3HJWC

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/rna
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3hjwC00
2OHWA 3CCEF 4C4WC 3CCVF 2VGMA 5GIOC 1YJNF 3CCMF 5EWRA 1KQSF 3SIVA 2LBXA 5G4UC 1Q82H 1VQNF 1GO1A 2AIFA 1W3EX 1M90H 1VQ8F 2BO1A 3SIUA 2OZBA 3CMEF 3CCUF 1JJ2F 1RA4A 3CG6A 1VQ5F 3I56F 1X52A 1VQKF 3HJWC 1X7PA 4LCKA 3IR9A 2FC3A 1YHQF 1VQ4F 1VQ6F 1N8RH 1GZ0A 4BW0B 3RA6A 1NJIH 3GYQA 3CC7F 3CMAF 3CCRF 3HAXD 1Q81H 3OBWA 3V7QA 1GO0A 3CPQA 3CC4F 5GAPK 2LBWA 1M1KH 1XBIA 3LWVC 1CN7A 1W2BF 4X3LA 2QI2A 3CCLF 1RLGA 2HVYD 3VMFB 2QEXF 2VGNA 2WALA 3OW2F 3V7EA 1YJ9F 5GIPC 3FFMA 3RA5A 3I55F 3CCSF 5GANK 2KTVA 1W40A 1T0KB 5IT9M 3G4SF 2QA4F 3WXMB 1VQMF 3J81M 1DT9A 1CK2A 5FLXM 3CCJF 2KTUA 3JAMM 4BY9D 1K9MH 1IPAA 3MCAB 1X7OA 2ALEA 3J7AR 3ON1A 1ZWZA 1VQOF 3NVKE 1K73H 5DCVA 3JCMM 1YJWF 1H7MA 5FJ4C 1YI2F 1W42A 5EO3A 1VQ9F 2OTLF 3LFOA 4X3MA 1KC8H 1E7KA 3G6EF 3E20B 3CD6F 3CC2F 1PXWA 3VI6A 4TZZA 3NMUC 1Q7YH 3E1YA 3G71F 2I6DA 1Q86H 2KG4A 1W41A 5GINC 1SDSA 1QVFF 3LWRC 1NMUB 3N4YA 5A2QM 3LWPC 1YIJF 1VQ7F 3CCQF 1VQLF 1VQPF 3CPWF 3PLAC 3PAFA 3LWOC 1YITF 3NK7A 3NK6A 3J80M 2CZWA 1QVGF 3N4ZA 3CXCF 4NUTA 3OBYA 3LWQC 3O85A 1K8AH 2OTJF 1S72F 3AGKA 3NVIB 2JNBA 1KD1H 5G4VC
chains in the Genus database with same CATH superfamily
2OHWA 4C4WC 1W59A 4I55A 1Z5WA 3HWUA 3RYIA 3FD6A 4NWOB 4U3JB 1KQSF 2LBXA 3Q8HA 4F6RB 1U40A 5JQGA 3SIUA 2OZBA 3VOAA 3K12A 3CMEF 5KX5A 3S0YA 5FNVB 1SA0B 3M4SA 2RB9A 4ZOLA 3WJRA 1RA4A 3JAWB 2DT4A 4G88A 2ZVYA 4TUYB 1RLUA 2LCAA 5J2TB 2DYYA 5HWEA 1N8RH 5LA6A 3KE1A 4BVQA 3P10A 2H6LA 3E22A 2OTMA 3R0PA 4B5CA 2ZOVA 4TV9B 4C8IA 5KMGB 5C8YA 4I50B 2ZVZA 1Q81H 1OFUA 1GO0A 3CC4F 3LWVC 1CN7A 4BT4A 1RLGA 4B46A 2HVYD 5EAZA 2FGYA 3F6MA 3OW2F 4EB6B 3I55F 2G9IA 2HX0A 3KJJA 2AMTA 5JVDB 3JARB 1W5BA 3U0OA 4HNAB 4BT7A 3S06A 4O2BA 2BTQB 5FLXM 5LOVA 4M8IA 1VK3A 3JAMM 2AIZP 1ODEA 5IYZA 4X20B 4I55B 3RYIB 1K73H 1YJWF 5EB0A 4EI7A 2V9YA 4ZHYB 1QAHA 3LFOA 3IKFA 5JQGB 3HKCA 5IJ9A 1W57A 3S0WA 5KX5B 3VI6A 4XCQA 4DXDA 3VTIC 3MCQA 3G71F 3D54A 2I6DA 4O2AA 1W5AA 2KG4A 5JH7A 2NMUA 5GINC 1TUBA 2HP0B 1NMUB 3N4YA 2UYJA 3VIUA 3CCQF 2YXZA 1VQPF 4DRXB 5LA6B 1RQ2A 1DBFA 1KNJA 3K14A 3E22B 2RHHA 2CZWA 3NK6A 5HP7A 3N4ZA 1QVGF 5C8YB 2HRYA 4G4YA 1QD9A 2BTUA 4ZHQA 4C82A 2OTJF 1UI9A 2VAMA 3CYQA 2MQEA 3VYTC 2Z1UA 4O4IA 4RQOA 3JASB 3CCEF 3FD5A 4B45A 3HKDA 4ZHVA 3CCVF 5IJ0B 2UYNA 5EWRA 1TVKA 5LOVB 1Z5VA 4IHJA 1VQNF 5IYZB 5HY2A 1W3EX 1M90H 1VQ8F 2BO1A 1IV4A 2Z1FA 3TD3A 3F0FA 1VH8A 3K2XA 1YQNA 5LYJA 4BT6A 3VO8A 2CWJA 3I7TA 5HY0A 4I4TA 3WGMA 5MN4A 3HJWC 1X7PA 1H47A 3IR9A 5ITZA 3WGKA 3DC2A 1VQ6F 3HKCB 5IJ9B 1NJIH 4BVRA 2VXYA 3I3FA 3UT5A 3CC7F 2Z01A 5EB1B 3CMAF 3CCRF 3S03A 4IIJA 4O2AB 5JH7B 2H8CA 3HAXD 1TUBB 3OBWA 5B8FA 3CPQA 1IV3A 3C8LA 2HS4A 1M1KH 1XBIA 3S0HA 1W2BF 4X3LA 3V7EA 1SZQA 5CA1A 5GIPC 3FFMA 3RA5A 1IV1A 3CCSF 5GANK 1T0KB 3DDNA 2KGWA 4X1KB 3WXMB 1VQMF 3J81M 4ZHQB 3ZO8A 4BY9D 1K9MH 1JY8A 1W55A 1IPAA 3MCAB 1X7OA 4O4HA 3F0GA 2ALEA 4O4IB 4PWTA 1QU9A 4O4LA 3IMPA 3J7AR 3ON1A 4BVSA 1W581 3HKDB 3KHNA 4LNUA 2UZHA 1H7MA 2W8BC 3ZOPA 5EO3A 4C8EA 3V3TA 1VQ9F 4IHJB 2GLZA 4X3MA 5HY1A 1KC8H 5EYPB 1COMA 3E20B 4X1IA 3HKEB 4B62A 5LYJB 4TZZA 2HQSC 1Q7YH 1PF5A 3HKBA 4ZHWA 3JVHA 3QHDA 1Q86H 5CB4A 5ITZB 4G4ZA 3LWPC 4YJ3A 1VQ7F 4WBNA 4G4WA 3CPWF 1NQ3A 2UYKA 3IKEA 3PLAC 2CHTA 3J80M 4IIJB 1VQVA 5LXTA 3JATA 2L26A 4ZI7A 1S72F 2QTPA 2JNBA 4ZOLB 3RYCA 5G4VC 5CA1B 2RHLA 1T0AA 3B6NA 2VGMA 3N2KA 5GIOC 3CCMF 1R1MA 1Q82H 2IAFA 2AIFA 4O4HB 2Q1XA 4O4LB 5LP6C 4TV8A 3RE3A 3JAKA 1IV2A 4BT2A 1JJ2F 2PHNA 4LNUB 3TD4A 3I56F 1VQKF 1FFXA 4LCKA 1JFFA 3C9RA 1YHQF 1VQ4F 5BMVA 4F6RA 3S02A 3GTZA 1GZ0A 1H48A 3BYQA 2GVIA 3HKBB 3D00A 3C9SA 3MDOA 4O2BB 3V7QA 3JALA 5CB4B 5CA0A 1JN1A 4YJ3B 2GZLA 2ZF8A 3WGLA 3F0EA 2QI2A 4WBNB 2P6YA 5AVMA 2HS0A 5J2TA 2QEXF 5MN6A 2WALA 3LDTA 2HRUA 2KTVA 2HS3A 5IT9M 4KWEA 3G4SF 3LMEA 5EIBC 2QA4F 3JATB 3RYHA 3V4DA 3CCJF 2KTUA 4ZI7B 3RYCB 3OONA 2UYPA 4ZK7A 3ERNA 4U39A 2IQQA 3WPXA 4ERHA 5DCVA 3N2KB 3JCMM 4EI8A 5HXZA 5FJ4C 1YI2F 3MBMA 2CSLA 5EZYA 2CW4A 2LBTA 2OTLF 4X20A 1GX1A 2VAPA 1U3PA 2EWCA 3WGJA 3L7QA 3CD6F 3VOBA 4TV8B 1PXWA 2PMPA 3JAKB 3F0DA 3NMUC 2B33A 3KIZA 5JCOC 4BVTA 3N2GA 1FFXB 1UFYA 1JFFB 3QUWA 3LWRC 5A2QM 3D01A 5BMVB 1YIJF 1VQLF 1W5EA 2CHSA 3QTYA 4G4VA 3PAFA 3LWOC 3NK7A 4FFBA 2UYNB 2Z1TA 1TVKB 3OBYA 3ELCA 3LYBA 3LWQC 1X25A 4G4XA 3JALB 3ZP4A 5CA0B 1VHAA 5MN5A 2Q1YA 1ONIA 2ZODA 4NQ3A 2HP0A 3VYUC 2BTOA 1KD1H 3WJQA 4DRXA 5J2UA 1J7HA 1YGYA 1FNKA 2CVLA 4I4TB 1YJNF 5GONA 2R751 3C9UA 3RYHB 3SIVA 5G4UC 2K1SA 1Q8RA 2VAWA 1GO1A 2I6RA 2H8EA 4YJ2A 4X1YA 3UT5B 3WGNA 3CCUF 3JASA 3CG6A 1VQ5F 3CB2A 3ZP7A 5LP6A 1X52A 4R40B 5EZYB 3M1XA 5IJ0A 3IEWA 2FC3A 3KJKA 3T80A 4O4JA 3P4EA 4BW0B 3RA6A 3RYFA 3K0TA 3GYQA 5HP8A 2Z1EA 3P0ZA 3N2GB 3MQWA 2IG8A 1W5FA 5GAPK 2LBWA 1XRGA 3FBAA 3FPIA 3CCLF 3WPWA 3VMFB 2VGNA 1FNJA 4FFBB 1YJ9F 1W40A 3EORA 1JD1A 2R6R1 4U3JA 3VYSC 1DT9A 1CK2A 4X1IB 3WJPA 2RHOA 2HP3A 1FSZA 4C8GA 5J2UB 5FNVA 1RQ7A 1SA0A 1ZWZA 3C9TA 1VQOF 3NVKE 2N48A 3JAWA 5GONB 1W42A 2YYEA 4E6EA 4BT3A 4TUYA 4X1KA 2ZAUA 1E7KA 4YJ2B 3G6EF 5EIBD 4X1YB 3TD5A 3CC2F 4EI9A 5LXTB 3IEQA 3E1YA 3VCZA 4TV9A 4BT5A 5KMGA 5LP6B 4I50A 1U3LA 1W41A 1U43A 1SDSA 3HTNA 1QVFF 1XV2A 4O4JB 1CLIA 3M84A 5JCOA 3RYFB 5EYPA 1KNKA 1YITF 3CYPB 4EB6A 3HKEA 3CXCF 4C81A 4NUTA 5HY4A 5JVDA 2RHJA 3JARA 4HNAA 1XHOA 2F9ZC 3O85A 3ESJA 3AGKA 4RHAA 3GHZA 1OAPA 3NVIB 1K8AH 5HXUA
chains in the Genus database with same CATH topology
2OHWA 3CCEF 4C4WC 3CCVF 2VGMA 5GIOC 1YJNF 3CCMF 5EWRA 1KQSF 3SIVA 2LBXA 5G4UC 1Q82H 1VQNF 1GO1A 2AIFA 5HY2A 1W3EX 1M90H 1VQ8F 2BO1A 3SIUA 2OZBA 3CMEF 3CCUF 1JJ2F 1RA4A 3CG6A 1VQ5F 3I56F 1X52A 5HY0A 1VQKF 3HJWC 1X7PA 4LCKA 3IR9A 2FC3A 1YHQF 1VQ4F 1VQ6F 5HWEA 1N8RH 1GZ0A 4BW0B 3RA6A 1NJIH 4BVQA 4BVRA 3GYQA 3CC7F 3CMAF 3CCRF 3D00A 3HAXD 1Q81H 3OBWA 3V7QA 1GO0A 3CPQA 3CC4F 5GAPK 2LBWA 1M1KH 1XBIA 3LWVC 1CN7A 1W2BF 4X3LA 2QI2A 3CCLF 1RLGA 2HVYD 2FGYA 3VMFB 2QEXF 2VGNA 2WALA 3OW2F 3V7EA 1YJ9F 5GIPC 3FFMA 3RA5A 3I55F 3CCSF 5GANK 2KTVA 1W40A 1T0KB 5IT9M 3G4SF 2QA4F 3WXMB 1VQMF 3J81M 1DT9A 1CK2A 5FLXM 3CCJF 2KTUA 3JAMM 4BY9D 1K9MH 1IPAA 3MCAB 1X7OA 2ALEA 3J7AR 3ON1A 4BVSA 1ZWZA 1VQOF 3NVKE 1K73H 5DCVA 3JCMM 4EI8A 1YJWF 5HXZA 1H7MA 5FJ4C 1YI2F 1W42A 5EO3A 4EI7A 3V3TA 1VQ9F 2OTLF 2GLZA 3LFOA 4X3MA 5HY1A 1KC8H 1E7KA 3G6EF 3E20B 3CD6F 3CC2F 1PXWA 3VI6A 4EI9A 4XCQA 4TZZA 3NMUC 1Q7YH 3E1YA 3G71F 2I6DA 1Q86H 2KG4A 4BVTA 1W41A 5GINC 1SDSA 1QVFF 3LWRC 1NMUB 3N4YA 5A2QM 3LWPC 1YIJF 1VQ7F 3CCQF 1VQLF 1VQPF 3CPWF 3PLAC 3PAFA 3LWOC 1YITF 3NK7A 3NK6A 3J80M 2CZWA 1QVGF 3N4ZA 3CXCF 4NUTA 3OBYA 5HY4A 3LWQC 4NQ3A 2F9ZC 3O85A 1K8AH 2OTJF 1S72F 3AGKA 3NVIB 2JNBA 1KD1H 5G4VC 5HXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  3CCE F;  4C4W C;  3CCV F;  2VGM A;  5GIO C;  1YJN F;  3CCM F;  5EWR A;  1KQS F;  3SIV A;  2LBX A;  5G4U C;  1Q82 H;  1VQN F;  1GO1 A;  2AIF A;  1W3E X;  1M90 H;  1VQ8 F;  2BO1 A;  3SIU A;  2OZB A;  3CME F;  3CCU F;  1JJ2 F;  1RA4 A;  3CG6 A;  1VQ5 F;  3I56 F;  1X52 A;  1VQK F;  3HJW C;  1X7P A;  4LCK A;  3IR9 A;  2FC3 A;  1YHQ F;  1VQ4 F;  1VQ6 F;  1N8R H;  1GZ0 A;  4BW0 B;  3RA6 A;  1NJI H;  3GYQ A;  3CC7 F;  3CMA F;  3CCR F;  3HAX D;  1Q81 H;  3OBW A;  3V7Q A;  1GO0 A;  3CPQ A;  3CC4 F;  5GAP K;  2LBW A;  1M1K H;  1XBI A;  3LWV C;  1CN7 A;  1W2B F;  4X3L A;  2QI2 A;  3CCL F;  1RLG A;  2HVY D;  3VMF B;  2QEX F;  2VGN A;  2WAL A;  3OW2 F;  3V7E A;  1YJ9 F;  5GIP C;  3FFM A;  3RA5 A;  3I55 F;  3CCS F;  5GAN K;  2KTV A;  1W40 A;  1T0K B;  5IT9 M;  3G4S F;  2QA4 F;  3WXM B;  1VQM F;  3J81 M;  1DT9 A;  1CK2 A;  5FLX M;  3CCJ F;  2KTU A;  3JAM M;  4BY9 D;  1K9M H;  1IPA A;  3MCA B;  1X7O A;  2ALE A;  3J7A R;  3ON1 A;  1ZWZ A;  1VQO F;  3NVK E;  1K73 H;  5DCV A;  3JCM M;  1YJW F;  1H7M A;  5FJ4 C;  1YI2 F;  1W42 A;  5EO3 A;  1VQ9 F;  2OTL F;  3LFO A;  4X3M A;  1KC8 H;  1E7K A;  3G6E F;  3E20 B;  3CD6 F;  3CC2 F;  1PXW A;  3VI6 A;  4TZZ A;  3NMU C;  1Q7Y H;  3E1Y A;  3G71 F;  2I6D A;  1Q86 H;  2KG4 A;  1W41 A;  5GIN C;  1SDS A;  1QVF F;  3LWR C;  1NMU B;  3N4Y A;  5A2Q M;  3LWP C;  1YIJ F;  1VQ7 F;  3CCQ F;  1VQL F;  1VQP F;  3CPW F;  3PLA C;  3PAF A;  3LWO C;  1YIT F;  3NK7 A;  3NK6 A;  3J80 M;  2CZW A;  1QVG F;  3N4Z A;  3CXC F;  4NUT A;  3OBY A;  3LWQ C;  3O85 A;  1K8A H;  2OTJ F;  1S72 F;  3AGK A;  3NVI B;  2JNB A;  1KD1 H;  5G4V C; 
#chains in the Genus database with same CATH topology
 2OHW A;  4C4W C;  1W59 A;  4I55 A;  1Z5W A;  3HWU A;  3RYI A;  3FD6 A;  4NWO B;  4U3J B;  1KQS F;  2LBX A;  3Q8H A;  4F6R B;  1U40 A;  5JQG A;  3SIU A;  2OZB A;  3VOA A;  3K12 A;  3CME F;  5KX5 A;  3S0Y A;  5FNV B;  1SA0 B;  3M4S A;  2RB9 A;  4ZOL A;  3WJR A;  1RA4 A;  3JAW B;  2DT4 A;  4G88 A;  2ZVY A;  4TUY B;  1RLU A;  2LCA A;  5J2T B;  2DYY A;  5HWE A;  1N8R H;  5LA6 A;  3KE1 A;  4BVQ A;  3P10 A;  2H6L A;  3E22 A;  2OTM A;  3R0P A;  4B5C A;  2ZOV A;  4TV9 B;  4C8I A;  5KMG B;  5C8Y A;  4I50 B;  2ZVZ A;  1Q81 H;  1OFU A;  1GO0 A;  3CC4 F;  3LWV C;  1CN7 A;  4BT4 A;  1RLG A;  4B46 A;  2HVY D;  5EAZ A;  2FGY A;  3F6M A;  3OW2 F;  4EB6 B;  3I55 F;  2G9I A;  2HX0 A;  3KJJ A;  2AMT A;  5JVD B;  3JAR B;  1W5B A;  3U0O A;  4HNA B;  4BT7 A;  3S06 A;  4O2B A;  2BTQ B;  5FLX M;  5LOV A;  4M8I A;  1VK3 A;  3JAM M;  2AIZ P;  1ODE A;  5IYZ A;  4X20 B;  4I55 B;  3RYI B;  1K73 H;  1YJW F;  5EB0 A;  4EI7 A;  2V9Y A;  4ZHY B;  1QAH A;  3LFO A;  3IKF A;  5JQG B;  3HKC A;  5IJ9 A;  1W57 A;  3S0W A;  5KX5 B;  3VI6 A;  4XCQ A;  4DXD A;  3VTI C;  3MCQ A;  3G71 F;  3D54 A;  2I6D A;  4O2A A;  1W5A A;  2KG4 A;  5JH7 A;  2NMU A;  5GIN C;  1TUB A;  2HP0 B;  1NMU B;  3N4Y A;  2UYJ A;  3VIU A;  3CCQ F;  2YXZ A;  1VQP F;  4DRX B;  5LA6 B;  1RQ2 A;  1DBF A;  1KNJ A;  3K14 A;  3E22 B;  2RHH A;  2CZW A;  3NK6 A;  5HP7 A;  3N4Z A;  1QVG F;  5C8Y B;  2HRY A;  4G4Y A;  1QD9 A;  2BTU A;  4ZHQ A;  4C82 A;  2OTJ F;  1UI9 A;  2VAM A;  3CYQ A;  2MQE A;  3VYT C;  2Z1U A;  4O4I A;  4RQO A;  3JAS B;  3CCE F;  3FD5 A;  4B45 A;  3HKD A;  4ZHV A;  3CCV F;  5IJ0 B;  2UYN A;  5EWR A;  1TVK A;  5LOV B;  1Z5V A;  4IHJ A;  1VQN F;  5IYZ B;  5HY2 A;  1W3E X;  1M90 H;  1VQ8 F;  2BO1 A;  1IV4 A;  2Z1F A;  3TD3 A;  3F0F A;  1VH8 A;  3K2X A;  1YQN A;  5LYJ A;  4BT6 A;  3VO8 A;  2CWJ A;  3I7T A;  5HY0 A;  4I4T A;  3WGM A;  5MN4 A;  3HJW C;  1X7P A;  1H47 A;  3IR9 A;  5ITZ A;  3WGK A;  3DC2 A;  1VQ6 F;  3HKC B;  5IJ9 B;  1NJI H;  4BVR A;  2VXY A;  3I3F A;  3UT5 A;  3CC7 F;  2Z01 A;  5EB1 B;  3CMA F;  3CCR F;  3S03 A;  4IIJ A;  4O2A B;  5JH7 B;  2H8C A;  3HAX D;  1TUB B;  3OBW A;  5B8F A;  3CPQ A;  1IV3 A;  3C8L A;  2HS4 A;  1M1K H;  1XBI A;  3S0H A;  1W2B F;  4X3L A;  3V7E A;  1SZQ A;  5CA1 A;  5GIP C;  3FFM A;  3RA5 A;  1IV1 A;  3CCS F;  5GAN K;  1T0K B;  3DDN A;  2KGW A;  4X1K B;  3WXM B;  1VQM F;  3J81 M;  4ZHQ B;  3ZO8 A;  4BY9 D;  1K9M H;  1JY8 A;  1W55 A;  1IPA A;  3MCA B;  1X7O A;  4O4H A;  3F0G A;  2ALE A;  4O4I B;  4PWT A;  1QU9 A;  4O4L A;  3IMP A;  3J7A R;  3ON1 A;  4BVS A;  1W58 1;  3HKD B;  3KHN A;  4LNU A;  2UZH A;  1H7M A;  2W8B C;  3ZOP A;  5EO3 A;  4C8E A;  3V3T A;  1VQ9 F;  4IHJ B;  2GLZ A;  4X3M A;  5HY1 A;  1KC8 H;  5EYP B;  1COM A;  3E20 B;  4X1I A;  3HKE B;  4B62 A;  5LYJ B;  4TZZ A;  2HQS C;  1Q7Y H;  1PF5 A;  3HKB A;  4ZHW A;  3JVH A;  3QHD A;  1Q86 H;  5CB4 A;  5ITZ B;  4G4Z A;  3LWP C;  4YJ3 A;  1VQ7 F;  4WBN A;  4G4W A;  3CPW F;  1NQ3 A;  2UYK A;  3IKE A;  3PLA C;  2CHT A;  3J80 M;  4IIJ B;  1VQV A;  5LXT A;  3JAT A;  2L26 A;  4ZI7 A;  1S72 F;  2QTP A;  2JNB A;  4ZOL B;  3RYC A;  5G4V C;  5CA1 B;  2RHL A;  1T0A A;  3B6N A;  2VGM A;  3N2K A;  5GIO C;  3CCM F;  1R1M A;  1Q82 H;  2IAF A;  2AIF A;  4O4H B;  2Q1X A;  4O4L B;  5LP6 C;  4TV8 A;  3RE3 A;  3JAK A;  1IV2 A;  4BT2 A;  1JJ2 F;  2PHN A;  4LNU B;  3TD4 A;  3I56 F;  1VQK F;  1FFX A;  4LCK A;  1JFF A;  3C9R A;  1YHQ F;  1VQ4 F;  5BMV A;  4F6R A;  3S02 A;  3GTZ A;  1GZ0 A;  1H48 A;  3BYQ A;  2GVI A;  3HKB B;  3D00 A;  3C9S A;  3MDO A;  4O2B B;  3V7Q A;  3JAL A;  5CB4 B;  5CA0 A;  1JN1 A;  4YJ3 B;  2GZL A;  2ZF8 A;  3WGL A;  3F0E A;  2QI2 A;  4WBN B;  2P6Y A;  5AVM A;  2HS0 A;  5J2T A;  2QEX F;  5MN6 A;  2WAL A;  3LDT A;  2HRU A;  2KTV A;  2HS3 A;  5IT9 M;  4KWE A;  3G4S F;  3LME A;  5EIB C;  2QA4 F;  3JAT B;  3RYH A;  3V4D A;  3CCJ F;  2KTU A;  4ZI7 B;  3RYC B;  3OON A;  2UYP A;  4ZK7 A;  3ERN A;  4U39 A;  2IQQ A;  3WPX A;  4ERH A;  5DCV A;  3N2K B;  3JCM M;  4EI8 A;  5HXZ A;  5FJ4 C;  1YI2 F;  3MBM A;  2CSL A;  5EZY A;  2CW4 A;  2LBT A;  2OTL F;  4X20 A;  1GX1 A;  2VAP A;  1U3P A;  2EWC A;  3WGJ A;  3L7Q A;  3CD6 F;  3VOB A;  4TV8 B;  1PXW A;  2PMP A;  3JAK B;  3F0D A;  3NMU C;  2B33 A;  3KIZ A;  5JCO C;  4BVT A;  3N2G A;  1FFX B;  1UFY A;  1JFF B;  3QUW A;  3LWR C;  5A2Q M;  3D01 A;  5BMV B;  1YIJ F;  1VQL F;  1W5E A;  2CHS A;  3QTY A;  4G4V A;  3PAF A;  3LWO C;  3NK7 A;  4FFB A;  2UYN B;  2Z1T A;  1TVK B;  3OBY A;  3ELC A;  3LYB A;  3LWQ C;  1X25 A;  4G4X A;  3JAL B;  3ZP4 A;  5CA0 B;  1VHA A;  5MN5 A;  2Q1Y A;  1ONI A;  2ZOD A;  4NQ3 A;  2HP0 A;  3VYU C;  2BTO A;  1KD1 H;  3WJQ A;  4DRX A;  5J2U A;  1J7H A;  1YGY A;  1FNK A;  2CVL A;  4I4T B;  1YJN F;  5GON A;  2R75 1;  3C9U A;  3RYH B;  3SIV A;  5G4U C;  2K1S A;  1Q8R A;  2VAW A;  1GO1 A;  2I6R A;  2H8E A;  4YJ2 A;  4X1Y A;  3UT5 B;  3WGN A;  3CCU F;  3JAS A;  3CG6 A;  1VQ5 F;  3CB2 A;  3ZP7 A;  5LP6 A;  1X52 A;  4R40 B;  5EZY B;  3M1X A;  5IJ0 A;  3IEW A;  2FC3 A;  3KJK A;  3T80 A;  4O4J A;  3P4E A;  4BW0 B;  3RA6 A;  3RYF A;  3K0T A;  3GYQ A;  5HP8 A;  2Z1E A;  3P0Z A;  3N2G B;  3MQW A;  2IG8 A;  1W5F A;  5GAP K;  2LBW A;  1XRG A;  3FBA A;  3FPI A;  3CCL F;  3WPW A;  3VMF B;  2VGN A;  1FNJ A;  4FFB B;  1YJ9 F;  1W40 A;  3EOR A;  1JD1 A;  2R6R 1;  4U3J A;  3VYS C;  1DT9 A;  1CK2 A;  4X1I B;  3WJP A;  2RHO A;  2HP3 A;  1FSZ A;  4C8G A;  5J2U B;  5FNV A;  1RQ7 A;  1SA0 A;  1ZWZ A;  3C9T A;  1VQO F;  3NVK E;  2N48 A;  3JAW A;  5GON B;  1W42 A;  2YYE A;  4E6E A;  4BT3 A;  4TUY A;  4X1K A;  2ZAU A;  1E7K A;  4YJ2 B;  3G6E F;  5EIB D;  4X1Y B;  3TD5 A;  3CC2 F;  4EI9 A;  5LXT B;  3IEQ A;  3E1Y A;  3VCZ A;  4TV9 A;  4BT5 A;  5KMG A;  5LP6 B;  4I50 A;  1U3L A;  1W41 A;  1U43 A;  1SDS A;  3HTN A;  1QVF F;  1XV2 A;  4O4J B;  1CLI A;  3M84 A;  5JCO A;  3RYF B;  5EYP A;  1KNK A;  1YIT F;  3CYP B;  4EB6 A;  3HKE A;  3CXC F;  4C81 A;  4NUT A;  5HY4 A;  5JVD A;  2RHJ A;  3JAR A;  4HNA A;  1XHO A;  2F9Z C;  3O85 A;  3ESJ A;  3AGK A;  4RHA A;  3GHZ A;  1OAP A;  3NVI B;  1K8A H;  5HXU A; 
#chains in the Genus database with same CATH homology
 2OHW A;  3CCE F;  4C4W C;  3CCV F;  2VGM A;  5GIO C;  1YJN F;  3CCM F;  5EWR A;  1KQS F;  3SIV A;  2LBX A;  5G4U C;  1Q82 H;  1VQN F;  1GO1 A;  2AIF A;  5HY2 A;  1W3E X;  1M90 H;  1VQ8 F;  2BO1 A;  3SIU A;  2OZB A;  3CME F;  3CCU F;  1JJ2 F;  1RA4 A;  3CG6 A;  1VQ5 F;  3I56 F;  1X52 A;  5HY0 A;  1VQK F;  3HJW C;  1X7P A;  4LCK A;  3IR9 A;  2FC3 A;  1YHQ F;  1VQ4 F;  1VQ6 F;  5HWE A;  1N8R H;  1GZ0 A;  4BW0 B;  3RA6 A;  1NJI H;  4BVQ A;  4BVR A;  3GYQ A;  3CC7 F;  3CMA F;  3CCR F;  3D00 A;  3HAX D;  1Q81 H;  3OBW A;  3V7Q A;  1GO0 A;  3CPQ A;  3CC4 F;  5GAP K;  2LBW A;  1M1K H;  1XBI A;  3LWV C;  1CN7 A;  1W2B F;  4X3L A;  2QI2 A;  3CCL F;  1RLG A;  2HVY D;  2FGY A;  3VMF B;  2QEX F;  2VGN A;  2WAL A;  3OW2 F;  3V7E A;  1YJ9 F;  5GIP C;  3FFM A;  3RA5 A;  3I55 F;  3CCS F;  5GAN K;  2KTV A;  1W40 A;  1T0K B;  5IT9 M;  3G4S F;  2QA4 F;  3WXM B;  1VQM F;  3J81 M;  1DT9 A;  1CK2 A;  5FLX M;  3CCJ F;  2KTU A;  3JAM M;  4BY9 D;  1K9M H;  1IPA A;  3MCA B;  1X7O A;  2ALE A;  3J7A R;  3ON1 A;  4BVS A;  1ZWZ A;  1VQO F;  3NVK E;  1K73 H;  5DCV A;  3JCM M;  4EI8 A;  1YJW F;  5HXZ A;  1H7M A;  5FJ4 C;  1YI2 F;  1W42 A;  5EO3 A;  4EI7 A;  3V3T A;  1VQ9 F;  2OTL F;  2GLZ A;  3LFO A;  4X3M A;  5HY1 A;  1KC8 H;  1E7K A;  3G6E F;  3E20 B;  3CD6 F;  3CC2 F;  1PXW A;  3VI6 A;  4EI9 A;  4XCQ A;  4TZZ A;  3NMU C;  1Q7Y H;  3E1Y A;  3G71 F;  2I6D A;  1Q86 H;  2KG4 A;  4BVT A;  1W41 A;  5GIN C;  1SDS A;  1QVF F;  3LWR C;  1NMU B;  3N4Y A;  5A2Q M;  3LWP C;  1YIJ F;  1VQ7 F;  3CCQ F;  1VQL F;  1VQP F;  3CPW F;  3PLA C;  3PAF A;  3LWO C;  1YIT F;  3NK7 A;  3NK6 A;  3J80 M;  2CZW A;  1QVG F;  3N4Z A;  3CXC F;  4NUT A;  3OBY A;  5HY4 A;  3LWQ C;  4NQ3 A;  2F9Z C;  3O85 A;  1K8A H;  2OTJ F;  1S72 F;  3AGK A;  3NVI B;  2JNB A;  1KD1 H;  5G4V C;  5HXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...