3HJWC

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3hjwC00
5GAPK 3RA5A 3J7AR 5A2QM 3SIVA 1NJIH 1XBIA 3LWPC 2HVYD 1PXWA 1Q7YH 1S72F 1VQLF 2KTUA 4BW0B 3FFMA 3RA6A 1K73H 3NMUC 3G6EF 1KC8H 3V7QA 2OZBA 3SIUA 4C4WC 3LWQC 1YITF 5GANK 3CC4F 3CC2F 1E7KA 3N4ZA 3CCLF 3NK6A 4NUTA 1YI2F 1GZ0A 3VI6A 3LWVC 1DT9A 3CCVF 3CCQF 2VGMA 1QVFF 2QI2A 2KTVA 3CPQA 5FJ4C 3V7EA 3CXCF 3NVKE 3O85A 3HJWC 1VQNF 4LCKA 3VMFB 1NMUB 3J81M 3CPWF 1M1KH 1SDSA 2OTLF 2LBWA 1VQ9F 1Q81H 2ALEA 1ZWZA 2QEXF 1IPAA 1YJ9F 1CK2A 3J80M 1RLGA 5DCVA 3G71F 1W41A 1K9MH 5GINC 1KD1H 1VQ8F 3ON1A 2FC3A 1Q82H 3E20B 3N4YA 3OW2F 3LWRC 1RA4A 5IT9M 1X7PA 2AIFA 4BY9D 1KQSF 3NK7A 1JJ2F 3GYQA 1H7MA 1VQ4F 3CCUF 1W3EX 3CCRF 1N8RH 4TZZA 3CCMF 1VQ6F 1GO1A 3WXMB 1X7OA 2I6DA 3CCEF 4X3MA 1W2BF 1YJWF 3NVIB 2BO1A 3CMEF 1W42A 5EWRA 3G4SF 3CCJF 1T0KB 1VQOF 1YHQF 5FLXM 5G4VC 2VGNA 3JCMM 3CMAF 3PLAC 3CG6A 5EO3A 1W40A 1VQMF 1K8AH 3CC7F 1X52A 3CD6F 3HAXD 4X3LA 3IR9A 2OHWA 3OBYA 3AGKA 1YIJF 3E1YA 2KG4A 5GIOC 3JAMM 5G4UC 3MCAB 5GIPC 2OTJF 2WALA 1QVGF 1M90H 1VQ5F 3OBWA 2CZWA 2JNBA 2LBXA 1VQKF 1GO0A 3LWOC 3I55F 3LFOA 1CN7A 1VQPF 3I56F 1YJNF 2QA4F 3PAFA 1VQ7F 3CCSF 1Q86H
chains in the Genus database with same CATH superfamily
2ZODA 3I3FA 2CW4A 3RA5A 5A2QM 3N2GA 1PXWA 1VQLF 2KTUA 2HRUA 3QUWA 4ZK7A 2CSLA 4TV9B 1KC8H 2PHNA 3HKBB 1W55A 1FNJA 3RYHA 4I55A 3CC4F 2UYNA 3CC2F 1Q8RA 2RHJA 4U3JA 4BT5A 1E7KA 3CCLF 2HS0A 1GZ0A 4G88A 3CCVF 3KE1A 3HTNA 5JCOC 5IJ9B 5HP8A 1COMA 1OFUA 2Z01A 3IKFA 1T0AA 1JFFB 5JVDA 3VYSC 5FNVB 3CXCF 4BT2A 5IJ0A 3NVKE 2VAMA 2HS4A 3F0DA 3TD5A 5CA1B 2H8CA 2VAWA 4LCKA 3GTZA 1VQVA 2IQQA 4YJ2B 2LBWA 4WBNB 2KGWA 2MQEA 4F6RB 1ZWZA 4ZHQA 5LYJA 1CK2A 3UT5B 1RLGA 5DCVA 3CB2A 4O4LA 2IAFA 3VOBA 3F0GA 3ELCA 2I6RA 1Z5WA 5C8YB 3OW2F 3N2KA 1RA4A 3JALA 4I4TB 4NQ3A 3C9TA 5MN5A 1JJ2F 5LXTB 4R40B 3GYQA 3WJQA 5HY2A 2HP3A 5EIBC 5LP6C 3JAKB 3MBMA 3RE3A 2YXZA 2BTUA 5IYZB 4TV8A 4B5CA 2UYJA 3S0HA 1GO1A 2ZVZA 1SA0B 3HKEB 3JAWB 4ZOLB 4X1KA 1VQOF 5ITZA 5EO3A 5LA6B 1U3PA 4E6EA 4B62A 5MN6A 2L26A 5HXUA 3IR9A 4X20A 4DRXA 3K2XA 3ESJA 3ZP4A 5EYPB 1YIJF 3VOAA 2FGYA 3C9RA 5JH7A 1H47A 5G4UC 2RB9A 3BYQA 1M90H 4LNUA 2LBXA 2UYNB 5J2UA 3WPXA 1YJNF 4IHJA 3K0TA 1TUBB 4IIJA 1VQ7F 5CB4A 2HP0B 3CCSF 5GAPK 3MCQA 4G4WA 3SIVA 2R751 5CA0B 5EB1B 1NJIH 2HVYD 3JVHA 4BW0B 5KMGB 1K73H 3NMUC 3RYCA 2Z1TA 2OZBA 3SIUA 4C4WC 2K1SA 4DXDA 3LWQC 4ERHA 1IV2A 3M4SA 3CYPB 5LP6A 5LYJB 3N4ZA 1W5AA 1FFXA 3VI6A 3ZP7A 1DT9A 2ZF8A 3LWVC 1QVFF 3D54A 4C8IA 3OONA 3Q8HA 1VHAA 1U43A 3KIZA 2GVIA 3N2KB 4O2AA 2UYKA 4X1IB 3HKCA 1TVKA 4I50A 4G4ZA 1QU9A 5GONA 3VMFB 4FFBA 3J81M 3FD5A 1M1KH 3F6MA 4BVSA 3ZOPA 2Z1EA 2BTOA 1UI9A 1VK3A 3E22B 2ZAUA 2QEXF 3HKDB 3WGNA 4BT3A 3K12A 2YYEA 1FSZA 2DYYA 3I7TA 2NMUA 1UFYA 4HNAA 5LOVB 3DC2A 3FBAA 2H8EA 3ON1A 1Q82H 3N4YA 3KJJA 3LWRC 5KX5A 5IT9M 5BMVA 4BVTA 1X7PA 4RQOA 2W8BC 3RYIA 4G4VA 1H7MA 4BVRA 2HS3A 3JASB 1W3EX 3CCRF 1N8RH 3VO8A 1VQ6F 4XCQA 3WXMB 3JARA 1X7OA 4TUYA 3ZO8A 1YJWF 4BT4A 5EWRA 3WJPA 2V9YA 1YGYA 3D01A 4IHJB 3CMAF 3LMEA 1X25A 4IIJB 5EZYA 3CD6F 3HAXD 3M1XA 2G9IA 1IV4A 5HXZA 2CVLA 3IEWA 2Q1XA 4YJ3B 2Z1FA 2QTPA 3JATA 5HY0A 5JQGA 3S02A 5HY4A 3E1YA 3D00A 1GX1A 3T80A 1RLUA 4B45A 2WALA 3DDNA 5J2TA 4EI7A 1FNKA 4O2BB 5LP6B 4O4JB 3RYFB 3IMPA 3B6NA 3L7QA 2HX0A 4O4HB 3LWPC 3IEQA 1Q7YH 1S72F 1H48A 4I50B 4TV9A 3N2GB 1W5BA 3HKBA 3RA6A 3G6EF 3V7QA 3VCZA 1YITF 2UYPA 4ZHVA 5GANK 3RYHB 3U0OA 4BVQA 4I55B 5EAZA 4NUTA 1YI2F 5AVMA 4U3JB 5IJ9A 3CCQF 2VGMA 1ONIA 1CLIA 2QI2A 1JFFA 2PMPA 3V7EA 5BMVB 1XV2A 5CA1A 2N48A 1IV3A 1XRGA 4C8GA 5JVDB 3HJWC 5IJ0B 1DBFA 1NMUB 4WBNA 2ZOVA 2Q1YA 4O4IA 3C9SA 2UZHA 2B33A 3UT5A 2CHSA 2LCAA 2R6R1 3VTIC 3J80M 3JARB 4ZHQB 1K9MH 1W581 5GINC 4O4LB 2FC3A 3TD4A 1J7HA 4I4TA 1IV1A 3C9UA 2AIFA 1KQSF 3JALB 4U39A 3NK7A 2GLZA 5JQGB 3JATB 3FPIA 3VIUA 1YQNA 1RQ7A 3CYQA 5IYZA 1KNJA 1VQ4F 1SZQA 3QHDA 4BT6A 1JY8A 2I6DA 3HKEA 2OTMA 4X3MA 4TV8B 3JAWA 3LDTA 1QD9A 1VH8A 4ZOLA 4C8EA 2HQSC 2BO1A 3NVIB 1W42A 1KNKA 2BTQB 2LBTA 1W5FA 5FLXM 5G4VC 2VGNA 3PLAC 4X1KB 1W59A 1W40A 2AMTA 5ITZB 1VQMF 1K8AH 3CC7F 4RHAA 5EYPA 2OHWA 3OBYA 2ZVYA 2VXYA 4X20B 4DRXB 1U3LA 4EI8A 5GIOC 3S03A 3JAMM 3MCAB 5GIPC 2GZLA 2RHOA 5JH7B 2P6YA 1QVGF 2CZWA 2JNBA 1GO0A 4BT7A 4LNUB 3LWOC 1W57A 3I55F 5EB0A 3LFOA 1TUBA 1VQPF 1CN7A 5J2UB 2HP0A 2CHTA 4EI9A 4KWEA 3MQWA 2Z1UA 5HP7A 5CA0A 5CB4B 3J7AR 3P0ZA 5HWEA 1XBIA 3F0FA 5KMGA 2EWCA 1JN1A 3FFMA 4M8IA 1Z5VA 3VYTC 4O4IB 3RYCB 4X1YA 4EB6A 3NK6A 1XHOA 3P4EA 1JD1A 3K14A 1NQ3A 1FFXB 3HWUA 1RQ2A 3S06A 3S0YA 4C82A 4ZI7A 2KTVA 5EIBD 3P10A 4X1IA 5MN4A 3WGLA 3CPQA 5FJ4C 3O85A 4O2AB 3R0PA 3IKEA 3FD6A 3HKCB 1QAHA 3MDOA 1TVKB 2RHHA 1VQNF 3CPWF 3KJKA 4C81A 1SDSA 3E22A 5GONB 4FFBB 2OTLF 3HKDA 1VQ9F 1Q81H 1U40A 2ALEA 1IPAA 2RHLA 1YJ9F 5LOVA 3M84A 3G71F 1W41A 3TD3A 3WGKA 1KD1H 2HRYA 4NWOB 1VQ8F 4HNAB 3E20B 2AIZP 4G4XA 5FNVA 5JCOA 4ZHYB 5KX5B 4BY9D 3EORA 3KHNA 3LYBA 2F9ZC 3JASA 3WGMA 4YJ2A 3RYIB 3WGJA 3WPWA 4F6RA 3CCUF 4TZZA 2DT4A 3CCMF 4ZHWA 3CCEF 1W2BF 1W5EA 4TUYB 3WJRA 5C8YA 3G4SF 3CMEF 3CCJF 3GHZA 2IG8A 1T0KB 1YHQF 3JCMM 3CG6A 1R1MA 5HY1A 4YJ3A 1X52A 5EZYB 2VAPA 4X3LA 3C8LA 4G4YA 5LXTA 4PWTA 2H6LA 3QTYA 3JAKA 3AGKA 3S0WA 2KG4A 5B8FA 3V4DA 2OTJF 2CWJA 3ERNA 1VQ5F 3OBWA 4O2BA 1OAPA 1VQKF 4O4JA 4X1YB 1ODEA 1SA0A 3RYFA 3VYUC 5J2TB 1PF5A 4EB6B 3V3TA 3I56F 2QA4F 3F0EA 4O4HA 3PAFA 5LA6A 4B46A 4ZI7B 1Q86H
chains in the Genus database with same CATH topology
5GAPK 3RA5A 3J7AR 5A2QM 3SIVA 5HWEA 1NJIH 1XBIA 3LWPC 2HVYD 1PXWA 1Q7YH 1S72F 1VQLF 2KTUA 4BW0B 3FFMA 3RA6A 1K73H 3NMUC 3G6EF 1KC8H 3V7QA 2OZBA 3SIUA 4C4WC 3LWQC 1YITF 5GANK 3CC4F 3CC2F 4BVQA 1E7KA 3N4ZA 3CCLF 3NK6A 4NUTA 1YI2F 1GZ0A 3VI6A 3LWVC 1DT9A 3CCVF 3CCQF 2VGMA 1QVFF 2QI2A 2KTVA 3CPQA 5FJ4C 3V7EA 3CXCF 3NVKE 3O85A 3HJWC 1VQNF 4LCKA 3VMFB 1NMUB 3J81M 3CPWF 1M1KH 1SDSA 4BVSA 2OTLF 2LBWA 1VQ9F 1Q81H 2ALEA 1ZWZA 2QEXF 1IPAA 1YJ9F 1CK2A 3J80M 1RLGA 5DCVA 3G71F 1W41A 1K9MH 5GINC 1KD1H 1VQ8F 3ON1A 2FC3A 1Q82H 3E20B 3N4YA 3OW2F 3LWRC 1RA4A 5IT9M 4BVTA 1X7PA 4NQ3A 2AIFA 4BY9D 1KQSF 3NK7A 2F9ZC 1JJ2F 2GLZA 3GYQA 1H7MA 5HY2A 4BVRA 1VQ4F 3CCUF 1W3EX 3CCRF 1N8RH 4TZZA 3CCMF 1VQ6F 4XCQA 1GO1A 3WXMB 1X7OA 2I6DA 3CCEF 4X3MA 1W2BF 1YJWF 3NVIB 2BO1A 3CMEF 1W42A 5EWRA 3G4SF 3CCJF 1T0KB 1VQOF 1YHQF 5FLXM 5G4VC 2VGNA 3JCMM 3CMAF 3PLAC 3CG6A 5EO3A 1W40A 1VQMF 1K8AH 5HY1A 3CC7F 1X52A 3CD6F 3HAXD 4X3LA 5HXUA 3IR9A 5HXZA 5HY0A 2OHWA 3OBYA 5HY4A 3AGKA 1YIJF 3E1YA 2FGYA 3D00A 2KG4A 4EI8A 5GIOC 3JAMM 5G4UC 3MCAB 5GIPC 2OTJF 2WALA 1QVGF 1M90H 1VQ5F 3OBWA 2CZWA 2JNBA 2LBXA 4EI7A 1VQKF 1GO0A 3LWOC 3I55F 3LFOA 1CN7A 1VQPF 3V3TA 3I56F 1YJNF 2QA4F 4EI9A 3PAFA 1VQ7F 3CCSF 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAP K;  3RA5 A;  3J7A R;  5A2Q M;  3SIV A;  1NJI H;  1XBI A;  3LWP C;  2HVY D;  1PXW A;  1Q7Y H;  1S72 F;  1VQL F;  2KTU A;  4BW0 B;  3FFM A;  3RA6 A;  1K73 H;  3NMU C;  3G6E F;  1KC8 H;  3V7Q A;  2OZB A;  3SIU A;  4C4W C;  3LWQ C;  1YIT F;  5GAN K;  3CC4 F;  3CC2 F;  1E7K A;  3N4Z A;  3CCL F;  3NK6 A;  4NUT A;  1YI2 F;  1GZ0 A;  3VI6 A;  3LWV C;  1DT9 A;  3CCV F;  3CCQ F;  2VGM A;  1QVF F;  2QI2 A;  2KTV A;  3CPQ A;  5FJ4 C;  3V7E A;  3CXC F;  3NVK E;  3O85 A;  3HJW C;  1VQN F;  4LCK A;  3VMF B;  1NMU B;  3J81 M;  3CPW F;  1M1K H;  1SDS A;  2OTL F;  2LBW A;  1VQ9 F;  1Q81 H;  2ALE A;  1ZWZ A;  2QEX F;  1IPA A;  1YJ9 F;  1CK2 A;  3J80 M;  1RLG A;  5DCV A;  3G71 F;  1W41 A;  1K9M H;  5GIN C;  1KD1 H;  1VQ8 F;  3ON1 A;  2FC3 A;  1Q82 H;  3E20 B;  3N4Y A;  3OW2 F;  3LWR C;  1RA4 A;  5IT9 M;  1X7P A;  2AIF A;  4BY9 D;  1KQS F;  3NK7 A;  1JJ2 F;  3GYQ A;  1H7M A;  1VQ4 F;  3CCU F;  1W3E X;  3CCR F;  1N8R H;  4TZZ A;  3CCM F;  1VQ6 F;  1GO1 A;  3WXM B;  1X7O A;  2I6D A;  3CCE F;  4X3M A;  1W2B F;  1YJW F;  3NVI B;  2BO1 A;  3CME F;  1W42 A;  5EWR A;  3G4S F;  3CCJ F;  1T0K B;  1VQO F;  1YHQ F;  5FLX M;  5G4V C;  2VGN A;  3JCM M;  3CMA F;  3PLA C;  3CG6 A;  5EO3 A;  1W40 A;  1VQM F;  1K8A H;  3CC7 F;  1X52 A;  3CD6 F;  3HAX D;  4X3L A;  3IR9 A;  2OHW A;  3OBY A;  3AGK A;  1YIJ F;  3E1Y A;  2KG4 A;  5GIO C;  3JAM M;  5G4U C;  3MCA B;  5GIP C;  2OTJ F;  2WAL A;  1QVG F;  1M90 H;  1VQ5 F;  3OBW A;  2CZW A;  2JNB A;  2LBX A;  1VQK F;  1GO0 A;  3LWO C;  3I55 F;  3LFO A;  1CN7 A;  1VQP F;  3I56 F;  1YJN F;  2QA4 F;  3PAF A;  1VQ7 F;  3CCS F;  1Q86 H; 
#chains in the Genus database with same CATH topology
 2ZOD A;  3I3F A;  2CW4 A;  3RA5 A;  5A2Q M;  3N2G A;  1PXW A;  1VQL F;  2KTU A;  2HRU A;  3QUW A;  4ZK7 A;  2CSL A;  4TV9 B;  1KC8 H;  2PHN A;  3HKB B;  1W55 A;  1FNJ A;  3RYH A;  4I55 A;  3CC4 F;  2UYN A;  3CC2 F;  1Q8R A;  2RHJ A;  4U3J A;  4BT5 A;  1E7K A;  3CCL F;  2HS0 A;  1GZ0 A;  4G88 A;  3CCV F;  3KE1 A;  3HTN A;  5JCO C;  5IJ9 B;  5HP8 A;  1COM A;  1OFU A;  2Z01 A;  3IKF A;  1T0A A;  1JFF B;  5JVD A;  3VYS C;  5FNV B;  3CXC F;  4BT2 A;  5IJ0 A;  3NVK E;  2VAM A;  2HS4 A;  3F0D A;  3TD5 A;  5CA1 B;  2H8C A;  2VAW A;  4LCK A;  3GTZ A;  1VQV A;  2IQQ A;  4YJ2 B;  2LBW A;  4WBN B;  2KGW A;  2MQE A;  4F6R B;  1ZWZ A;  4ZHQ A;  5LYJ A;  1CK2 A;  3UT5 B;  1RLG A;  5DCV A;  3CB2 A;  4O4L A;  2IAF A;  3VOB A;  3F0G A;  3ELC A;  2I6R A;  1Z5W A;  5C8Y B;  3OW2 F;  3N2K A;  1RA4 A;  3JAL A;  4I4T B;  4NQ3 A;  3C9T A;  5MN5 A;  1JJ2 F;  5LXT B;  4R40 B;  3GYQ A;  3WJQ A;  5HY2 A;  2HP3 A;  5EIB C;  5LP6 C;  3JAK B;  3MBM A;  3RE3 A;  2YXZ A;  2BTU A;  5IYZ B;  4TV8 A;  4B5C A;  2UYJ A;  3S0H A;  1GO1 A;  2ZVZ A;  1SA0 B;  3HKE B;  3JAW B;  4ZOL B;  4X1K A;  1VQO F;  5ITZ A;  5EO3 A;  5LA6 B;  1U3P A;  4E6E A;  4B62 A;  5MN6 A;  2L26 A;  5HXU A;  3IR9 A;  4X20 A;  4DRX A;  3K2X A;  3ESJ A;  3ZP4 A;  5EYP B;  1YIJ F;  3VOA A;  2FGY A;  3C9R A;  5JH7 A;  1H47 A;  5G4U C;  2RB9 A;  3BYQ A;  1M90 H;  4LNU A;  2LBX A;  2UYN B;  5J2U A;  3WPX A;  1YJN F;  4IHJ A;  3K0T A;  1TUB B;  4IIJ A;  1VQ7 F;  5CB4 A;  2HP0 B;  3CCS F;  5GAP K;  3MCQ A;  4G4W A;  3SIV A;  2R75 1;  5CA0 B;  5EB1 B;  1NJI H;  2HVY D;  3JVH A;  4BW0 B;  5KMG B;  1K73 H;  3NMU C;  3RYC A;  2Z1T A;  2OZB A;  3SIU A;  4C4W C;  2K1S A;  4DXD A;  3LWQ C;  4ERH A;  1IV2 A;  3M4S A;  3CYP B;  5LP6 A;  5LYJ B;  3N4Z A;  1W5A A;  1FFX A;  3VI6 A;  3ZP7 A;  1DT9 A;  2ZF8 A;  3LWV C;  1QVF F;  3D54 A;  4C8I A;  3OON A;  3Q8H A;  1VHA A;  1U43 A;  3KIZ A;  2GVI A;  3N2K B;  4O2A A;  2UYK A;  4X1I B;  3HKC A;  1TVK A;  4I50 A;  4G4Z A;  1QU9 A;  5GON A;  3VMF B;  4FFB A;  3J81 M;  3FD5 A;  1M1K H;  3F6M A;  4BVS A;  3ZOP A;  2Z1E A;  2BTO A;  1UI9 A;  1VK3 A;  3E22 B;  2ZAU A;  2QEX F;  3HKD B;  3WGN A;  4BT3 A;  3K12 A;  2YYE A;  1FSZ A;  2DYY A;  3I7T A;  2NMU A;  1UFY A;  4HNA A;  5LOV B;  3DC2 A;  3FBA A;  2H8E A;  3ON1 A;  1Q82 H;  3N4Y A;  3KJJ A;  3LWR C;  5KX5 A;  5IT9 M;  5BMV A;  4BVT A;  1X7P A;  4RQO A;  2W8B C;  3RYI A;  4G4V A;  1H7M A;  4BVR A;  2HS3 A;  3JAS B;  1W3E X;  3CCR F;  1N8R H;  3VO8 A;  1VQ6 F;  4XCQ A;  3WXM B;  3JAR A;  1X7O A;  4TUY A;  3ZO8 A;  1YJW F;  4BT4 A;  5EWR A;  3WJP A;  2V9Y A;  1YGY A;  3D01 A;  4IHJ B;  3CMA F;  3LME A;  1X25 A;  4IIJ B;  5EZY A;  3CD6 F;  3HAX D;  3M1X A;  2G9I A;  1IV4 A;  5HXZ A;  2CVL A;  3IEW A;  2Q1X A;  4YJ3 B;  2Z1F A;  2QTP A;  3JAT A;  5HY0 A;  5JQG A;  3S02 A;  5HY4 A;  3E1Y A;  3D00 A;  1GX1 A;  3T80 A;  1RLU A;  4B45 A;  2WAL A;  3DDN A;  5J2T A;  4EI7 A;  1FNK A;  4O2B B;  5LP6 B;  4O4J B;  3RYF B;  3IMP A;  3B6N A;  3L7Q A;  2HX0 A;  4O4H B;  3LWP C;  3IEQ A;  1Q7Y H;  1S72 F;  1H48 A;  4I50 B;  4TV9 A;  3N2G B;  1W5B A;  3HKB A;  3RA6 A;  3G6E F;  3V7Q A;  3VCZ A;  1YIT F;  2UYP A;  4ZHV A;  5GAN K;  3RYH B;  3U0O A;  4BVQ A;  4I55 B;  5EAZ A;  4NUT A;  1YI2 F;  5AVM A;  4U3J B;  5IJ9 A;  3CCQ F;  2VGM A;  1ONI A;  1CLI A;  2QI2 A;  1JFF A;  2PMP A;  3V7E A;  5BMV B;  1XV2 A;  5CA1 A;  2N48 A;  1IV3 A;  1XRG A;  4C8G A;  5JVD B;  3HJW C;  5IJ0 B;  1DBF A;  1NMU B;  4WBN A;  2ZOV A;  2Q1Y A;  4O4I A;  3C9S A;  2UZH A;  2B33 A;  3UT5 A;  2CHS A;  2LCA A;  2R6R 1;  3VTI C;  3J80 M;  3JAR B;  4ZHQ B;  1K9M H;  1W58 1;  5GIN C;  4O4L B;  2FC3 A;  3TD4 A;  1J7H A;  4I4T A;  1IV1 A;  3C9U A;  2AIF A;  1KQS F;  3JAL B;  4U39 A;  3NK7 A;  2GLZ A;  5JQG B;  3JAT B;  3FPI A;  3VIU A;  1YQN A;  1RQ7 A;  3CYQ A;  5IYZ A;  1KNJ A;  1VQ4 F;  1SZQ A;  3QHD A;  4BT6 A;  1JY8 A;  2I6D A;  3HKE A;  2OTM A;  4X3M A;  4TV8 B;  3JAW A;  3LDT A;  1QD9 A;  1VH8 A;  4ZOL A;  4C8E A;  2HQS C;  2BO1 A;  3NVI B;  1W42 A;  1KNK A;  2BTQ B;  2LBT A;  1W5F A;  5FLX M;  5G4V C;  2VGN A;  3PLA C;  4X1K B;  1W59 A;  1W40 A;  2AMT A;  5ITZ B;  1VQM F;  1K8A H;  3CC7 F;  4RHA A;  5EYP A;  2OHW A;  3OBY A;  2ZVY A;  2VXY A;  4X20 B;  4DRX B;  1U3L A;  4EI8 A;  5GIO C;  3S03 A;  3JAM M;  3MCA B;  5GIP C;  2GZL A;  2RHO A;  5JH7 B;  2P6Y A;  1QVG F;  2CZW A;  2JNB A;  1GO0 A;  4BT7 A;  4LNU B;  3LWO C;  1W57 A;  3I55 F;  5EB0 A;  3LFO A;  1TUB A;  1VQP F;  1CN7 A;  5J2U B;  2HP0 A;  2CHT A;  4EI9 A;  4KWE A;  3MQW A;  2Z1U A;  5HP7 A;  5CA0 A;  5CB4 B;  3J7A R;  3P0Z A;  5HWE A;  1XBI A;  3F0F A;  5KMG A;  2EWC A;  1JN1 A;  3FFM A;  4M8I A;  1Z5V A;  3VYT C;  4O4I B;  3RYC B;  4X1Y A;  4EB6 A;  3NK6 A;  1XHO A;  3P4E A;  1JD1 A;  3K14 A;  1NQ3 A;  1FFX B;  3HWU A;  1RQ2 A;  3S06 A;  3S0Y A;  4C82 A;  4ZI7 A;  2KTV A;  5EIB D;  3P10 A;  4X1I A;  5MN4 A;  3WGL A;  3CPQ A;  5FJ4 C;  3O85 A;  4O2A B;  3R0P A;  3IKE A;  3FD6 A;  3HKC B;  1QAH A;  3MDO A;  1TVK B;  2RHH A;  1VQN F;  3CPW F;  3KJK A;  4C81 A;  1SDS A;  3E22 A;  5GON B;  4FFB B;  2OTL F;  3HKD A;  1VQ9 F;  1Q81 H;  1U40 A;  2ALE A;  1IPA A;  2RHL A;  1YJ9 F;  5LOV A;  3M84 A;  3G71 F;  1W41 A;  3TD3 A;  3WGK A;  1KD1 H;  2HRY A;  4NWO B;  1VQ8 F;  4HNA B;  3E20 B;  2AIZ P;  4G4X A;  5FNV A;  5JCO A;  4ZHY B;  5KX5 B;  4BY9 D;  3EOR A;  3KHN A;  3LYB A;  2F9Z C;  3JAS A;  3WGM A;  4YJ2 A;  3RYI B;  3WGJ A;  3WPW A;  4F6R A;  3CCU F;  4TZZ A;  2DT4 A;  3CCM F;  4ZHW A;  3CCE F;  1W2B F;  1W5E A;  4TUY B;  3WJR A;  5C8Y A;  3G4S F;  3CME F;  3CCJ F;  3GHZ A;  2IG8 A;  1T0K B;  1YHQ F;  3JCM M;  3CG6 A;  1R1M A;  5HY1 A;  4YJ3 A;  1X52 A;  5EZY B;  2VAP A;  4X3L A;  3C8L A;  4G4Y A;  5LXT A;  4PWT A;  2H6L A;  3QTY A;  3JAK A;  3AGK A;  3S0W A;  2KG4 A;  5B8F A;  3V4D A;  2OTJ F;  2CWJ A;  3ERN A;  1VQ5 F;  3OBW A;  4O2B A;  1OAP A;  1VQK F;  4O4J A;  4X1Y B;  1ODE A;  1SA0 A;  3RYF A;  3VYU C;  5J2T B;  1PF5 A;  4EB6 B;  3V3T A;  3I56 F;  2QA4 F;  3F0E A;  4O4H A;  3PAF A;  5LA6 A;  4B46 A;  4ZI7 B;  1Q86 H; 
#chains in the Genus database with same CATH homology
 5GAP K;  3RA5 A;  3J7A R;  5A2Q M;  3SIV A;  5HWE A;  1NJI H;  1XBI A;  3LWP C;  2HVY D;  1PXW A;  1Q7Y H;  1S72 F;  1VQL F;  2KTU A;  4BW0 B;  3FFM A;  3RA6 A;  1K73 H;  3NMU C;  3G6E F;  1KC8 H;  3V7Q A;  2OZB A;  3SIU A;  4C4W C;  3LWQ C;  1YIT F;  5GAN K;  3CC4 F;  3CC2 F;  4BVQ A;  1E7K A;  3N4Z A;  3CCL F;  3NK6 A;  4NUT A;  1YI2 F;  1GZ0 A;  3VI6 A;  3LWV C;  1DT9 A;  3CCV F;  3CCQ F;  2VGM A;  1QVF F;  2QI2 A;  2KTV A;  3CPQ A;  5FJ4 C;  3V7E A;  3CXC F;  3NVK E;  3O85 A;  3HJW C;  1VQN F;  4LCK A;  3VMF B;  1NMU B;  3J81 M;  3CPW F;  1M1K H;  1SDS A;  4BVS A;  2OTL F;  2LBW A;  1VQ9 F;  1Q81 H;  2ALE A;  1ZWZ A;  2QEX F;  1IPA A;  1YJ9 F;  1CK2 A;  3J80 M;  1RLG A;  5DCV A;  3G71 F;  1W41 A;  1K9M H;  5GIN C;  1KD1 H;  1VQ8 F;  3ON1 A;  2FC3 A;  1Q82 H;  3E20 B;  3N4Y A;  3OW2 F;  3LWR C;  1RA4 A;  5IT9 M;  4BVT A;  1X7P A;  4NQ3 A;  2AIF A;  4BY9 D;  1KQS F;  3NK7 A;  2F9Z C;  1JJ2 F;  2GLZ A;  3GYQ A;  1H7M A;  5HY2 A;  4BVR A;  1VQ4 F;  3CCU F;  1W3E X;  3CCR F;  1N8R H;  4TZZ A;  3CCM F;  1VQ6 F;  4XCQ A;  1GO1 A;  3WXM B;  1X7O A;  2I6D A;  3CCE F;  4X3M A;  1W2B F;  1YJW F;  3NVI B;  2BO1 A;  3CME F;  1W42 A;  5EWR A;  3G4S F;  3CCJ F;  1T0K B;  1VQO F;  1YHQ F;  5FLX M;  5G4V C;  2VGN A;  3JCM M;  3CMA F;  3PLA C;  3CG6 A;  5EO3 A;  1W40 A;  1VQM F;  1K8A H;  5HY1 A;  3CC7 F;  1X52 A;  3CD6 F;  3HAX D;  4X3L A;  5HXU A;  3IR9 A;  5HXZ A;  5HY0 A;  2OHW A;  3OBY A;  5HY4 A;  3AGK A;  1YIJ F;  3E1Y A;  2FGY A;  3D00 A;  2KG4 A;  4EI8 A;  5GIO C;  3JAM M;  5G4U C;  3MCA B;  5GIP C;  2OTJ F;  2WAL A;  1QVG F;  1M90 H;  1VQ5 F;  3OBW A;  2CZW A;  2JNB A;  2LBX A;  4EI7 A;  1VQK F;  1GO0 A;  3LWO C;  3I55 F;  3LFO A;  1CN7 A;  1VQP F;  3V3T A;  3I56 F;  1YJN F;  2QA4 F;  4EI9 A;  3PAF A;  1VQ7 F;  3CCS F;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...