3G6E F;  3SIU A;  1Q7Y H;  1T0K B;  2ALE A;  2AIF A;  3NVI B;  1NJI H;  3OBY A;  1W3E X;  1YJN F;  3GYQ A;  1K8A H;  1Q81 H;  1X7O A;  3J80 M;  4LCK A;  1VQP F;  3LWR C;  1W2B F;  3E20 B;  2KTU A;  1K73 H;  3AGK A;  1CK2 A;  3ON1 A;  3CCL F;  3CXC F;  3HAX D;  5EWR A;  5G4V C;  1VQM F;  1YIT F;  3J81 M;  5GIP C;  3I55 F;  1K9M H;  1VQ8 F;  1GO1 A;  2QA4 F;  3RA6 A;  1XBI A;  3RA5 A;  1YIJ F;  3CC7 F;  5GAN K;  3CCR F;  1N8R H;  1H7M A;  1VQ9 F;  1JJ2 F;  5A2Q M;  2JNB A;  1W40 A;  1VQO F;  3IR9 A;  1PXW A;  3G71 F;  1GZ0 A;  3LWP C;  3CCE F;  2OZB A;  5FLX M;  3JAM M;  3V7E A;  3LFO A;  2I6D A;  3CCQ F;  3OBW A;  1E7K A;  2HVY D;  2KTV A;  2LBX A;  3I56 F;  3LWV C;  5EO3 A;  3CME F;  5GAP K;  3CCS F;  4TZZ A;  3V7Q A;  2VGM A;  1YJW F;  1NMU B;  1VQ7 F;  2WAL A;  4X3L A;  3LWO C;  1M90 H;  3CC4 F;  5DCV A;  1VQL F;  3HJW C;  5IT9 M;  2VGN A;  1X7P A;  1VQ4 F;  1CN7 A;  3VMF B;  1QVF F;  3NK7 A;  4C4W C;  1Q86 H;  3E1Y A;  1RLG A;  2BO1 A;  3N4Z A;  3CC2 F;  3OW2 F;  4BY9 D;  3WXM B;  5GIN C;  1Q82 H;  4BW0 B;  1S72 F;  3J7A R;  2FC3 A;  3PAF A;  3CMA F;  2CZW A;  1KD1 H;  3PLA C;  1VQ6 F;  2LBW A;  3FFM A;  2OTL F;  1W42 A;  1M1K H;  3LWQ C;  1VQ5 F;  4NUT A;  3CCJ F;  2QI2 A;  3N4Y A;  1X52 A;  3CD6 F;  3NVK E;  3VI6 A;  3O85 A;  1SDS A;  3CPW F;  1VQN F;  1ZWZ A; 
#chains in the Genus database with same CATH topology
 2CW4 A;  3WJQ A;  1VQK F;  2ZVY A;  3FD5 A;  4TUY A;  1YHQ F;  3LYB A;  3CPQ A;  5CA0 B;  3P10 A;  2H8C A;  3WJR A;  3C8L A;  3RYI A;  3BYQ A;  3ESJ A;  3F0E A;  5ITZ B;  1YI2 F;  1RQ2 A;  3KE1 A;  4C82 A;  3NMU C;  1W41 A;  3ZOP A;  2QEX F;  1Z5W A;  2AMT A;  5EZY B;  3CCM F;  3FD6 A;  3G6E F;  4B62 A;  3ERN A;  3SIU A;  3WGK A;  1NJI H;  2RHO A;  5LOV A;  4LNU B;  3B6N A;  3WGJ A;  1YJN F;  3FBA A;  3OON A;  1X7O A;  4LCK A;  4IHJ B;  4O2B B;  1U3L A;  1IV4 A;  3CCL F;  2HS3 A;  5LYJ A;  1ONI A;  4IIJ A;  4B46 A;  3I55 F;  3D00 A;  5JH7 A;  2HRU A;  4HNA B;  4I4T B;  4RQO A;  4BVR A;  4EI7 A;  5IJ0 A;  4ZK7 A;  4X1K B;  1XBI A;  4BVT A;  2Z1U A;  1QAH A;  4YJ3 B;  3RYH A;  5HY0 A;  2ZOD A;  1TUB B;  2L26 A;  4C8I A;  4BT5 A;  4O2A B;  3JAR A;  1W5A A;  2LCA A;  3CCE F;  2CWJ A;  4B45 A;  3V7E A;  3JAK A;  3D01 A;  4ZOL A;  3IKF A;  2LBX A;  4X20 B;  3VTI C;  4WBN B;  2HP0 B;  5EO3 A;  3CME F;  5LOV B;  3RYC A;  1VQV A;  2WAL A;  4EI9 A;  1OAP A;  3CC4 F;  5DCV A;  1YQN A;  3JAW B;  1VQL F;  3HJW C;  1X7P A;  3GTZ A;  3VMF B;  2K1S A;  5MN5 A;  1SZQ A;  1Q86 H;  5LA6 A;  4DRX A;  2CHT A;  1RLG A;  1XRG A;  3IEW A;  3OW2 F;  2GZL A;  1VK3 A;  3HKE B;  3PAF A;  3S02 A;  1PF5 A;  2PHN A;  2H6L A;  1KD1 H;  3RYH B;  3MBM A;  2OTL F;  4NWO B;  1JY8 A;  2QI2 A;  1DBF A;  3HKB B;  5KX5 A;  1OFU A;  3N4Y A;  3N2G B;  4ZHW A;  1SDS A;  3CPW F;  1VQN F;  5C8Y B;  5CA0 A;  3V4D A;  4FFB A;  2ZOV A;  5HY4 A;  2Z1E A;  5ITZ A;  2RHL A;  3MDO A;  2OHW A;  3CCV F;  2CHS A;  3G4S F;  4PWT A;  5EZY A;  3KHN A;  4I50 B;  3S06 A;  5FJ4 C;  4U3J B;  1KC8 H;  5LA6 B;  5B8F A;  4DRX B;  3DC2 A;  4X3M A;  4LNU A;  1GO0 A;  1RLU A;  2AIZ P;  1QD9 A;  4U39 A;  2BTU A;  4O2B A;  4ZHV A;  1Q7Y H;  1IV2 A;  2AIF A;  5HXZ A;  5EAZ A;  1W3E X;  5KX5 B;  1K8A H;  3QUW A;  3JAT B;  4HNA A;  4I4T A;  3J80 M;  3LWR C;  4X1K A;  1K73 H;  1CK2 A;  1RQ7 A;  4FFB B;  4YJ3 A;  2ZF8 A;  4R40 B;  5G4V C;  2BTQ B;  3J81 M;  3VYT C;  2Q1X A;  1TUB A;  3KJJ A;  4TV9 B;  1SA0 B;  1GO1 A;  2HP3 A;  4O2A A;  5MN6 A;  2VAW A;  5CB4 B;  1CLI A;  1FSZ A;  3CC7 F;  5GAN K;  2RB9 A;  3ELC A;  4X20 A;  1VQ9 F;  3T80 A;  4WBN A;  2HP0 A;  2BTO A;  2JNB A;  1W40 A;  3VO8 A;  3IR9 A;  3G71 F;  1GZ0 A;  3K2X A;  2UYP A;  3JAW A;  3OBW A;  3QTY A;  1E7K A;  2KTV A;  1JN1 A;  3I3F A;  3I56 F;  5AVM A;  4BT2 A;  4G4Z A;  5LP6 C;  5LXT B;  5JVD B;  3CCS F;  4TZZ A;  3TD5 A;  2ZAU A;  4DXD A;  1U3P A;  2LBT A;  3VOB A;  4O4I B;  4X3L A;  3HKE A;  1T0A A;  1VQ4 F;  2UYK A;  2HX0 A;  2OTM A;  3M4S A;  4ZHY B;  2HQS C;  1R1M A;  2VAP A;  3HKB A;  3N4Z A;  3CC2 F;  3K14 A;  3N2G A;  2DT4 A;  4BT6 A;  1W5F A;  1NQ3 A;  3S0Y A;  2R6R 1;  5C8Y A;  3PLA C;  5BMV B;  3GHZ A;  4BVQ A;  1QU9 A;  3FFM A;  3S03 A;  2MQE A;  1M1K H;  4NUT A;  3KIZ A;  3IEQ A;  5FNV B;  1VH8 A;  3WJP A;  3CD6 F;  5IYZ B;  2UZH A;  5LP6 B;  3S0H A;  2N48 A;  2HS4 A;  1ZWZ A;  4I50 A;  4U3J A;  2IQQ A;  2HRY A;  2Q1Y A;  4XCQ A;  5G4U C;  2KG4 A;  3JCM M;  2CSL A;  2UYN B;  3CG6 A;  3HWU A;  2P6Y A;  3MCA B;  1UFY A;  1H48 A;  3IKE A;  3SIV A;  1IPA A;  4EI8 A;  1W57 A;  2PMP A;  3JAT A;  1JD1 A;  2I6R A;  1XHO A;  4X1I B;  4G4V A;  1ODE A;  4F6R A;  2ALE A;  4ZI7 B;  1W55 A;  3HTN A;  3U0O A;  3OBY A;  3LDT A;  3RE3 A;  3HKD B;  3GYQ A;  4TV8 B;  3JAL B;  4M8I A;  1Q81 H;  1VHA A;  3JVH A;  1SA0 A;  4TV9 A;  2RHH A;  5CB4 A;  3C9T A;  4BT3 A;  3E20 B;  3AGK A;  3ON1 A;  3WGM A;  3CXC F;  3HAX D;  3P0Z A;  1TVK B;  1W59 A;  4G4X A;  2GLZ A;  1VQM F;  1YIT F;  5GIP C;  2QTP A;  1K9M H;  5HY2 A;  3RYF A;  3UT5 B;  2QA4 F;  3RA5 A;  1YIJ F;  5JCO C;  2YXZ A;  1W5B A;  4YJ2 A;  3CCR F;  4EB6 B;  3WGN A;  4E6E A;  1H7M A;  3F0F A;  5IJ9 B;  4I55 B;  5EYP B;  1H47 A;  1FNJ A;  2DYY A;  4KWE A;  5LXT A;  5JVD A;  1PXW A;  1JFF A;  3LWP C;  4O4I A;  1GX1 A;  1FNK A;  3CCQ F;  2HVY D;  4F6R B;  1KNK A;  4O4J B;  3VCZ A;  3LWV C;  5HP8 A;  5GAP K;  4B5C A;  2VGM A;  4ZHQ A;  1YJW F;  1VQ7 F;  2F9Z C;  1M90 H;  5EIB C;  2VGN A;  1YGY A;  3TD4 A;  3NK7 A;  3E22 A;  5HP7 A;  4C4W C;  5BMV A;  4C8G A;  3E1Y A;  2HS0 A;  4G4Y A;  5MN4 A;  3CYP B;  3M1X A;  5J2U B;  1UI9 A;  5J2T B;  3RYF B;  5FNV A;  1W5E A;  3WXM B;  5GIN C;  4BW0 B;  1S72 F;  4X1Y A;  2KGW A;  5IYZ A;  2FC3 A;  3J7A R;  5LP6 A;  2CZW A;  4YJ2 B;  3WPW A;  1VQ6 F;  2LBW A;  3HKC A;  3VYU C;  5GON B;  3CB2 A;  3LWQ C;  3LME A;  2H8E A;  3S0W A;  1X52 A;  5EB0 A;  3WGL A;  1JFF B;  3NVK E;  5CA1 B;  5HY1 A;  1J7H A;  2VXY A;  2UYN A;  3L7Q A;  1KQS F;  4C8E A;  2G9I A;  1YJ9 F;  5GIO C;  2CVL A;  4ZHQ B;  5EIB D;  2IG8 A;  3C9S A;  4BT4 A;  3KJK A;  2Z01 A;  4X1I A;  3VOA A;  1RA4 A;  3E22 B;  4O4L A;  3CCU F;  1DT9 A;  2RHJ A;  2ZVZ A;  4ZI7 A;  2OTJ F;  3WPX A;  3ZO8 A;  3NK6 A;  4TUY B;  3HKD A;  4BT7 A;  3R0P A;  4TV8 A;  5KMG A;  3JAL A;  2EWC A;  3VIU A;  2FGY A;  2Z1T A;  1QVG F;  3I7T A;  4X1Y B;  5HWE A;  3HKC B;  1IV1 A;  3RYI B;  1T0K B;  1KNJ A;  3NVI B;  2GVI A;  1TVK A;  2IAF A;  3D54 A;  3V3T A;  1FFX A;  3UT5 A;  1X25 A;  1VQP F;  2Z1F A;  4O4H A;  1W2B F;  2KTU A;  3TD3 A;  5EWR A;  4EB6 A;  3F6M A;  5IJ9 A;  4I55 A;  5EYP A;  4C81 A;  1VQ8 F;  3RA6 A;  3FPI A;  3IMP A;  3N2K A;  3MCQ A;  3JAS A;  3VYS C;  1N8R H;  4O4L B;  5LYJ B;  4IIJ B;  4O4J A;  1JJ2 F;  1Z5V A;  5JH7 B;  3F0D A;  5A2Q M;  1W58 1;  5IJ0 B;  1VQO F;  5EB1 B;  5JQG A;  5KMG B;  1XV2 A;  3C9U A;  2VAM A;  1IV3 A;  2OZB A;  5FLX M;  3JAM M;  3LFO A;  2I6D A;  3K12 A;  3C9R A;  3P4E A;  3K0T A;  4NQ3 A;  3Q8H A;  5JCO A;  1COM A;  1FFX B;  2R75 1;  3JAR B;  3V7Q A;  5J2U A;  5J2T A;  3ZP4 A;  3EOR A;  1NMU B;  3LWO C;  3DDN A;  3JAK B;  4O4H B;  2YYE A;  4ZOL B;  5IT9 M;  1CN7 A;  2W8B C;  4ERH A;  3CYQ A;  1QVF F;  3F0G A;  5GON A;  3RYC B;  1Q8R A;  2UYJ A;  3M84 A;  2BO1 A;  2NMU A;  3ZP7 A;  4RHA A;  4BY9 D;  1U43 A;  1Q82 H;  3N2K B;  3CMA F;  5CA1 A;  3JAS B;  4G88 A;  2B33 A;  1W42 A;  1VQ5 F;  3CCJ F;  5JQG B;  3MQW A;  4BVS A;  4G4W A;  4IHJ A;  3VI6 A;  3O85 A;  5HXU A;  2V9Y A;  1U40 A;  3QHD A; 
#chains in the Genus database with same CATH homology
 5HY1 A;  1VQK F;  5HY4 A;  1KQS F;  1YJ9 F;  5GIO C;  4XCQ A;  5G4U C;  2KG4 A;  2OHW A;  1YHQ F;  3CCV F;  3CPQ A;  3JCM M;  3G4S F;  3CG6 A;  3MCA B;  1RA4 A;  5FJ4 C;  3CCU F;  1DT9 A;  1KC8 H;  3SIV A;  2OTJ F;  1IPA A;  1YI2 F;  3NK6 A;  4EI8 A;  4X3M A;  3NMU C;  1GO0 A;  1W41 A;  2QEX F;  1QVG F;  2FGY A;  3CCM F;  5HWE A;  3G6E F;  3SIU A;  1Q7Y H;  1T0K B;  2ALE A;  2AIF A;  5HXZ A;  3NVI B;  1NJI H;  3OBY A;  1W3E X;  1YJN F;  3V3T A;  3GYQ A;  1K8A H;  1Q81 H;  1X7O A;  3J80 M;  4LCK A;  1VQP F;  3LWR C;  1W2B F;  3E20 B;  2KTU A;  1K73 H;  3AGK A;  1CK2 A;  3ON1 A;  3CCL F;  3CXC F;  3HAX D;  5EWR A;  2GLZ A;  5G4V C;  1VQM F;  1YIT F;  3J81 M;  5GIP C;  3I55 F;  3D00 A;  1K9M H;  5HY2 A;  4BVR A;  4EI7 A;  1VQ8 F;  1GO1 A;  2QA4 F;  3RA6 A;  1XBI A;  3RA5 A;  4BVT A;  1YIJ F;  3CC7 F;  5GAN K;  3CCR F;  5HY0 A;  1N8R H;  1H7M A;  1VQ9 F;  1JJ2 F;  5A2Q M;  2JNB A;  1W40 A;  1VQO F;  3IR9 A;  1PXW A;  3G71 F;  1GZ0 A;  3LWP C;  3CCE F;  2OZB A;  5FLX M;  3JAM M;  3V7E A;  3LFO A;  2I6D A;  3CCQ F;  3OBW A;  1E7K A;  2HVY D;  2KTV A;  2LBX A;  3I56 F;  3LWV C;  5EO3 A;  4NQ3 A;  3CME F;  5GAP K;  3CCS F;  4TZZ A;  3V7Q A;  2VGM A;  1YJW F;  1NMU B;  1VQ7 F;  2WAL A;  2F9Z C;  4X3L A;  4EI9 A;  3LWO C;  1M90 H;  3CC4 F;  5DCV A;  1VQL F;  3HJW C;  5IT9 M;  2VGN A;  1X7P A;  1VQ4 F;  1CN7 A;  3VMF B;  1QVF F;  3NK7 A;  4C4W C;  1Q86 H;  3E1Y A;  1RLG A;  2BO1 A;  3N4Z A;  3CC2 F;  3OW2 F;  4BY9 D;  3WXM B;  5GIN C;  1Q82 H;  4BW0 B;  1S72 F;  3J7A R;  2FC3 A;  3PAF A;  3CMA F;  2CZW A;  1KD1 H;  3PLA C;  1VQ6 F;  2LBW A;  4BVQ A;  3FFM A;  2OTL F;  1W42 A;  1M1K H;  3LWQ C;  1VQ5 F;  4NUT A;  3CCJ F;  2QI2 A;  3N4Y A;  1X52 A;  3CD6 F;  5HXU A;  4BVS A;  3NVK E;  3VI6 A;  3O85 A;  1SDS A;  3CPW F;  1VQN F;  1ZWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...