3KJKA

Crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (monoclinic crystal form)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
MDIRYFGTTPRYSEAVGANGLIFLSGMVPENGETAAEQTADVLAQIDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARPEWRVEIKITAVKRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMB1025 protein
publication title Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Unknown function
total genus 33
structure length 116
sequence length 116
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3kjkA00
1UI9A 1J7HA 1COMA 2UYNB 3ZP4A 4ZK7A 1QD9A 3MQWA 3ZP7A 1DBFA 3ZOPA 1XHOA 2UYKA 3D01A 2UYPA 2CHTA 3R0PA 2UYNA 2CWJA 3M1XA 1NQ3A 1JD1A 3LYBA 5HP7A 5HP8A 2UYJA 3LMEA 2OTMA 3KJJA 1ODEA 1FNKA 1QAHA 4NWOB 3GTZA 3QUWA 3I3FA 3I7TA 2CVLA 1X25A 1QU9A 1FNJA 2CHSA 1PF5A 1ONIA 1UFYA 3K0TA 3M4SA 3V4DA 2IG8A 3VCZA 3KJKA 2B33A 2CSLA 1XRGA 2EWCA 3ZO8A 3K12A 2DYYA 3L7QA 2CW4A
chains in the Genus database with same CATH superfamily
4O4JA 1KNJA 4G4YA 5IJ0B 1X7PA 4HNAA 4TV8B 1W2BF 1Q81H 3N2GA 3HKBA 3LWVC 4O4IA 3CMAF 1N8RH 1W5AA 4TV9B 5HY2A 1RLGA 3MCAB 5J2UB 4X20B 1H48A 2HS0A 2FGYA 3E22B 3C9TA 3GHZA 5EYPA 1W40A 1IPAA 1IV1A 2RHLA 5FJ4C 3CPWF 3HAXD 3V7QA 4C8GA 1XBIA 3HKDB 4E6EA 5JH7A 1IV4A 1TVKA 2OZBA 2VXYA 3RE3A 4EB6B 5GINC 2IQQA 3CG6A 2JNBA 3WGKA 5G4UC 1SA0A 3WPXA 3RYHA 2OTJF 3JASA 3ON1A 3IKEA 5LYJA 3V4DA 4U39A 3E1YA 3I55F 2ZVZA 4O2AB 1XV2A 3F0DA 4LCKA 2KG4A 2VGMA 1YJWF 3AGKA 3IKFA 4NQ3A 3HKEB 1H7MA 3B6NA 5C8YB 1YGYA 3FD5A 4PWTA 4FFBA 4IHJA 3V7EA 2KTVA 3HKCB 2F9ZC 2H8EA 3F0GA 3U0OA 3RYCB 1M90H 5A2QM 3LMEA 5JVDB 3P10A 3VOAA 1FNKA 2RHJA 2KTUA 3ESJA 1YITF 3G4SF 5GAPK 1W5FA 5BMVA 3BYQA 2H6LA 3D00A 3F0FA 3N4YA 4C4WC 4O4HA 3S0WA 1RA4A 1UI9A 2I6DA 5CA0A 1X52A 2W8BC 1COMA 3VYSC 3LFOA 3JALB 3ZP7A 1VQ7F 3CPQA 5HXUA 3OONA 2UZHA 3HJWC 3LYBA 1S72F 5IJ0A 3V3TA 2HP0B 4EI9A 4TV8A 1JFFB 5HY4A 3CD6F 5EO3A 5GIOC 2VAPA 3C9SA 3CCMF 3VOBA 2Z1FA 1VQVA 3WGMA 4TV9A 2R751 4X20A 5FNVB 3LWRC 2H8CA 3E22A 2RHHA 4M8IA 4C81A 3MCQA 4ZK7A 1QVGF 2ZAUA 2VAWA 4TZZA 1TUBB 1M1KH 4B46A 4RHAA 5GANK 2Z1UA 4X1KB 2CWJA 4ZI7B 2HP3A 3C9RA 4BT6A 4EB6A 2ZF8A 5CA1B 3WGLA 2CVLA 2YYEA 5LXTB 5EIBD 3S06A 3T80A 2B33A 1T0KB 2KGWA 5EWRA 3G71F 4BVRA 3ZP4A 4O2AA 2G9IA 3KE1A 1RQ7A 3IEWA 1VQLF 3CB2A 1OAPA 5HP7A 3F0EA 5HP8A 3HKEA 1JJ2F 4NWOB 5C8YA 1FFXB 3HKCA 1X25A 3N4ZA 4G4ZA 5B8FA 3RYCA 5JVDA 5LP6B 3CC7F 1VQ6F 3EORA 2N48A 1JN1A 4LNUA 1W59A 3IMPA 5GIPC 3OBWA 2DT4A 3FFMA 3K14A 5JCOA 3FBAA 2VAMA 3OW2F 1JD1A 3E20B 4X3LA 3JALA 2PHNA 5FLXM 1VK3A 2RHOA 1IV3A 2K1SA 1W57A 3GYQA 2HP0A 1JFFA 5LA6B 3Q8HA 5EIBC 2NMUA 3TD5A 1KQSF 3F6MA 1KNKA 3JAKB 2BTQB 3RA6A 1YJNF 3RYIB 3JVHA 3G6EF 5FNVA 2Q1XA 3P4EA 3J81M 1RQ2A 3NVKE 1W5BA 1VQPF 4ZHYB 3HTNA 3D54A 2HS4A 4X3MA 1TUBA 3KJJA 4EI8A 3C8LA 3JAWB 1YQNA 4X1KA 3QUWA 2BTUA 3MBMA 4ZI7A 3VTIC 5CA1A 5EAZA 3DC2A 4B45A 1VQNF 3S0YA 3CCVF 1U43A 1YI2F 2ZOVA 5LXTA 1KC8H 1NMUB 3TD3A 1VQ8F 2CW4A 3PAFA 3M84A 4I50B 4EI7A 2HS3A 2UYKA 5IJ9B 2UYPA 2Z1EA 1KD1H 1K9MH 3WGNA 5EZYB 4KWEA 1Q86H 2HRYA 3UT5B 3JCMM 1ONIA 1Z5WA 2Z01A 1K8AH 3CYPB 3SIUA 1FFXA 1CK2A 4ZOLB 5J2UA 1NJIH 5LP6A 4YJ3B 1GO1A 4X1IB 2VGNA 1VQ4F 3S02A 4U3JB 5MN5A 1CN7A 4BVSA 3HKDA 4ZHQB 2UYJA 5AVMA 3LWOC 2BTOA 1QAHA 1Z5VA 3QHDA 4ZHVA 4R40B 4F6RB 5G4VC 3PLAC 5IT9M 1DT9A 3CC2F 2QEXF 3J80M 3VCZA 3CXCF 4B5CA 4YJ2B 2LBTA 2EWCA 1VQ5F 3K2XA 3VMFB 1VQOF 2HRUA 3MDOA 3RYFB 1ZWZA 3VO8A 5DCVA 5LA6A 3CCQF 1OFUA 3CCRF 1QD9A 3ERNA 3VI6A 1K73H 4I55B 4C8IA 2PMPA 2YXZA 3NK7A 3JAKA 2CHTA 3KHNA 5JQGB 4G4WA 1NQ3A 2AIZP 3CCEF 1JY8A 3RYIA 2BO1A 3CCUF 4O2BB 3GTZA 1SZQA 3NMUC 3FPIA 5CB4B 1W55A 4C8EA 5MN4A 3JAWA 5IYZB 3CC4F 4I4TB 2R6R1 1GO0A 2GZLA 1RLUA 3IEQA 3S0HA 2HX0A 5HWEA 4XCQA 3VYTC 4NUTA 2Q1YA 1H47A 1CLIA 2UYNB 2LBXA 3QTYA 4IIJB 1DBFA 5JCOC 1XHOA 3VIUA 3WPWA 1GX1A 2LBWA 1Q8RA 2LCAA 3N2KB 5KX5B 3WXMB 1YJ9F 4I50A 4BT5A 4BT2A 3KIZA 5HY1A 5IJ9A 1ODEA 5J2TB 2P6YA 5ITZB 3O85A 3I7TA 5EZYA 1QU9A 1FNJA 1IV2A 3ELCA 3M4SA 4X1YB 2MQEA 2CZWA 3UT5A 5KMGB 2OHWA 4O4LB 2OTLF 1XRGA 4WBNB 4ZHWA 4BVQA 2QTPA 1Q7YH 4ERHA 4TUYB 4ZOLA 3JARB 4RQOA 5LOVB 1X7OA 2Z1TA 4YJ3A 5GONB 4X1IA 2I6RA 4U3JA 1YIJF 3JATB 4ZHQA 3TD4A 4DRXB 3JAMM 2CHSA 1PF5A 1W581 2WALA 1T0AA 2V9YA 4O4JB 1QVFF 1W3EX 1U3LA 3WJQA 3RA5A 4HNAB 4DXDA 4F6RA 3OBYA 2AIFA 3N2GB 3HKBB 3IR9A 4O4IB 4YJ2A 3LWPC 3D01A 3RYFA 4BVTA 3R0PA 4BW0B 3VYUC 1VQ9F 4I55A 2OTMA 3CYQA 5EYPB 4G4XA 4BT3A 5JQGA 3I3FA 3CCSF 4LNUB 3K0TA 1U40A 1U3PA 3CMEF 4O2BA 1Q82H 2FC3A 2IG8A 5JH7B 1TVKB 2GLZA 5EB0A 2CSLA 3FD6A 5LP6C 3J7AR 1GZ0A 1VHAA 3SIVA 2DYYA 5CB4A 5IYZA 1J7HA 4I4TA 3CCJF 3LWQC 1SA0B 5HXZA 2L26A 3ZOPA 5EB1B 3I56F 3RYHB 2UYNA 1W42A 3M1XA 3JASB 4IIJA 3CCLF 5HY0A 2IAFA 5LYJB 3WJPA 2HVYD 1VH8A 1YHQF 1VQKF 3DDNA 3N2KA 5KX5A 4BY9D 4B62A 3NK6A 2RB9A 5J2TA 4BT7A 1W41A 5ITZA 2HQSC 2GVIA 3C9UA 3S03A 3ZO8A 1SDSA 3K12A 2AMTA 4X1YA 3LDTA 3L7QA 1R1MA 5KMGA 4FFBB 4IHJB 3P0ZA 4O4LA 4BT4A 2ALEA 3MQWA 4WBNA 3HWUA 1W5EA 4TUYA 1VQMF 3JARA 5LOVA 5MN6A 4G4VA 5BMVB 2QI2A 5GONA 1PXWA 2ZVYA 1E7KA 4O4HB 1FSZA 1UFYA 4G88A 3WGJA 5CA0B 3WJRA 4C82A 2ZODA 3JATA 3KJKA 4DRXA 2QA4F 3NVIB
chains in the Genus database with same CATH topology
1UI9A 1J7HA 1COMA 2UYNB 3ZP4A 4ZK7A 1QD9A 3MQWA 3ZP7A 1DBFA 3ZOPA 1XHOA 2UYKA 3D01A 2UYPA 2CHTA 3R0PA 2UYNA 2CWJA 3M1XA 1NQ3A 1JD1A 3LYBA 5HP7A 5HP8A 2UYJA 3LMEA 2OTMA 3KJJA 1ODEA 1FNKA 1QAHA 4NWOB 3GTZA 3QUWA 3I3FA 3I7TA 2CVLA 1X25A 1QU9A 1FNJA 2CHSA 1PF5A 1ONIA 1UFYA 3K0TA 3M4SA 3V4DA 2IG8A 3VCZA 3KJKA 2B33A 2CSLA 1XRGA 2EWCA 3ZO8A 3K12A 2DYYA 3L7QA 2CW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI9 A;  1J7H A;  1COM A;  2UYN B;  3ZP4 A;  4ZK7 A;  1QD9 A;  3MQW A;  3ZP7 A;  1DBF A;  3ZOP A;  1XHO A;  2UYK A;  3D01 A;  2UYP A;  2CHT A;  3R0P A;  2UYN A;  2CWJ A;  3M1X A;  1NQ3 A;  1JD1 A;  3LYB A;  5HP7 A;  5HP8 A;  2UYJ A;  3LME A;  2OTM A;  3KJJ A;  1ODE A;  1FNK A;  1QAH A;  4NWO B;  3GTZ A;  3QUW A;  3I3F A;  3I7T A;  2CVL A;  1X25 A;  1QU9 A;  1FNJ A;  2CHS A;  1PF5 A;  1ONI A;  1UFY A;  3K0T A;  3M4S A;  3V4D A;  2IG8 A;  3VCZ A;  3KJK A;  2B33 A;  2CSL A;  1XRG A;  2EWC A;  3ZO8 A;  3K12 A;  2DYY A;  3L7Q A;  2CW4 A; 
#chains in the Genus database with same CATH topology
 4O4J A;  1KNJ A;  4G4Y A;  5IJ0 B;  1X7P A;  4HNA A;  4TV8 B;  1W2B F;  1Q81 H;  3N2G A;  3HKB A;  3LWV C;  4O4I A;  3CMA F;  1N8R H;  1W5A A;  4TV9 B;  5HY2 A;  1RLG A;  3MCA B;  5J2U B;  4X20 B;  1H48 A;  2HS0 A;  2FGY A;  3E22 B;  3C9T A;  3GHZ A;  5EYP A;  1W40 A;  1IPA A;  1IV1 A;  2RHL A;  5FJ4 C;  3CPW F;  3HAX D;  3V7Q A;  4C8G A;  1XBI A;  3HKD B;  4E6E A;  5JH7 A;  1IV4 A;  1TVK A;  2OZB A;  2VXY A;  3RE3 A;  4EB6 B;  5GIN C;  2IQQ A;  3CG6 A;  2JNB A;  3WGK A;  5G4U C;  1SA0 A;  3WPX A;  3RYH A;  2OTJ F;  3JAS A;  3ON1 A;  3IKE A;  5LYJ A;  3V4D A;  4U39 A;  3E1Y A;  3I55 F;  2ZVZ A;  4O2A B;  1XV2 A;  3F0D A;  4LCK A;  2KG4 A;  2VGM A;  1YJW F;  3AGK A;  3IKF A;  4NQ3 A;  3HKE B;  1H7M A;  3B6N A;  5C8Y B;  1YGY A;  3FD5 A;  4PWT A;  4FFB A;  4IHJ A;  3V7E A;  2KTV A;  3HKC B;  2F9Z C;  2H8E A;  3F0G A;  3U0O A;  3RYC B;  1M90 H;  5A2Q M;  3LME A;  5JVD B;  3P10 A;  3VOA A;  1FNK A;  2RHJ A;  2KTU A;  3ESJ A;  1YIT F;  3G4S F;  5GAP K;  1W5F A;  5BMV A;  3BYQ A;  2H6L A;  3D00 A;  3F0F A;  3N4Y A;  4C4W C;  4O4H A;  3S0W A;  1RA4 A;  1UI9 A;  2I6D A;  5CA0 A;  1X52 A;  2W8B C;  1COM A;  3VYS C;  3LFO A;  3JAL B;  3ZP7 A;  1VQ7 F;  3CPQ A;  5HXU A;  3OON A;  2UZH A;  3HJW C;  3LYB A;  1S72 F;  5IJ0 A;  3V3T A;  2HP0 B;  4EI9 A;  4TV8 A;  1JFF B;  5HY4 A;  3CD6 F;  5EO3 A;  5GIO C;  2VAP A;  3C9S A;  3CCM F;  3VOB A;  2Z1F A;  1VQV A;  3WGM A;  4TV9 A;  2R75 1;  4X20 A;  5FNV B;  3LWR C;  2H8C A;  3E22 A;  2RHH A;  4M8I A;  4C81 A;  3MCQ A;  4ZK7 A;  1QVG F;  2ZAU A;  2VAW A;  4TZZ A;  1TUB B;  1M1K H;  4B46 A;  4RHA A;  5GAN K;  2Z1U A;  4X1K B;  2CWJ A;  4ZI7 B;  2HP3 A;  3C9R A;  4BT6 A;  4EB6 A;  2ZF8 A;  5CA1 B;  3WGL A;  2CVL A;  2YYE A;  5LXT B;  5EIB D;  3S06 A;  3T80 A;  2B33 A;  1T0K B;  2KGW A;  5EWR A;  3G71 F;  4BVR A;  3ZP4 A;  4O2A A;  2G9I A;  3KE1 A;  1RQ7 A;  3IEW A;  1VQL F;  3CB2 A;  1OAP A;  5HP7 A;  3F0E A;  5HP8 A;  3HKE A;  1JJ2 F;  4NWO B;  5C8Y A;  1FFX B;  3HKC A;  1X25 A;  3N4Z A;  4G4Z A;  5B8F A;  3RYC A;  5JVD A;  5LP6 B;  3CC7 F;  1VQ6 F;  3EOR A;  2N48 A;  1JN1 A;  4LNU A;  1W59 A;  3IMP A;  5GIP C;  3OBW A;  2DT4 A;  3FFM A;  3K14 A;  5JCO A;  3FBA A;  2VAM A;  3OW2 F;  1JD1 A;  3E20 B;  4X3L A;  3JAL A;  2PHN A;  5FLX M;  1VK3 A;  2RHO A;  1IV3 A;  2K1S A;  1W57 A;  3GYQ A;  2HP0 A;  1JFF A;  5LA6 B;  3Q8H A;  5EIB C;  2NMU A;  3TD5 A;  1KQS F;  3F6M A;  1KNK A;  3JAK B;  2BTQ B;  3RA6 A;  1YJN F;  3RYI B;  3JVH A;  3G6E F;  5FNV A;  2Q1X A;  3P4E A;  3J81 M;  1RQ2 A;  3NVK E;  1W5B A;  1VQP F;  4ZHY B;  3HTN A;  3D54 A;  2HS4 A;  4X3M A;  1TUB A;  3KJJ A;  4EI8 A;  3C8L A;  3JAW B;  1YQN A;  4X1K A;  3QUW A;  2BTU A;  3MBM A;  4ZI7 A;  3VTI C;  5CA1 A;  5EAZ A;  3DC2 A;  4B45 A;  1VQN F;  3S0Y A;  3CCV F;  1U43 A;  1YI2 F;  2ZOV A;  5LXT A;  1KC8 H;  1NMU B;  3TD3 A;  1VQ8 F;  2CW4 A;  3PAF A;  3M84 A;  4I50 B;  4EI7 A;  2HS3 A;  2UYK A;  5IJ9 B;  2UYP A;  2Z1E A;  1KD1 H;  1K9M H;  3WGN A;  5EZY B;  4KWE A;  1Q86 H;  2HRY A;  3UT5 B;  3JCM M;  1ONI A;  1Z5W A;  2Z01 A;  1K8A H;  3CYP B;  3SIU A;  1FFX A;  1CK2 A;  4ZOL B;  5J2U A;  1NJI H;  5LP6 A;  4YJ3 B;  1GO1 A;  4X1I B;  2VGN A;  1VQ4 F;  3S02 A;  4U3J B;  5MN5 A;  1CN7 A;  4BVS A;  3HKD A;  4ZHQ B;  2UYJ A;  5AVM A;  3LWO C;  2BTO A;  1QAH A;  1Z5V A;  3QHD A;  4ZHV A;  4R40 B;  4F6R B;  5G4V C;  3PLA C;  5IT9 M;  1DT9 A;  3CC2 F;  2QEX F;  3J80 M;  3VCZ A;  3CXC F;  4B5C A;  4YJ2 B;  2LBT A;  2EWC A;  1VQ5 F;  3K2X A;  3VMF B;  1VQO F;  2HRU A;  3MDO A;  3RYF B;  1ZWZ A;  3VO8 A;  5DCV A;  5LA6 A;  3CCQ F;  1OFU A;  3CCR F;  1QD9 A;  3ERN A;  3VI6 A;  1K73 H;  4I55 B;  4C8I A;  2PMP A;  2YXZ A;  3NK7 A;  3JAK A;  2CHT A;  3KHN A;  5JQG B;  4G4W A;  1NQ3 A;  2AIZ P;  3CCE F;  1JY8 A;  3RYI A;  2BO1 A;  3CCU F;  4O2B B;  3GTZ A;  1SZQ A;  3NMU C;  3FPI A;  5CB4 B;  1W55 A;  4C8E A;  5MN4 A;  3JAW A;  5IYZ B;  3CC4 F;  4I4T B;  2R6R 1;  1GO0 A;  2GZL A;  1RLU A;  3IEQ A;  3S0H A;  2HX0 A;  5HWE A;  4XCQ A;  3VYT C;  4NUT A;  2Q1Y A;  1H47 A;  1CLI A;  2UYN B;  2LBX A;  3QTY A;  4IIJ B;  1DBF A;  5JCO C;  1XHO A;  3VIU A;  3WPW A;  1GX1 A;  2LBW A;  1Q8R A;  2LCA A;  3N2K B;  5KX5 B;  3WXM B;  1YJ9 F;  4I50 A;  4BT5 A;  4BT2 A;  3KIZ A;  5HY1 A;  5IJ9 A;  1ODE A;  5J2T B;  2P6Y A;  5ITZ B;  3O85 A;  3I7T A;  5EZY A;  1QU9 A;  1FNJ A;  1IV2 A;  3ELC A;  3M4S A;  4X1Y B;  2MQE A;  2CZW A;  3UT5 A;  5KMG B;  2OHW A;  4O4L B;  2OTL F;  1XRG A;  4WBN B;  4ZHW A;  4BVQ A;  2QTP A;  1Q7Y H;  4ERH A;  4TUY B;  4ZOL A;  3JAR B;  4RQO A;  5LOV B;  1X7O A;  2Z1T A;  4YJ3 A;  5GON B;  4X1I A;  2I6R A;  4U3J A;  1YIJ F;  3JAT B;  4ZHQ A;  3TD4 A;  4DRX B;  3JAM M;  2CHS A;  1PF5 A;  1W58 1;  2WAL A;  1T0A A;  2V9Y A;  4O4J B;  1QVF F;  1W3E X;  1U3L A;  3WJQ A;  3RA5 A;  4HNA B;  4DXD A;  4F6R A;  3OBY A;  2AIF A;  3N2G B;  3HKB B;  3IR9 A;  4O4I B;  4YJ2 A;  3LWP C;  3D01 A;  3RYF A;  4BVT A;  3R0P A;  4BW0 B;  3VYU C;  1VQ9 F;  4I55 A;  2OTM A;  3CYQ A;  5EYP B;  4G4X A;  4BT3 A;  5JQG A;  3I3F A;  3CCS F;  4LNU B;  3K0T A;  1U40 A;  1U3P A;  3CME F;  4O2B A;  1Q82 H;  2FC3 A;  2IG8 A;  5JH7 B;  1TVK B;  2GLZ A;  5EB0 A;  2CSL A;  3FD6 A;  5LP6 C;  3J7A R;  1GZ0 A;  1VHA A;  3SIV A;  2DYY A;  5CB4 A;  5IYZ A;  1J7H A;  4I4T A;  3CCJ F;  3LWQ C;  1SA0 B;  5HXZ A;  2L26 A;  3ZOP A;  5EB1 B;  3I56 F;  3RYH B;  2UYN A;  1W42 A;  3M1X A;  3JAS B;  4IIJ A;  3CCL F;  5HY0 A;  2IAF A;  5LYJ B;  3WJP A;  2HVY D;  1VH8 A;  1YHQ F;  1VQK F;  3DDN A;  3N2K A;  5KX5 A;  4BY9 D;  4B62 A;  3NK6 A;  2RB9 A;  5J2T A;  4BT7 A;  1W41 A;  5ITZ A;  2HQS C;  2GVI A;  3C9U A;  3S03 A;  3ZO8 A;  1SDS A;  3K12 A;  2AMT A;  4X1Y A;  3LDT A;  3L7Q A;  1R1M A;  5KMG A;  4FFB B;  4IHJ B;  3P0Z A;  4O4L A;  4BT4 A;  2ALE A;  3MQW A;  4WBN A;  3HWU A;  1W5E A;  4TUY A;  1VQM F;  3JAR A;  5LOV A;  5MN6 A;  4G4V A;  5BMV B;  2QI2 A;  5GON A;  1PXW A;  2ZVY A;  1E7K A;  4O4H B;  1FSZ A;  1UFY A;  4G88 A;  3WGJ A;  5CA0 B;  3WJR A;  4C82 A;  2ZOD A;  3JAT A;  3KJK A;  4DRX A;  2QA4 F;  3NVI B; 
#chains in the Genus database with same CATH homology
 1UI9 A;  1J7H A;  1COM A;  2UYN B;  3ZP4 A;  4ZK7 A;  1QD9 A;  3MQW A;  3ZP7 A;  1DBF A;  3ZOP A;  1XHO A;  2UYK A;  3D01 A;  2UYP A;  2CHT A;  3R0P A;  2UYN A;  2CWJ A;  3M1X A;  1NQ3 A;  1JD1 A;  3LYB A;  5HP7 A;  5HP8 A;  2UYJ A;  3LME A;  2OTM A;  3KJJ A;  1ODE A;  1FNK A;  1QAH A;  4NWO B;  3GTZ A;  3QUW A;  3I3F A;  3I7T A;  2CVL A;  1X25 A;  1QU9 A;  1FNJ A;  2CHS A;  1PF5 A;  1ONI A;  1UFY A;  3K0T A;  3M4S A;  3V4D A;  2IG8 A;  3VCZ A;  3KJK A;  2B33 A;  2CSL A;  1XRG A;  2EWC A;  3ZO8 A;  3K12 A;  2DYY A;  3L7Q A;  2CW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...