3HJWC

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
molecule keywords Pseudouridine synthase Cbf5
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3hjwC00
3G4SF 1N8RH 3FFMA 3OBYA 1W41A 2AIFA 1X7PA 3CCQF 2QA4F 3CCVF 2KTUA 1YITF 1VQ7F 3E20B 3V7QA 3WXMB 1T0KB 1X52A 2CZWA 1VQ5F 3LWQC 3J80M 3CMAF 3MCAB 1VQKF 1VQ4F 2KTVA 2VGNA 4X3MA 2ALEA 2VGMA 3PAFA 5GANK 1H7MA 4TZZA 3G71F 3CC4F 5EO3A 3CCUF 3CG6A 4X3LA 5FJ4C 1W3EX 3RA6A 3J7AR 1X7OA 3SIVA 2LBXA 2OHWA 1VQLF 2KG4A 1XBIA 5G4UC 3CCMF 1E7KA 3LWVC 5A2QM 4BW0B 1YJNF 2QEXF 5FLXM 3CPQA 1Q82H 3LFOA 3N4YA 1K73H 4LCKA 1GO0A 1VQOF 1YJ9F 1ZWZA 1NJIH 3NVIB 4NUTA 3JCMM 3HAXD 1KC8H 3NVKE 1S72F 1Q81H 1W42A 1SDSA 1DT9A 5GIOC 3LWPC 3CCLF 1YJWF 3LWOC 3E1YA 3G6EF 3OBWA 1VQNF 1QVFF 3GYQA 3N4ZA 3NK6A 5GAPK 1W40A 3CMEF 3ON1A 1IPAA 1GZ0A 1GO1A 3CCJF 1Q7YH 1YIJF 1VQ6F 2I6DA 3CXCF 4BY9D 1VQPF 2WALA 1W2BF 1K9MH 1QVGF 1JJ2F 3OW2F 3JAMM 3CC2F 3VI6A 3CCEF 1M90H 2OZBA 3O85A 2BO1A 3I56F 3J81M 1RLGA 2OTLF 1KQSF 3AGKA 1Q86H 2FC3A 2OTJF 5EWRA 1YI2F 3LWRC 3SIUA 2HVYD 1VQ9F 1YHQF 1NMUB 5GINC 3CD6F 3CCRF 2JNBA 3NK7A 1K8AH 1RA4A 3PLAC 4C4WC 2QI2A 3CC7F 3HJWC 2LBWA 5GIPC 1VQMF 3I55F 3IR9A 1KD1H 3CPWF 3RA5A 5G4VC 1CK2A 1VQ8F 3CCSF 3VMFB 3V7EA 5DCVA 3NMUC 1PXWA 5IT9M 1CN7A 1M1KH
chains in the Genus database with same CATH superfamily
5IJ9A 2Z1EA 1W41A 1VK3A 3ZOPA 3IEQA 1YITF 3OONA 2GLZA 3E20B 2RHLA 1X52A 4G4ZA 4F6RB 2ZF8A 1JFFB 4X1YB 2F9ZC 4LNUA 4X20B 3WGKA 3G71F 5HP8A 3CC4F 2YXZA 3CCUF 3K12A 4TUYB 5JVDB 5FJ4C 3VIUA 3D54A 5LOVB 4G88A 1X7OA 3ZO8A 1VQVA 3ESJA 5EB0A 4G4XA 3EORA 2OTMA 3RYFB 1E7KA 4C81A 1W5EA 3K2XA 3LWVC 2K1SA 5A2QM 2RHJA 1W5FA 5CB4B 2DT4A 2ZAUA 3JAKB 5FLXM 5BMVA 1Q82H 1Q8RA 2BTQB 4EI9A 3TD3A 1JY8A 1JFFA 2UZHA 3B6NA 2MQEA 5BMVB 1YGYA 4IHJA 3JCMM 4F6RA 4G4YA 3P0ZA 1S72F 3DC2A 4FFBA 2GVIA 5GIOC 1TVKA 3E1YA 1X25A 3OBWA 1VQNF 4BT7A 3ON1A 4O4HA 4X1IB 1YQNA 1YIJF 1VQ6F 5JVDA 1VQPF 2WALA 5LYJA 1QVGF 3FD6A 2RB9A 3CC2F 3CCEF 4DXDA 3O85A 1Z5VA 5EZYB 3I56F 2R751 1Q86H 2FC3A 1JN1A 1IV1A 3LWRC 2HVYD 3WJPA 3M1XA 2CWJA 5GINC 2IQQA 3HKCA 4WBNA 1H47A 3WJRA 5HXUA 1ONIA 3NK7A 1U43A 3PLAC 3D01A 2CW4A 3F6MA 4O2BA 4IHJB 3CYQA 3WGLA 1PF5A 4HNAB 3I55F 2VXYA 3FPIA 3Q8HA 3RA5A 5G4VC 1CK2A 2I6RA 3BYQA 2HP3A 3VMFB 3JAKA 3V7EA 4B46A 3C8LA 3NMUC 2L26A 5GONA 1M1KH 4NQ3A 5KX5A 4IIJB 3OBYA 3WJQA 2BTOA 1X7PA 5KX5B 3S0YA 2QA4F 5HP7A 2VAMA 3V7QA 4B45A 3WXMB 1T0KB 1VQ5F 3LWQC 5EYPA 1VQKF 2EWCA 4YJ3B 3I7TA 2KTVA 2VGNA 3LMEA 5GANK 4O2AB 4X20A 1H7MA 4O4IA 3ERNA 4BT3A 5HWEA 3HKDB 1CLIA 2Z1FA 5LA6A 3JAWA 3N2GA 3JARA 3RA6A 3J7AR 5LXTA 5CA0A 4ZOLB 2HS3A 3UT5A 4BT4A 1XBIA 2H6LA 3ELCA 1SZQA 4RHAA 4RQOA 3UT5B 3MCQA 3TD4A 3P10A 2Z1UA 1YJNF 5LP6C 5IJ0B 4O4JA 2QEXF 1RQ2A 3CPQA 3LFOA 5FNVB 1YJ9F 1ZWZA 4O2AA 4C82A 3S0HA 5FNVA 4BT6A 5IYZA 5LYJB 3NVIB 4NUTA 3HAXD 2GZLA 3T80A 1U3PA 3HTNA 4TV8B 3VOBA 1SDSA 1FFXB 3E22B 3CB2A 3JATA 4ZHQB 2NMUA 1QVFF 3GYQA 5GAPK 1IPAA 1W581 5GONB 3N2GB 3CCJF 2I6DA 4BY9D 2G9IA 4KWEA 5J2UB 3IMPA 2OZBA 5EYPB 5JCOA 3K14A 3RYHB 1Z5WA 1XHOA 3U0OA 2HRYA 2ZODA 3SIUA 4ZK7A 1YHQF 1NMUB 3KJKA 4BT2A 3JATB 4ZHQA 1QAHA 1R1MA 2IG8A 4E6EA 1XRGA 4WBNB 2H8EA 3GTZA 1W55A 3ZP4A 1K8AH 3LYBA 3RE3A 3CC7F 5HY1A 2LBWA 2VAPA 5EIBD 3RYIB 5GIPC 5EZYA 3S0WA 3N2KB 2ZOVA 4LNUB 2W8BC 3VO8A 3LDTA 4YJ2B 5HY4A 2HRUA 5JH7B 3G4SF 3C9RA 1SA0B 2PMPA 2AIFA 3CCQF 1VQ7F 2BTUA 2Q1XA 4ZHWA 2Z1TA 4I50B 3JARB 5EIBC 2CZWA 2P6YA 3C9SA 3CMAF 3I3FA 5LA6B 3J80M 3VCZA 2FGYA 1VQ4F 2HP0B 4DRXB 3FBAA 4X3MA 2ALEA 3S02A 4I55A 4B5CA 1QU9A 1NQ3A 5EO3A 4EB6A 3IKFA 4X3LA 5CB4A 3WPXA 3CYPB 3F0EA 3JALB 2LBXA 1FNJA 5CA1B 3RYCA 3RYCB 3VYUC 1OFUA 3M4SA 4I4TB 3QHDA 3VYSC 3JASB 1VH8A 3RYHA 4O4LB 3QUWA 2B33A 3M84A 2HQSC 2CSLA 4EB6B 3N4YA 4ZHYB 3HKEA 3WPWA 5J2TA 5MN4A 2HP0A 4DRXA 1NJIH 5KMGA 1QD9A 1COMA 4I50A 3NVKE 2QTPA 3RYFA 3LWPC 3CCLF 1YJWF 5ITZA 4U39A 5MN6A 3HKCB 2CHTA 3C9TA 1FFXA 3E22A 3JVHA 3F0FA 3N4ZA 3NK6A 2DYYA 3CMEF 3JALA 2KGWA 4EI8A 1W59A 5LOVA 1GO1A 2V9YA 3V3TA 4YJ2A 3K0TA 3CXCF 4TUYA 1UFYA 2AIZP 3JAMM 1DBFA 1M90H 2BO1A 1IV4A 3RYIA 5LP6A 1KQSF 5JQGB 2OTJF 5C8YA 1YI2F 2AMTA 3MQWA 2UYJA 1VQ9F 3IEWA 3D00A 5JCOC 1KNJA 4X1KB 4BT5A 5IJ9B 4ZOLA 1W5AA 2JNBA 5LXTB 1TUBB 1RA4A 2CVLA 5JH7A 4C4WC 1U40A 1RQ7A 3L7QA 1VQMF 1IV2A 1KD1H 1VHAA 1OAPA 3N2KA 2RHHA 2VAWA 2ZVZA 4YJ3A 1VQ8F 2LBTA 3VTIC 3MDOA 4O4LA 3P4EA 4PWTA 1KNKA 5IT9M 3JASA 4U3JA 2N48A 3HWUA 1RLUA 4G4WA 4I4TA 1N8RH 3FFMA 4C8IA 2IAFA 4TV9A 3CCVF 2KTUA 3VOAA 3FD5A 3S06A 3WGJA 4R40B 2UYNA 1T0AA 2UYPA 4ZI7B 5HXZA 3MCAB 3KIZA 4XCQA 3PAFA 2VGMA 2R6R1 4NWOB 4X1YA 4TZZA 4EI7A 1FNKA 5J2UA 1U3LA 3CG6A 3F0DA 1W3EX 4O4JB 4O2BB 5IJ0A 3SIVA 2OHWA 2Q1YA 1VQLF 2KG4A 1SA0A 3MBMA 3IKEA 2RHOA 5G4UC 5HY2A 3CCMF 2Z01A 5EB1B 3GHZA 5CA0B 1ODEA 4G4VA 4BW0B 5C8YB 4B62A 1JD1A 5LP6B 3HKDA 5MN5A 1W5BA 1K73H 4LCKA 1GO0A 1VQOF 3C9UA 3QTYA 2HS4A 2LCAA 5B8FA 3ZP7A 5HY0A 1J7HA 3HKBA 2HX0A 3TD5A 1KC8H 2UYNB 1Q81H 3S03A 1W42A 3F0GA 1DT9A 4ERHA 2HS0A 3LWOC 3G6EF 5ITZB 1TVKB 4M8IA 4C8GA 1W40A 3R0PA 3WGMA 1FSZA 1XV2A 4FFBB 4U3JB 3DDNA 1GZ0A 2YYEA 1Q7YH 3JAWB 1UI9A 5KMGB 1K9MH 1W2BF 4ZHVA 1JJ2F 3OW2F 3HKEB 4O4IB 3VYTC 5J2TB 3VI6A 2UYKA 3V4DA 4HNAA 3KE1A 3J81M 1RLGA 2OTLF 3AGKA 3KHNA 4BVSA 5EWRA 4ZI7A 5EAZA 4TV9B 2PHNA 4X1KA 1IV3A 4BVQA 3CD6F 1W57A 4C8EA 4IIJA 3CCRF 5CA1A 3KJJA 3WGNA 4BVRA 5AVMA 4TV8A 2QI2A 3HKBB 5JQGA 3HJWC 4BVTA 5IYZB 3IR9A 3CPWF 4I55B 1GX1A 2H8CA 3CCSF 5DCVA 1PXWA 1H48A 2CHSA 4O4HB 4X1IA 1TUBA 1CN7A 2ZVYA
chains in the Genus database with same CATH topology
4NQ3A 3G4SF 1N8RH 3FFMA 3OBYA 1W41A 2AIFA 1X7PA 3CCQF 2QA4F 3CCVF 2KTUA 1YITF 1VQ7F 2GLZA 3E20B 3V7QA 3WXMB 1T0KB 1X52A 2CZWA 1VQ5F 3LWQC 3J80M 5HXZA 3MCAB 3CMAF 2FGYA 1VQ4F 1VQKF 2KTVA 2VGNA 4XCQA 4X3MA 2ALEA 2VGMA 3PAFA 5GANK 2F9ZC 1H7MA 4TZZA 4EI7A 3G71F 3CC4F 5EO3A 5HWEA 3CCUF 3CG6A 4X3LA 5FJ4C 1W3EX 3RA6A 3J7AR 1X7OA 3SIVA 2LBXA 2OHWA 1VQLF 2KG4A 1XBIA 5G4UC 5HY2A 3CCMF 1E7KA 3LWVC 5A2QM 4BW0B 1YJNF 2QEXF 5FLXM 3CPQA 1Q82H 3LFOA 3N4YA 4EI9A 1K73H 4LCKA 1GO0A 1VQOF 1YJ9F 1ZWZA 1NJIH 3NVIB 4NUTA 3JCMM 5HY0A 3HAXD 1KC8H 3NVKE 1S72F 1Q81H 1W42A 1SDSA 1DT9A 5GIOC 3LWPC 3CCLF 1YJWF 3LWOC 3E1YA 3G6EF 3OBWA 1VQNF 1QVFF 3GYQA 3N4ZA 3NK6A 5GAPK 1W40A 3CMEF 4EI8A 3ON1A 1IPAA 1GZ0A 1GO1A 3CCJF 1Q7YH 3V3TA 1YIJF 2I6DA 3CXCF 1VQ6F 4BY9D 1VQPF 2WALA 1W2BF 1K9MH 1QVGF 1JJ2F 3OW2F 3JAMM 3CC2F 3VI6A 3CCEF 1M90H 2OZBA 3O85A 2BO1A 3I56F 3J81M 1RLGA 2OTLF 1KQSF 3AGKA 1Q86H 2FC3A 2OTJF 4BVSA 5EWRA 1YI2F 3LWRC 3SIUA 2HVYD 1VQ9F 1YHQF 1NMUB 4BVQA 5GINC 3CD6F 3D00A 3CCRF 5HXUA 2JNBA 3NK7A 1K8AH 1RA4A 4BVRA 3PLAC 4C4WC 2QI2A 3CC7F 5HY1A 3HJWC 2LBWA 5GIPC 4BVTA 1VQMF 3I55F 3IR9A 1KD1H 3CPWF 3RA5A 5G4VC 1CK2A 1VQ8F 3CCSF 3VMFB 3V7EA 5DCVA 3NMUC 1PXWA 5HY4A 5IT9M 1CN7A 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S F;  1N8R H;  3FFM A;  3OBY A;  1W41 A;  2AIF A;  1X7P A;  3CCQ F;  2QA4 F;  3CCV F;  2KTU A;  1YIT F;  1VQ7 F;  3E20 B;  3V7Q A;  3WXM B;  1T0K B;  1X52 A;  2CZW A;  1VQ5 F;  3LWQ C;  3J80 M;  3CMA F;  3MCA B;  1VQK F;  1VQ4 F;  2KTV A;  2VGN A;  4X3M A;  2ALE A;  2VGM A;  3PAF A;  5GAN K;  1H7M A;  4TZZ A;  3G71 F;  3CC4 F;  5EO3 A;  3CCU F;  3CG6 A;  4X3L A;  5FJ4 C;  1W3E X;  3RA6 A;  3J7A R;  1X7O A;  3SIV A;  2LBX A;  2OHW A;  1VQL F;  2KG4 A;  1XBI A;  5G4U C;  3CCM F;  1E7K A;  3LWV C;  5A2Q M;  4BW0 B;  1YJN F;  2QEX F;  5FLX M;  3CPQ A;  1Q82 H;  3LFO A;  3N4Y A;  1K73 H;  4LCK A;  1GO0 A;  1VQO F;  1YJ9 F;  1ZWZ A;  1NJI H;  3NVI B;  4NUT A;  3JCM M;  3HAX D;  1KC8 H;  3NVK E;  1S72 F;  1Q81 H;  1W42 A;  1SDS A;  1DT9 A;  5GIO C;  3LWP C;  3CCL F;  1YJW F;  3LWO C;  3E1Y A;  3G6E F;  3OBW A;  1VQN F;  1QVF F;  3GYQ A;  3N4Z A;  3NK6 A;  5GAP K;  1W40 A;  3CME F;  3ON1 A;  1IPA A;  1GZ0 A;  1GO1 A;  3CCJ F;  1Q7Y H;  1YIJ F;  1VQ6 F;  2I6D A;  3CXC F;  4BY9 D;  1VQP F;  2WAL A;  1W2B F;  1K9M H;  1QVG F;  1JJ2 F;  3OW2 F;  3JAM M;  3CC2 F;  3VI6 A;  3CCE F;  1M90 H;  2OZB A;  3O85 A;  2BO1 A;  3I56 F;  3J81 M;  1RLG A;  2OTL F;  1KQS F;  3AGK A;  1Q86 H;  2FC3 A;  2OTJ F;  5EWR A;  1YI2 F;  3LWR C;  3SIU A;  2HVY D;  1VQ9 F;  1YHQ F;  1NMU B;  5GIN C;  3CD6 F;  3CCR F;  2JNB A;  3NK7 A;  1K8A H;  1RA4 A;  3PLA C;  4C4W C;  2QI2 A;  3CC7 F;  3HJW C;  2LBW A;  5GIP C;  1VQM F;  3I55 F;  3IR9 A;  1KD1 H;  3CPW F;  3RA5 A;  5G4V C;  1CK2 A;  1VQ8 F;  3CCS F;  3VMF B;  3V7E A;  5DCV A;  3NMU C;  1PXW A;  5IT9 M;  1CN7 A;  1M1K H; 
#chains in the Genus database with same CATH topology
 5IJ9 A;  2Z1E A;  1W41 A;  1VK3 A;  3ZOP A;  3IEQ A;  1YIT F;  3OON A;  2GLZ A;  3E20 B;  2RHL A;  1X52 A;  4G4Z A;  4F6R B;  2ZF8 A;  1JFF B;  4X1Y B;  2F9Z C;  4LNU A;  4X20 B;  3WGK A;  3G71 F;  5HP8 A;  3CC4 F;  2YXZ A;  3CCU F;  3K12 A;  4TUY B;  5JVD B;  5FJ4 C;  3VIU A;  3D54 A;  5LOV B;  4G88 A;  1X7O A;  3ZO8 A;  1VQV A;  3ESJ A;  5EB0 A;  4G4X A;  3EOR A;  2OTM A;  3RYF B;  1E7K A;  4C81 A;  1W5E A;  3K2X A;  3LWV C;  2K1S A;  5A2Q M;  2RHJ A;  1W5F A;  5CB4 B;  2DT4 A;  2ZAU A;  3JAK B;  5FLX M;  5BMV A;  1Q82 H;  1Q8R A;  2BTQ B;  4EI9 A;  3TD3 A;  1JY8 A;  1JFF A;  2UZH A;  3B6N A;  2MQE A;  5BMV B;  1YGY A;  4IHJ A;  3JCM M;  4F6R A;  4G4Y A;  3P0Z A;  1S72 F;  3DC2 A;  4FFB A;  2GVI A;  5GIO C;  1TVK A;  3E1Y A;  1X25 A;  3OBW A;  1VQN F;  4BT7 A;  3ON1 A;  4O4H A;  4X1I B;  1YQN A;  1YIJ F;  1VQ6 F;  5JVD A;  1VQP F;  2WAL A;  5LYJ A;  1QVG F;  3FD6 A;  2RB9 A;  3CC2 F;  3CCE F;  4DXD A;  3O85 A;  1Z5V A;  5EZY B;  3I56 F;  2R75 1;  1Q86 H;  2FC3 A;  1JN1 A;  1IV1 A;  3LWR C;  2HVY D;  3WJP A;  3M1X A;  2CWJ A;  5GIN C;  2IQQ A;  3HKC A;  4WBN A;  1H47 A;  3WJR A;  5HXU A;  1ONI A;  3NK7 A;  1U43 A;  3PLA C;  3D01 A;  2CW4 A;  3F6M A;  4O2B A;  4IHJ B;  3CYQ A;  3WGL A;  1PF5 A;  4HNA B;  3I55 F;  2VXY A;  3FPI A;  3Q8H A;  3RA5 A;  5G4V C;  1CK2 A;  2I6R A;  3BYQ A;  2HP3 A;  3VMF B;  3JAK A;  3V7E A;  4B46 A;  3C8L A;  3NMU C;  2L26 A;  5GON A;  1M1K H;  4NQ3 A;  5KX5 A;  4IIJ B;  3OBY A;  3WJQ A;  2BTO A;  1X7P A;  5KX5 B;  3S0Y A;  2QA4 F;  5HP7 A;  2VAM A;  3V7Q A;  4B45 A;  3WXM B;  1T0K B;  1VQ5 F;  3LWQ C;  5EYP A;  1VQK F;  2EWC A;  4YJ3 B;  3I7T A;  2KTV A;  2VGN A;  3LME A;  5GAN K;  4O2A B;  4X20 A;  1H7M A;  4O4I A;  3ERN A;  4BT3 A;  5HWE A;  3HKD B;  1CLI A;  2Z1F A;  5LA6 A;  3JAW A;  3N2G A;  3JAR A;  3RA6 A;  3J7A R;  5LXT A;  5CA0 A;  4ZOL B;  2HS3 A;  3UT5 A;  4BT4 A;  1XBI A;  2H6L A;  3ELC A;  1SZQ A;  4RHA A;  4RQO A;  3UT5 B;  3MCQ A;  3TD4 A;  3P10 A;  2Z1U A;  1YJN F;  5LP6 C;  5IJ0 B;  4O4J A;  2QEX F;  1RQ2 A;  3CPQ A;  3LFO A;  5FNV B;  1YJ9 F;  1ZWZ A;  4O2A A;  4C82 A;  3S0H A;  5FNV A;  4BT6 A;  5IYZ A;  5LYJ B;  3NVI B;  4NUT A;  3HAX D;  2GZL A;  3T80 A;  1U3P A;  3HTN A;  4TV8 B;  3VOB A;  1SDS A;  1FFX B;  3E22 B;  3CB2 A;  3JAT A;  4ZHQ B;  2NMU A;  1QVF F;  3GYQ A;  5GAP K;  1IPA A;  1W58 1;  5GON B;  3N2G B;  3CCJ F;  2I6D A;  4BY9 D;  2G9I A;  4KWE A;  5J2U B;  3IMP A;  2OZB A;  5EYP B;  5JCO A;  3K14 A;  3RYH B;  1Z5W A;  1XHO A;  3U0O A;  2HRY A;  2ZOD A;  3SIU A;  4ZK7 A;  1YHQ F;  1NMU B;  3KJK A;  4BT2 A;  3JAT B;  4ZHQ A;  1QAH A;  1R1M A;  2IG8 A;  4E6E A;  1XRG A;  4WBN B;  2H8E A;  3GTZ A;  1W55 A;  3ZP4 A;  1K8A H;  3LYB A;  3RE3 A;  3CC7 F;  5HY1 A;  2LBW A;  2VAP A;  5EIB D;  3RYI B;  5GIP C;  5EZY A;  3S0W A;  3N2K B;  2ZOV A;  4LNU B;  2W8B C;  3VO8 A;  3LDT A;  4YJ2 B;  5HY4 A;  2HRU A;  5JH7 B;  3G4S F;  3C9R A;  1SA0 B;  2PMP A;  2AIF A;  3CCQ F;  1VQ7 F;  2BTU A;  2Q1X A;  4ZHW A;  2Z1T A;  4I50 B;  3JAR B;  5EIB C;  2CZW A;  2P6Y A;  3C9S A;  3CMA F;  3I3F A;  5LA6 B;  3J80 M;  3VCZ A;  2FGY A;  1VQ4 F;  2HP0 B;  4DRX B;  3FBA A;  4X3M A;  2ALE A;  3S02 A;  4I55 A;  4B5C A;  1QU9 A;  1NQ3 A;  5EO3 A;  4EB6 A;  3IKF A;  4X3L A;  5CB4 A;  3WPX A;  3CYP B;  3F0E A;  3JAL B;  2LBX A;  1FNJ A;  5CA1 B;  3RYC A;  3RYC B;  3VYU C;  1OFU A;  3M4S A;  4I4T B;  3QHD A;  3VYS C;  3JAS B;  1VH8 A;  3RYH A;  4O4L B;  3QUW A;  2B33 A;  3M84 A;  2HQS C;  2CSL A;  4EB6 B;  3N4Y A;  4ZHY B;  3HKE A;  3WPW A;  5J2T A;  5MN4 A;  2HP0 A;  4DRX A;  1NJI H;  5KMG A;  1QD9 A;  1COM A;  4I50 A;  3NVK E;  2QTP A;  3RYF A;  3LWP C;  3CCL F;  1YJW F;  5ITZ A;  4U39 A;  5MN6 A;  3HKC B;  2CHT A;  3C9T A;  1FFX A;  3E22 A;  3JVH A;  3F0F A;  3N4Z A;  3NK6 A;  2DYY A;  3CME F;  3JAL A;  2KGW A;  4EI8 A;  1W59 A;  5LOV A;  1GO1 A;  2V9Y A;  3V3T A;  4YJ2 A;  3K0T A;  3CXC F;  4TUY A;  1UFY A;  2AIZ P;  3JAM M;  1DBF A;  1M90 H;  2BO1 A;  1IV4 A;  3RYI A;  5LP6 A;  1KQS F;  5JQG B;  2OTJ F;  5C8Y A;  1YI2 F;  2AMT A;  3MQW A;  2UYJ A;  1VQ9 F;  3IEW A;  3D00 A;  5JCO C;  1KNJ A;  4X1K B;  4BT5 A;  5IJ9 B;  4ZOL A;  1W5A A;  2JNB A;  5LXT B;  1TUB B;  1RA4 A;  2CVL A;  5JH7 A;  4C4W C;  1U40 A;  1RQ7 A;  3L7Q A;  1VQM F;  1IV2 A;  1KD1 H;  1VHA A;  1OAP A;  3N2K A;  2RHH A;  2VAW A;  2ZVZ A;  4YJ3 A;  1VQ8 F;  2LBT A;  3VTI C;  3MDO A;  4O4L A;  3P4E A;  4PWT A;  1KNK A;  5IT9 M;  3JAS A;  4U3J A;  2N48 A;  3HWU A;  1RLU A;  4G4W A;  4I4T A;  1N8R H;  3FFM A;  4C8I A;  2IAF A;  4TV9 A;  3CCV F;  2KTU A;  3VOA A;  3FD5 A;  3S06 A;  3WGJ A;  4R40 B;  2UYN A;  1T0A A;  2UYP A;  4ZI7 B;  5HXZ A;  3MCA B;  3KIZ A;  4XCQ A;  3PAF A;  2VGM A;  2R6R 1;  4NWO B;  4X1Y A;  4TZZ A;  4EI7 A;  1FNK A;  5J2U A;  1U3L A;  3CG6 A;  3F0D A;  1W3E X;  4O4J B;  4O2B B;  5IJ0 A;  3SIV A;  2OHW A;  2Q1Y A;  1VQL F;  2KG4 A;  1SA0 A;  3MBM A;  3IKE A;  2RHO A;  5G4U C;  5HY2 A;  3CCM F;  2Z01 A;  5EB1 B;  3GHZ A;  5CA0 B;  1ODE A;  4G4V A;  4BW0 B;  5C8Y B;  4B62 A;  1JD1 A;  5LP6 B;  3HKD A;  5MN5 A;  1W5B A;  1K73 H;  4LCK A;  1GO0 A;  1VQO F;  3C9U A;  3QTY A;  2HS4 A;  2LCA A;  5B8F A;  3ZP7 A;  5HY0 A;  1J7H A;  3HKB A;  2HX0 A;  3TD5 A;  1KC8 H;  2UYN B;  1Q81 H;  3S03 A;  1W42 A;  3F0G A;  1DT9 A;  4ERH A;  2HS0 A;  3LWO C;  3G6E F;  5ITZ B;  1TVK B;  4M8I A;  4C8G A;  1W40 A;  3R0P A;  3WGM A;  1FSZ A;  1XV2 A;  4FFB B;  4U3J B;  3DDN A;  1GZ0 A;  2YYE A;  1Q7Y H;  3JAW B;  1UI9 A;  5KMG B;  1K9M H;  1W2B F;  4ZHV A;  1JJ2 F;  3OW2 F;  3HKE B;  4O4I B;  3VYT C;  5J2T B;  3VI6 A;  2UYK A;  3V4D A;  4HNA A;  3KE1 A;  3J81 M;  1RLG A;  2OTL F;  3AGK A;  3KHN A;  4BVS A;  5EWR A;  4ZI7 A;  5EAZ A;  4TV9 B;  2PHN A;  4X1K A;  1IV3 A;  4BVQ A;  3CD6 F;  1W57 A;  4C8E A;  4IIJ A;  3CCR F;  5CA1 A;  3KJJ A;  3WGN A;  4BVR A;  5AVM A;  4TV8 A;  2QI2 A;  3HKB B;  5JQG A;  3HJW C;  4BVT A;  5IYZ B;  3IR9 A;  3CPW F;  4I55 B;  1GX1 A;  2H8C A;  3CCS F;  5DCV A;  1PXW A;  1H48 A;  2CHS A;  4O4H B;  4X1I A;  1TUB A;  1CN7 A;  2ZVY A; 
#chains in the Genus database with same CATH homology
 4NQ3 A;  3G4S F;  1N8R H;  3FFM A;  3OBY A;  1W41 A;  2AIF A;  1X7P A;  3CCQ F;  2QA4 F;  3CCV F;  2KTU A;  1YIT F;  1VQ7 F;  2GLZ A;  3E20 B;  3V7Q A;  3WXM B;  1T0K B;  1X52 A;  2CZW A;  1VQ5 F;  3LWQ C;  3J80 M;  5HXZ A;  3MCA B;  3CMA F;  2FGY A;  1VQ4 F;  1VQK F;  2KTV A;  2VGN A;  4XCQ A;  4X3M A;  2ALE A;  2VGM A;  3PAF A;  5GAN K;  2F9Z C;  1H7M A;  4TZZ A;  4EI7 A;  3G71 F;  3CC4 F;  5EO3 A;  5HWE A;  3CCU F;  3CG6 A;  4X3L A;  5FJ4 C;  1W3E X;  3RA6 A;  3J7A R;  1X7O A;  3SIV A;  2LBX A;  2OHW A;  1VQL F;  2KG4 A;  1XBI A;  5G4U C;  5HY2 A;  3CCM F;  1E7K A;  3LWV C;  5A2Q M;  4BW0 B;  1YJN F;  2QEX F;  5FLX M;  3CPQ A;  1Q82 H;  3LFO A;  3N4Y A;  4EI9 A;  1K73 H;  4LCK A;  1GO0 A;  1VQO F;  1YJ9 F;  1ZWZ A;  1NJI H;  3NVI B;  4NUT A;  3JCM M;  5HY0 A;  3HAX D;  1KC8 H;  3NVK E;  1S72 F;  1Q81 H;  1W42 A;  1SDS A;  1DT9 A;  5GIO C;  3LWP C;  3CCL F;  1YJW F;  3LWO C;  3E1Y A;  3G6E F;  3OBW A;  1VQN F;  1QVF F;  3GYQ A;  3N4Z A;  3NK6 A;  5GAP K;  1W40 A;  3CME F;  4EI8 A;  3ON1 A;  1IPA A;  1GZ0 A;  1GO1 A;  3CCJ F;  1Q7Y H;  3V3T A;  1YIJ F;  2I6D A;  3CXC F;  1VQ6 F;  4BY9 D;  1VQP F;  2WAL A;  1W2B F;  1K9M H;  1QVG F;  1JJ2 F;  3OW2 F;  3JAM M;  3CC2 F;  3VI6 A;  3CCE F;  1M90 H;  2OZB A;  3O85 A;  2BO1 A;  3I56 F;  3J81 M;  1RLG A;  2OTL F;  1KQS F;  3AGK A;  1Q86 H;  2FC3 A;  2OTJ F;  4BVS A;  5EWR A;  1YI2 F;  3LWR C;  3SIU A;  2HVY D;  1VQ9 F;  1YHQ F;  1NMU B;  4BVQ A;  5GIN C;  3CD6 F;  3D00 A;  3CCR F;  5HXU A;  2JNB A;  3NK7 A;  1K8A H;  1RA4 A;  4BVR A;  3PLA C;  4C4W C;  2QI2 A;  3CC7 F;  5HY1 A;  3HJW C;  2LBW A;  5GIP C;  4BVT A;  1VQM F;  3I55 F;  3IR9 A;  1KD1 H;  3CPW F;  3RA5 A;  5G4V C;  1CK2 A;  1VQ8 F;  3CCS F;  3VMF B;  3V7E A;  5DCV A;  3NMU C;  1PXW A;  5HY4 A;  5IT9 M;  1CN7 A;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...