3KJKA

Crystal structure of nmb1025, a member of yjgf protein family, from neisseria meningitidis (monoclinic crystal form)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
MDIRYFGTTPRYSEAVGANGLIFLSGMVPENGETAAEQTADVLAQIDRWLAECGSDKAHVLDAVIYLRDMGDYAEMNGVWDAWVAAGRTPARACVEARLARPEWRVEIKITAVKRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMB1025 protein
publication title Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Unknown function
total genus 33
structure length 116
sequence length 116
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3kjkA00
2CVLA 1JD1A 5HP8A 3ZOPA 2B33A 2EWCA 5HP7A 3LMEA 3ZP7A 1XHOA 1J7HA 4NWOB 1COMA 1PF5A 3ZP4A 2CWJA 1QU9A 2UYNA 3I7TA 1X25A 1FNKA 1QD9A 2DYYA 2UYKA 1ONIA 2IG8A 1UFYA 2CW4A 2OTMA 3GTZA 3MQWA 3V4DA 2UYJA 2UYPA 2CHSA 2CHTA 3I3FA 1DBFA 3ZO8A 3M1XA 3D01A 4ZK7A 3LYBA 3M4SA 1ODEA 3K12A 1QAHA 1UI9A 2UYNB 3K0TA 3KJKA 1NQ3A 3R0PA 1FNJA 3KJJA 3QUWA 3VCZA 1XRGA 3L7QA 2CSLA
chains in the Genus database with same CATH superfamily
3E1YA 3LWVC 3CC7F 4F6RA 3TD5A 3ZP7A 4G88A 4X3LA 3S0WA 4EI9A 2HX0A 5IJ0A 4ZOLB 5EB0A 3CCRF 2DYYA 3TD3A 3WGMA 1XV2A 1Z5VA 3E20B 4X1KB 3CXCF 1IV3A 1VQOF 3LYBA 3FD6A 3JAMM 1JFFB 3JAWB 3JAKB 5FLXM 4I4TA 3RYHB 3NMUC 5IT9M 4BW0B 5IYZB 3KHNA 3S06A 4HNAB 3S0YA 5HY4A 3ELCA 4X1YA 4TUYA 1J7HA 4O4LA 5HWEA 4O2BB 1U40A 1K8AH 3RYFB 5KMGB 3CC4F 2BO1A 4BT3A 5JCOC 2OHWA 4O4HA 1CLIA 3K14A 3CPQA 5JQGA 1GZ0A 2VAWA 4O4IA 4C8IA 5CA1A 3IEWA 1Q82H 1VQ8F 1OFUA 5FJ4C 5BMVA 1GO0A 1VQMF 3HKBA 3O85A 5ITZB 3CMAF 1T0KB 4LCKA 4NQ3A 1COMA 1VQVA 3ZP4A 1S72F 4M8IA 1VQNF 5JVDB 3F0EA 2AIZP 1QD9A 4TV9A 3VO8A 3CYQA 4B5CA 1U3LA 2VGNA 3VMFB 1QVGF 1W5BA 2P6YA 3RYIA 5LA6B 4YJ3A 1VH8A 2Z1UA 4I55A 1NJIH 2LCAA 1YHQF 3K0TA 4BT2A 5J2TA 3VIUA 1KQSF 2N48A 2L26A 5HXZA 3MBMA 5EZYB 1PXWA 3HKEB 4ZI7A 1W40A 1H7MA 5MN6A 5JH7B 3NVKE 2H8EA 4WBNA 2VAPA 3KIZA 4C81A 1T0AA 4I50A 3HKCB 3FD5A 3WGJA 4ZHQB 3I55F 1YJ9F 2CW4A 1M90H 3JATB 2MQEA 3JALB 3EORA 2Z1EA 3CPWF 2QEXF 1X7PA 3M4SA 1RA4A 3KJJA 3QUWA 3N4ZA 3WGLA 2IG8A 3FFMA 3HKDA 3C8LA 3F0FA 4X3MA 4X1IA 2LBTA 4NWOB 1ZWZA 2CWJA 3I7TA 5EIBD 3J81M 5FNVB 3QHDA 1W3EX 3N2GA 4R40B 2UYPA 3MDOA 5J2UA 1M1KH 2PHNA 2AMTA 3HJWC 3PLAC 1IV2A 2AIFA 1X52A 5CA0A 2HQSC 3ERNA 4EB6A 2ZVZA 3FBAA 5LYJB 3RYCA 1KC8H 4X20B 3CCJF 4BVRA 2ZODA 2LBXA 4IIJB 3N4YA 3OBWA 5HP7A 3LMEA 3JARB 3AGKA 4LNUB 5LOVA 5KX5A 3FPIA 2HP0A 4DRXA 1IPAA 5LXTA 3JASB 5EYPA 2R751 1VQKF 5C8YA 1XBIA 4F6RB 5IJ9B 3VI6A 4ZHWA 1YI2F 1KD1H 1Z5WA 2QTPA 4B62A 4TV8B 1FFXA 2Q1XA 3J7AR 3LWQC 3LFOA 3JCMM 2PMPA 3IKEA 1VQ4F 4E6EA 1TUBB 2F9ZC 4FFBB 4ZOLA 2HVYD 1VK3A 2RHHA 4X1KA 3S0HA 2BTOA 5DCVA 4RQOA 1JFFA 4I4TB 3JAWA 3JAKA 1K9MH 1K73H 1X25A 3WJRA 5B8FA 3RYHA 3QTYA 2YXZA 1UFYA 3GTZA 4X1YB 1JN1A 3ZO8A 4HNAA 4C8EA 3HAXD 3TD4A 3HTNA 4BVQA 2VAMA 2K1SA 4O2BA 3VCZA 3RYFA 5KMGA 2RHLA 3P10A 1H48A 2KG4A 3MCAB 3D00A 2WALA 3VYUC 5GINC 3V3TA 3C9RA 3E22B 2GZLA 3WPXA 3V7EA 3NK6A 3HKBB 2OTJF 2HRUA 1ONIA 1TVKB 5GONA 5ITZA 4G4VA 3I3FA 3PAFA 3IMPA 3D01A 2HS4A 3K12A 3U0OA 3WJQA 3C9TA 3RA5A 2BTQB 5JVDA 1IV1A 1W2BF 1VQ5F 1JD1A 2VGMA 3UT5B 3RYIB 4O2AB 4NUTA 1Q86H 1PF5A 3T80A 4G4ZA 1R1MA 2UYNA 3N2KB 1FNKA 3C9UA 1JY8A 3JVHA 4C4WC 3ESJA 1YQNA 4XCQA 3V4DA 3VOBA 4BT6A 1CK2A 5EO3A 5EZYA 3HKEA 3CD6F 5HXUA 1YJWF 1NQ3A 1YIJF 3HKCA 4ZHQA 2ZVYA 3P0ZA 2CSLA 3VYTC 3JATA 1VQLF 3JALA 1U43A 5HY2A 1SA0A 2HS3A 4O4JB 3WGNA 4BVSA 2OTLF 5CB4A 1VQ7F 4IHJB 3P4EA 3CB2A 4U3JB 2H6LA 4X1IB 3F0GA 2CHSA 2KTUA 2ZF8A 3SIUA 3IR9A 4ZK7A 4G4XA 2FGYA 2NMUA 3KJKA 5LP6B 3KE1A 3J80M 1RQ2A 1XRGA 1SZQA 3L7QA 3NK7A 5FNVA 3RA6A 3CYPB 4YJ2B 2IAFA 2Z1TA 3OW2F 3WXMB 4DXDA 3G71F 4U39A 5GIOC 1E7KA 1CN7A 3IEQA 2G9IA 3DDNA 1KNJA 1Q7YH 1W5FA 2LBWA 4X20A 3RE3A 1VQ9F 1IV4A 3DC2A 2DT4A 3Q8HA 3JARA 4LNUA 5A2QM 5IJ0B 2QA4F 1H47A 5EWRA 3G4SF 3I56F 1YJNF 3JASA 1KNKA 2CVLA 4BVTA 1FFXB 5IJ9A 3IKFA 4TV8A 2FC3A 4B46A 3BYQA 5G4VC 3VYSC 1TUBA 2UYKA 1JJ2F 3LDTA 4FFBA 3CCEF 3OONA 2ZOVA 4ZHYB 2CHTA 1DBFA 5IYZA 4TUYB 4O4LB 2GVIA 3S03A 3F0DA 1U3PA 3LWRC 3VOAA 1W57A 2HP3A 4O4HB 3CCVF 2IQQA 2R6R1 3M84A 5JQGB 4C8GA 1GX1A 4O4IB 5CA1B 3CCLF 2JNBA 2KGWA 4G4YA 2ZAUA 5BMVB 3CCQF 3GHZA 3SIVA 5EB1B 4BY9D 3MQWA 3ON1A 1QAHA 2RHOA 5LP6C 3WGKA 1X7OA 4BT4A 3E22A 1VHAA 1FNJA 2Q1YA 4TV9B 2Z1FA 5GONB 3B6NA 4G4WA 1TVKA 1Q8RA 3C9SA 3K2XA 4KWEA 1N8RH 5AVMA 4YJ3B 2BTUA 2VXYA 4I55B 2OZBA 1SDSA 5LA6A 5J2TB 5GANK 3GYQA 1W55A 1VQ6F 1QU9A 2RHJA 4RHAA 3WPWA 1YGYA 3UT5A 4ZI7B 2W8BC 2Z01A 4EI7A 3M1XA 1W5AA 4O2AA 5MN4A 1W42A 4BT7A 3LWOC 4WBNB 1UI9A 2UYNB 3V7QA 3R0PA 4I50B 5JH7A 1OAPA 1W59A 5MN5A 3CCSF 1RQ7A 4TZZA 3NVIB 3N2KA 2ALEA 5HP8A 2H8CA 4BT5A 3VTIC 1XHOA 2UZHA 5EIBC 4B45A 3OBYA 2HRYA 5HY1A 2HS0A 2I6RA 3HKDB 2OTMA 1DT9A 4C82A 2CZWA 2UYJA 1NMUB 1SA0B 3CG6A 3CCMF 5CB4B 4O4JA 2YYEA 4IHJA 1RLGA 2GLZA 4U3JA 3D54A 1W41A 3N2GB 5GIPC 5HY0A 1FSZA 1W581 4ERHA 5JCOA 4EI8A 2RB9A 1VQPF 3ZOPA 5EAZA 5J2UB 3WJPA 2B33A 3HWUA 2EWCA 3CCUF 4PWTA 2I6DA 3F6MA 5G4UC 1GO1A 2QI2A 5CA0B 1QVFF 2KTVA 4EB6B 5LP6A 3RYCB 3CMEF 5LYJA 4YJ2A 1RLUA 4IIJA 3G6EF 5GAPK 1YITF 5LOVB 3MCQA 5KX5B 1ODEA 2HP0B 4DRXB 3S02A 3LWPC 3CC2F 1Q81H 5LXTB 5EYPB 4ZHVA 1W5EA 5C8YB 2V9YA
chains in the Genus database with same CATH topology
2CVLA 1JD1A 5HP8A 3ZOPA 2B33A 2EWCA 5HP7A 3LMEA 3ZP7A 1XHOA 1J7HA 4NWOB 1COMA 1PF5A 3ZP4A 2CWJA 1QU9A 2UYNA 3I7TA 1X25A 1FNKA 1QD9A 2DYYA 2UYKA 1ONIA 2IG8A 1UFYA 2CW4A 2OTMA 3GTZA 3MQWA 3V4DA 2UYJA 2UYPA 2CHSA 2CHTA 3I3FA 1DBFA 3ZO8A 3M1XA 3D01A 4ZK7A 3LYBA 3M4SA 1ODEA 3K12A 1QAHA 1UI9A 2UYNB 3K0TA 3KJKA 1NQ3A 3R0PA 1FNJA 3KJJA 3QUWA 3VCZA 1XRGA 3L7QA 2CSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVL A;  1JD1 A;  5HP8 A;  3ZOP A;  2B33 A;  2EWC A;  5HP7 A;  3LME A;  3ZP7 A;  1XHO A;  1J7H A;  4NWO B;  1COM A;  1PF5 A;  3ZP4 A;  2CWJ A;  1QU9 A;  2UYN A;  3I7T A;  1X25 A;  1FNK A;  1QD9 A;  2DYY A;  2UYK A;  1ONI A;  2IG8 A;  1UFY A;  2CW4 A;  2OTM A;  3GTZ A;  3MQW A;  3V4D A;  2UYJ A;  2UYP A;  2CHS A;  2CHT A;  3I3F A;  1DBF A;  3ZO8 A;  3M1X A;  3D01 A;  4ZK7 A;  3LYB A;  3M4S A;  1ODE A;  3K12 A;  1QAH A;  1UI9 A;  2UYN B;  3K0T A;  3KJK A;  1NQ3 A;  3R0P A;  1FNJ A;  3KJJ A;  3QUW A;  3VCZ A;  1XRG A;  3L7Q A;  2CSL A; 
#chains in the Genus database with same CATH topology
 3E1Y A;  3LWV C;  3CC7 F;  4F6R A;  3TD5 A;  3ZP7 A;  4G88 A;  4X3L A;  3S0W A;  4EI9 A;  2HX0 A;  5IJ0 A;  4ZOL B;  5EB0 A;  3CCR F;  2DYY A;  3TD3 A;  3WGM A;  1XV2 A;  1Z5V A;  3E20 B;  4X1K B;  3CXC F;  1IV3 A;  1VQO F;  3LYB A;  3FD6 A;  3JAM M;  1JFF B;  3JAW B;  3JAK B;  5FLX M;  4I4T A;  3RYH B;  3NMU C;  5IT9 M;  4BW0 B;  5IYZ B;  3KHN A;  3S06 A;  4HNA B;  3S0Y A;  5HY4 A;  3ELC A;  4X1Y A;  4TUY A;  1J7H A;  4O4L A;  5HWE A;  4O2B B;  1U40 A;  1K8A H;  3RYF B;  5KMG B;  3CC4 F;  2BO1 A;  4BT3 A;  5JCO C;  2OHW A;  4O4H A;  1CLI A;  3K14 A;  3CPQ A;  5JQG A;  1GZ0 A;  2VAW A;  4O4I A;  4C8I A;  5CA1 A;  3IEW A;  1Q82 H;  1VQ8 F;  1OFU A;  5FJ4 C;  5BMV A;  1GO0 A;  1VQM F;  3HKB A;  3O85 A;  5ITZ B;  3CMA F;  1T0K B;  4LCK A;  4NQ3 A;  1COM A;  1VQV A;  3ZP4 A;  1S72 F;  4M8I A;  1VQN F;  5JVD B;  3F0E A;  2AIZ P;  1QD9 A;  4TV9 A;  3VO8 A;  3CYQ A;  4B5C A;  1U3L A;  2VGN A;  3VMF B;  1QVG F;  1W5B A;  2P6Y A;  3RYI A;  5LA6 B;  4YJ3 A;  1VH8 A;  2Z1U A;  4I55 A;  1NJI H;  2LCA A;  1YHQ F;  3K0T A;  4BT2 A;  5J2T A;  3VIU A;  1KQS F;  2N48 A;  2L26 A;  5HXZ A;  3MBM A;  5EZY B;  1PXW A;  3HKE B;  4ZI7 A;  1W40 A;  1H7M A;  5MN6 A;  5JH7 B;  3NVK E;  2H8E A;  4WBN A;  2VAP A;  3KIZ A;  4C81 A;  1T0A A;  4I50 A;  3HKC B;  3FD5 A;  3WGJ A;  4ZHQ B;  3I55 F;  1YJ9 F;  2CW4 A;  1M90 H;  3JAT B;  2MQE A;  3JAL B;  3EOR A;  2Z1E A;  3CPW F;  2QEX F;  1X7P A;  3M4S A;  1RA4 A;  3KJJ A;  3QUW A;  3N4Z A;  3WGL A;  2IG8 A;  3FFM A;  3HKD A;  3C8L A;  3F0F A;  4X3M A;  4X1I A;  2LBT A;  4NWO B;  1ZWZ A;  2CWJ A;  3I7T A;  5EIB D;  3J81 M;  5FNV B;  3QHD A;  1W3E X;  3N2G A;  4R40 B;  2UYP A;  3MDO A;  5J2U A;  1M1K H;  2PHN A;  2AMT A;  3HJW C;  3PLA C;  1IV2 A;  2AIF A;  1X52 A;  5CA0 A;  2HQS C;  3ERN A;  4EB6 A;  2ZVZ A;  3FBA A;  5LYJ B;  3RYC A;  1KC8 H;  4X20 B;  3CCJ F;  4BVR A;  2ZOD A;  2LBX A;  4IIJ B;  3N4Y A;  3OBW A;  5HP7 A;  3LME A;  3JAR B;  3AGK A;  4LNU B;  5LOV A;  5KX5 A;  3FPI A;  2HP0 A;  4DRX A;  1IPA A;  5LXT A;  3JAS B;  5EYP A;  2R75 1;  1VQK F;  5C8Y A;  1XBI A;  4F6R B;  5IJ9 B;  3VI6 A;  4ZHW A;  1YI2 F;  1KD1 H;  1Z5W A;  2QTP A;  4B62 A;  4TV8 B;  1FFX A;  2Q1X A;  3J7A R;  3LWQ C;  3LFO A;  3JCM M;  2PMP A;  3IKE A;  1VQ4 F;  4E6E A;  1TUB B;  2F9Z C;  4FFB B;  4ZOL A;  2HVY D;  1VK3 A;  2RHH A;  4X1K A;  3S0H A;  2BTO A;  5DCV A;  4RQO A;  1JFF A;  4I4T B;  3JAW A;  3JAK A;  1K9M H;  1K73 H;  1X25 A;  3WJR A;  5B8F A;  3RYH A;  3QTY A;  2YXZ A;  1UFY A;  3GTZ A;  4X1Y B;  1JN1 A;  3ZO8 A;  4HNA A;  4C8E A;  3HAX D;  3TD4 A;  3HTN A;  4BVQ A;  2VAM A;  2K1S A;  4O2B A;  3VCZ A;  3RYF A;  5KMG A;  2RHL A;  3P10 A;  1H48 A;  2KG4 A;  3MCA B;  3D00 A;  2WAL A;  3VYU C;  5GIN C;  3V3T A;  3C9R A;  3E22 B;  2GZL A;  3WPX A;  3V7E A;  3NK6 A;  3HKB B;  2OTJ F;  2HRU A;  1ONI A;  1TVK B;  5GON A;  5ITZ A;  4G4V A;  3I3F A;  3PAF A;  3IMP A;  3D01 A;  2HS4 A;  3K12 A;  3U0O A;  3WJQ A;  3C9T A;  3RA5 A;  2BTQ B;  5JVD A;  1IV1 A;  1W2B F;  1VQ5 F;  1JD1 A;  2VGM A;  3UT5 B;  3RYI B;  4O2A B;  4NUT A;  1Q86 H;  1PF5 A;  3T80 A;  4G4Z A;  1R1M A;  2UYN A;  3N2K B;  1FNK A;  3C9U A;  1JY8 A;  3JVH A;  4C4W C;  3ESJ A;  1YQN A;  4XCQ A;  3V4D A;  3VOB A;  4BT6 A;  1CK2 A;  5EO3 A;  5EZY A;  3HKE A;  3CD6 F;  5HXU A;  1YJW F;  1NQ3 A;  1YIJ F;  3HKC A;  4ZHQ A;  2ZVY A;  3P0Z A;  2CSL A;  3VYT C;  3JAT A;  1VQL F;  3JAL A;  1U43 A;  5HY2 A;  1SA0 A;  2HS3 A;  4O4J B;  3WGN A;  4BVS A;  2OTL F;  5CB4 A;  1VQ7 F;  4IHJ B;  3P4E A;  3CB2 A;  4U3J B;  2H6L A;  4X1I B;  3F0G A;  2CHS A;  2KTU A;  2ZF8 A;  3SIU A;  3IR9 A;  4ZK7 A;  4G4X A;  2FGY A;  2NMU A;  3KJK A;  5LP6 B;  3KE1 A;  3J80 M;  1RQ2 A;  1XRG A;  1SZQ A;  3L7Q A;  3NK7 A;  5FNV A;  3RA6 A;  3CYP B;  4YJ2 B;  2IAF A;  2Z1T A;  3OW2 F;  3WXM B;  4DXD A;  3G71 F;  4U39 A;  5GIO C;  1E7K A;  1CN7 A;  3IEQ A;  2G9I A;  3DDN A;  1KNJ A;  1Q7Y H;  1W5F A;  2LBW A;  4X20 A;  3RE3 A;  1VQ9 F;  1IV4 A;  3DC2 A;  2DT4 A;  3Q8H A;  3JAR A;  4LNU A;  5A2Q M;  5IJ0 B;  2QA4 F;  1H47 A;  5EWR A;  3G4S F;  3I56 F;  1YJN F;  3JAS A;  1KNK A;  2CVL A;  4BVT A;  1FFX B;  5IJ9 A;  3IKF A;  4TV8 A;  2FC3 A;  4B46 A;  3BYQ A;  5G4V C;  3VYS C;  1TUB A;  2UYK A;  1JJ2 F;  3LDT A;  4FFB A;  3CCE F;  3OON A;  2ZOV A;  4ZHY B;  2CHT A;  1DBF A;  5IYZ A;  4TUY B;  4O4L B;  2GVI A;  3S03 A;  3F0D A;  1U3P A;  3LWR C;  3VOA A;  1W57 A;  2HP3 A;  4O4H B;  3CCV F;  2IQQ A;  2R6R 1;  3M84 A;  5JQG B;  4C8G A;  1GX1 A;  4O4I B;  5CA1 B;  3CCL F;  2JNB A;  2KGW A;  4G4Y A;  2ZAU A;  5BMV B;  3CCQ F;  3GHZ A;  3SIV A;  5EB1 B;  4BY9 D;  3MQW A;  3ON1 A;  1QAH A;  2RHO A;  5LP6 C;  3WGK A;  1X7O A;  4BT4 A;  3E22 A;  1VHA A;  1FNJ A;  2Q1Y A;  4TV9 B;  2Z1F A;  5GON B;  3B6N A;  4G4W A;  1TVK A;  1Q8R A;  3C9S A;  3K2X A;  4KWE A;  1N8R H;  5AVM A;  4YJ3 B;  2BTU A;  2VXY A;  4I55 B;  2OZB A;  1SDS A;  5LA6 A;  5J2T B;  5GAN K;  3GYQ A;  1W55 A;  1VQ6 F;  1QU9 A;  2RHJ A;  4RHA A;  3WPW A;  1YGY A;  3UT5 A;  4ZI7 B;  2W8B C;  2Z01 A;  4EI7 A;  3M1X A;  1W5A A;  4O2A A;  5MN4 A;  1W42 A;  4BT7 A;  3LWO C;  4WBN B;  1UI9 A;  2UYN B;  3V7Q A;  3R0P A;  4I50 B;  5JH7 A;  1OAP A;  1W59 A;  5MN5 A;  3CCS F;  1RQ7 A;  4TZZ A;  3NVI B;  3N2K A;  2ALE A;  5HP8 A;  2H8C A;  4BT5 A;  3VTI C;  1XHO A;  2UZH A;  5EIB C;  4B45 A;  3OBY A;  2HRY A;  5HY1 A;  2HS0 A;  2I6R A;  3HKD B;  2OTM A;  1DT9 A;  4C82 A;  2CZW A;  2UYJ A;  1NMU B;  1SA0 B;  3CG6 A;  3CCM F;  5CB4 B;  4O4J A;  2YYE A;  4IHJ A;  1RLG A;  2GLZ A;  4U3J A;  3D54 A;  1W41 A;  3N2G B;  5GIP C;  5HY0 A;  1FSZ A;  1W58 1;  4ERH A;  5JCO A;  4EI8 A;  2RB9 A;  1VQP F;  3ZOP A;  5EAZ A;  5J2U B;  3WJP A;  2B33 A;  3HWU A;  2EWC A;  3CCU F;  4PWT A;  2I6D A;  3F6M A;  5G4U C;  1GO1 A;  2QI2 A;  5CA0 B;  1QVF F;  2KTV A;  4EB6 B;  5LP6 A;  3RYC B;  3CME F;  5LYJ A;  4YJ2 A;  1RLU A;  4IIJ A;  3G6E F;  5GAP K;  1YIT F;  5LOV B;  3MCQ A;  5KX5 B;  1ODE A;  2HP0 B;  4DRX B;  3S02 A;  3LWP C;  3CC2 F;  1Q81 H;  5LXT B;  5EYP B;  4ZHV A;  1W5E A;  5C8Y B;  2V9Y A; 
#chains in the Genus database with same CATH homology
 2CVL A;  1JD1 A;  5HP8 A;  3ZOP A;  2B33 A;  2EWC A;  5HP7 A;  3LME A;  3ZP7 A;  1XHO A;  1J7H A;  4NWO B;  1COM A;  1PF5 A;  3ZP4 A;  2CWJ A;  1QU9 A;  2UYN A;  3I7T A;  1X25 A;  1FNK A;  1QD9 A;  2DYY A;  2UYK A;  1ONI A;  2IG8 A;  1UFY A;  2CW4 A;  2OTM A;  3GTZ A;  3MQW A;  3V4D A;  2UYJ A;  2UYP A;  2CHS A;  2CHT A;  3I3F A;  1DBF A;  3ZO8 A;  3M1X A;  3D01 A;  4ZK7 A;  3LYB A;  3M4S A;  1ODE A;  3K12 A;  1QAH A;  1UI9 A;  2UYN B;  3K0T A;  3KJK A;  1NQ3 A;  3R0P A;  1FNJ A;  3KJJ A;  3QUW A;  3VCZ A;  1XRG A;  3L7Q A;  2CSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...