3HJWC

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
120
structure length
120
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudouridine synthase Cbf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
total genus 34
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3hjwC00
1VQLF 5FJ4C 2CZWA 1S72F 3CMAF 3FFMA 2QEXF 1YHQF 1W3EX 4BY9D 1NMUB 5GIPC 3CC2F 4TZZA 1YI2F 1VQ6F 1VQ4F 1N8RH 3CCRF 5G4UC 4LCKA 1Q86H 4NUTA 2AIFA 1IPAA 1SDSA 3CPQA 3I56F 3HAXD 5EWRA 1M90H 3JCMM 2VGNA 3IR9A 1QVGF 3CCMF 4X3LA 1VQ8F 1CK2A 2HVYD 1RA4A 3V7QA 1K9MH 1YIJF 3CD6F 3RA5A 3CMEF 5FLXM 1YITF 1CN7A 3G71F 3NK6A 1VQPF 3AGKA 3E20B 3CCLF 1M1KH 3RA6A 1YJNF 3LFOA 5IT9M 2QI2A 3LWPC 1VQOF 3G6EF 5EO3A 1VQNF 1YJ9F 3N4YA 3NVIB 1T0KB 3N4ZA 5GAPK 1VQMF 3OBWA 3OW2F 2KTVA 1GO0A 3CCSF 2OTJF 2LBWA 2LBXA 3V7EA 3LWOC 3I55F 1X7PA 3MCAB 2OHWA 3LWQC 1YJWF 5GINC 3ON1A 4X3MA 1VQ5F 3NMUC 2OZBA 3OBYA 5DCVA 2QA4F 3CXCF 1E7KA 3SIUA 1PXWA 3CPWF 1W42A 2OTLF 3WXMB 1QVFF 3CCVF 1Q82H 5G4VC 3J7AR 1RLGA 2FC3A 3PLAC 5GIOC 2BO1A 5GANK 3G4SF 1VQ9F 4BW0B 1W2BF 2VGMA 1X7OA 3JAMM 3O85A 2I6DA 1W40A 3CCUF 2JNBA 4C4WC 3J80M 3VMFB 2ALEA 1Q7YH 5A2QM 3PAFA 1KQSF 2KG4A 3SIVA 1K73H 3CG6A 1VQKF 1KC8H 3CCJF 1XBIA 1GO1A 1DT9A 3GYQA 3CC4F 1W41A 2WALA 3NVKE 1GZ0A 1X52A 3LWVC 3CCQF 1Q81H 3CC7F 3HJWC 1VQ7F 1H7MA 3E1YA 1KD1H 3LWRC 2KTUA 1NJIH 3VI6A 3CCEF 1ZWZA 3J81M 1K8AH 3NK7A 1JJ2F
chains in the Genus database with same CATH superfamily
3FFMA 1UI9A 3VOBA 4BY9D 5HY4A 2H6LA 4IIJA 4BT5A 1W581 4F6RB 3HKBB 5GIPC 4O2AB 3CC2F 4TZZA 2Z1TA 3Q8HA 5BMVB 1Q8RA 3WJPA 3I56F 4O4JA 1VH8A 2PHNA 1XRGA 3C9RA 4X3LA 3KE1A 3V7QA 1YIJF 1TUBB 2G9IA 3D54A 2NMUA 3G71F 2IAFA 3MQWA 4ZOLA 3AGKA 2CHTA 5LXTB 2AIZP 2R751 1VK3A 3IEQA 1M1KH 3LFOA 3UT5A 4U3JA 5FNVB 3S06A 1OFUA 5B8FA 2BTOA 3S03A 1YJ9F 3N4ZA 5GAPK 3RYCB 4BVTA 3ZP7A 3CCSF 3V7EA 1PF5A 1QU9A 4ZHQB 3LWOC 3I55F 2L26A 1X7PA 3KJKA 2H8CA 1YJWF 4X3MA 4F6RA 1VQ5F 2HS0A 3HKBA 2OZBA 3WGKA 4O2AA 1QAHA 5DCVA 1XV2A 2QA4F 5EB1B 1U43A 5CA1B 1H48A 5BMVA 3JAKB 2Z01A 2BTQB 2DT4A 4ZHYB 1IV1A 3IKEA 2ZOVA 1W5BA 5G4VC 3CYPB 1Q82H 4B62A 2GLZA 2MQEA 1CLIA 2QTPA 5HXUA 3G4SF 2Z1UA 4XCQA 3ZO8A 1W2BF 2RHJA 1X7OA 4FFBB 3WGJA 5EB0A 1TUBA 3CCUF 4B45A 5LXTA 2VAMA 5FNVA 3S0HA 3MDOA 2IQQA 3CCJF 2HX0A 1U3LA 1W5EA 3DDNA 4R40B 1W41A 2F9ZC 4TUYB 4TV8B 3RYCA 4PWTA 3E22B 2UYNB 2ZODA 4ZHVA 5JH7B 3J81M 1K8AH 4BT2A 3NK7A 1R1MA 5GONB 1IV2A 1W55A 5JQGB 3FPIA 5CA1A 1IV3A 4I4TB 5IYZB 3FBAA 2CHSA 2RB9A 3U0OA 3FD6A 3GHZA 3L7QA 4EI9A 3S02A 1IPAA 1SDSA 1OAPA 5LP6B 5EWRA 5EYPA 1M90H 2VGNA 4FFBA 1VQVA 4ZI7B 3CCMF 1SA0B 1J7HA 5LA6B 2HVYD 5MN6A 3CD6F 4YJ2B 3RA5A 2VXYA 3ERNA 4O4LA 4E6EA 3LDTA 1ODEA 1RQ2A 4ERHA 3HKCB 3HTNA 3WPXA 2Q1YA 4TUYA 3G6EF 5CA0B 3P4EA 3C9TA 4TV8A 4C81A 3E22A 3M1XA 1FNKA 4RQOA 2UYNA 2VAWA 3LYBA 3M84A 3OBWA 3GTZA 3ESJA 3JVHA 1GO0A 5JH7A 2OTJF 2LBWA 4HNAB 3BYQA 4I55B 5GONA 3V4DA 4BT4A 3EORA 4X1YB 2OHWA 3D01A 3LWQC 5JQGA 2FGYA 3ON1A 4I4TA 5IYZA 3IKFA 3VYTC 2HS3A 5KX5B 3VO8A 3CPWF 3J7AR 3N2KA 5LP6A 2GVIA 1U3PA 5GIOC 5HY0A 4ZI7A 1YGYA 5EZYB 2PMPA 3JALB 1SA0A 1GX1A 5LA6A 2YXZA 1YQNA 4YJ2A 5JCOC 1H47A 2I6DA 4BT6A 3F0FA 2LBTA 4C4WC 3J80M 3VMFB 1Q7YH 3WPWA 3F0GA 3PAFA 3HKCA 2KG4A 3SIVA 2W8BC 1K73H 1KC8H 4BT7A 5CA0A 5HXZA 2ZVZA 3GYQA 2Z1FA 3RE3A 1X52A 3LWVC 3WGLA 3CB2A 4BT3A 3RYHB 2UYKA 3CCQF 3HJWC 4O4HB 3E1YA 1KD1H 4HNAA 4I55A 2KTUA 3IEWA 1NJIH 5EYPB 2CWJA 2RHOA 4X1YA 3WJQA 1ONIA 3WGNA 5FJ4C 5HP7A 2CZWA 1S72F 3QUWA 3CMAF 1SZQA 2QEXF 3VOAA 1YHQF 5KX5A 1W3EX 4C82A 3JAWB 4O4LB 1VQ4F 3HKEB 1N8RH 3CCRF 4LCKA 4NUTA 5J2TB 1Z5WA 5HWEA 3CPQA 5EZYA 3JALA 3LMEA 2RHLA 1QVGF 4B5CA 2EWCA 1CK2A 4C8IA 1RA4A 3MBMA 2UYPA 3HKDB 2ZF8A 3CMEF 3QHDA 2K1SA 3KIZA 2HQSC 3VCZA 3M4SA 1XHOA 1VQPF 3E20B 3CCLF 4C8GA 4X20B 5IT9M 2QI2A 3K2XA 2HRYA 1VQOF 1FFXB 5KMGB 5EO3A 2KGWA 3RYHA 3WGMA 4DRXB 4O4HA 1W59A 2OTMA 3N2KB 1VQMF 4O2BB 2HP0B 3D00A 2UYJA 2GZLA 2HRUA 3B6NA 4X1KB 5HP8A 5HY2A 3FD5A 4C8EA 5GINC 4G4WA 3ZP4A 3JAWA 3NMUC 2CW4A 2YYEA 2Q1XA 3HKEA 5ITZB 4G4ZA 1E7KA 3IMPA 5J2UB 5JVDB 3TD4A 3VIUA 4B46A 1W42A 5EAZA 3WXMB 5J2TA 2OTLF 4O4IB 1QVFF 1QD9A 2ZAUA 3JARA 3JATB 1VQ9F 4NQ3A 4EB6B 3HKDA 3JAMM 3K14A 2CVLA 1Z5VA 1W40A 3S0WA 5HY1A 2ZVYA 5C8YB 1KQSF 3P0ZA 4X20A 2I6RA 3CG6A 1VQKF 1FFXA 3K0TA 5KMGA 1XBIA 1JFFB 1DT9A 4LNUB 4DRXA 4EI8A 3CC4F 4ZK7A 1FNJA 4G4XA 3NVKE 1X25A 4O2BA 3VTIC 2HP0A 3CC7F 1VQ7F 1KNJA 3I3FA 5IJ0B 3CYQA 3MCQA 4YJ3B 3VI6A 1ZWZA 4X1KA 1VHAA 4X1IB 1Q86H 4IHJB 1W5FA 1JJ2F 3OONA 5AVMA 1VQLF 4BVSA 1JN1A 3KJJA 3VYSC 4M8IA 5ITZA 1NMUB 5J2UA 5JVDA 5LOVB 1YI2F 1VQ6F 4O4IA 5G4UC 3HWUA 2HP3A 3JASB 3WJRA 2AIFA 4U39A 5CB4B 4KWEA 3JATA 2UZHA 1RQ7A 3HAXD 1DBFA 4ZHWA 3JCMM 3RYFB 5EIBC 3IR9A 4EB6A 4TV9B 4I50B 1VQ8F 3F0DA 1K9MH 1KNKA 1TVKB 2V9YA 5FLXM 4WBNB 5C8YA 4EI7A 1YITF 1CN7A 1RLUA 3ELCA 3DC2A 1NQ3A 3NK6A 2DYYA 5LYJB 3RA6A 1JFFA 1YJNF 4LNUA 3LWPC 3RYIB 2N48A 1VQNF 3N4YA 2B33A 3NVIB 1T0KB 4RHAA 1W5AA 2LCAA 5IJ0A 3OW2F 4YJ3A 2KTVA 4X1IA 4IHJA 3JARB 3TD5A 4BVRA 2LBXA 3S0YA 2BTUA 1U40A 3MCAB 3C9SA 5IJ9B 3N2GB 3ZOPA 1JY8A 1W57A 5LOVA 3OBYA 5MN4A 1T0AA 4G4VA 3C9UA 3V3TA 4IIJB 3CXCF 2HS4A 1JD1A 2AMTA 3K12A 1PXWA 2R6R1 3SIUA 5JCOA 3JASA 4G88A 2RHHA 4DXDA 3F0EA 5CB4A 3CCVF 1UFYA 2FC3A 1RLGA 3KHNA 3PLAC 3RYFA 2BO1A 5GANK 4TV9A 4I50A 4O4JB 4ZHQA 4NWOB 4BW0B 5MN5A 2VGMA 4BVQA 2IG8A 2VAPA 2H8EA 3O85A 1TVKA 3VYUC 4WBNA 2JNBA 2Z1EA 5LP6C 1COMA 3I7TA 4G4YA 3R0PA 3QTYA 2ALEA 3T80A 5LYJA 5A2QM 3JAKA 5EIBD 4ZOLB 1FSZA 3RYIA 3UT5B 4U3JB 1GO1A 3TD3A 2WALA 1IV4A 2P6YA 1GZ0A 1Q81H 3C8LA 1H7MA 3LWRC 3CCEF 2CSLA 3F6MA 5IJ9A 3P10A 3N2GA
chains in the Genus database with same CATH topology
1VQLF 5FJ4C 2CZWA 4BVSA 3CMAF 3FFMA 1S72F 2QEXF 1YHQF 1W3EX 4BY9D 5HY4A 1NMUB 5GIPC 3CC2F 4TZZA 1YI2F 1VQ6F 1VQ4F 1N8RH 3CCRF 5G4UC 4EI9A 4LCKA 1Q86H 4NUTA 2AIFA 1IPAA 1SDSA 5HWEA 3CPQA 3I56F 3HAXD 5EWRA 1M90H 3JCMM 2VGNA 3IR9A 1QVGF 3CCMF 4X3LA 1VQ8F 1CK2A 2HVYD 1RA4A 3V7QA 1K9MH 1YIJF 3CD6F 3RA5A 3CMEF 5FLXM 4EI7A 1YITF 1CN7A 3G71F 3NK6A 1VQPF 3AGKA 3E20B 3CCLF 1M1KH 3RA6A 1YJNF 3LFOA 5IT9M 2QI2A 3LWPC 1VQOF 3G6EF 5EO3A 1VQNF 1YJ9F 3N4YA 3NVIB 1T0KB 3N4ZA 5GAPK 1VQMF 3OBWA 4BVTA 3OW2F 2KTVA 3D00A 1GO0A 3CCSF 4BVRA 2OTJF 2LBWA 2LBXA 3V7EA 3LWOC 3I55F 5HY2A 1X7PA 3MCAB 2OHWA 3LWQC 1YJWF 5GINC 2FGYA 3ON1A 4X3MA 1VQ5F 3NMUC 2OZBA 3OBYA 5DCVA 2QA4F 3V3TA 3CXCF 1E7KA 3SIUA 1PXWA 3CPWF 1W42A 2OTLF 3WXMB 1QVFF 3CCVF 1Q82H 5G4VC 3J7AR 1RLGA 2FC3A 2GLZA 3PLAC 5GIOC 5HY0A 2BO1A 5HXUA 5GANK 3G4SF 4XCQA 1VQ9F 4NQ3A 4BW0B 1W2BF 2VGMA 4BVQA 1X7OA 3JAMM 3O85A 2I6DA 1W40A 3CCUF 2JNBA 5HY1A 4C4WC 3J80M 3VMFB 2ALEA 1Q7YH 5A2QM 3PAFA 1KQSF 2KG4A 3SIVA 1K73H 3CG6A 1VQKF 1KC8H 3CCJF 1XBIA 5HXZA 1GO1A 1DT9A 4EI8A 3GYQA 3CC4F 1W41A 2F9ZC 2WALA 3NVKE 1GZ0A 1X52A 3LWVC 3CCQF 1Q81H 3CC7F 3HJWC 1VQ7F 1H7MA 3E1YA 1KD1H 3LWRC 2KTUA 1NJIH 3VI6A 3CCEF 1ZWZA 3J81M 1K8AH 3NK7A 1JJ2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL F;  5FJ4 C;  2CZW A;  1S72 F;  3CMA F;  3FFM A;  2QEX F;  1YHQ F;  1W3E X;  4BY9 D;  1NMU B;  5GIP C;  3CC2 F;  4TZZ A;  1YI2 F;  1VQ6 F;  1VQ4 F;  1N8R H;  3CCR F;  5G4U C;  4LCK A;  1Q86 H;  4NUT A;  2AIF A;  1IPA A;  1SDS A;  3CPQ A;  3I56 F;  3HAX D;  5EWR A;  1M90 H;  3JCM M;  2VGN A;  3IR9 A;  1QVG F;  3CCM F;  4X3L A;  1VQ8 F;  1CK2 A;  2HVY D;  1RA4 A;  3V7Q A;  1K9M H;  1YIJ F;  3CD6 F;  3RA5 A;  3CME F;  5FLX M;  1YIT F;  1CN7 A;  3G71 F;  3NK6 A;  1VQP F;  3AGK A;  3E20 B;  3CCL F;  1M1K H;  3RA6 A;  1YJN F;  3LFO A;  5IT9 M;  2QI2 A;  3LWP C;  1VQO F;  3G6E F;  5EO3 A;  1VQN F;  1YJ9 F;  3N4Y A;  3NVI B;  1T0K B;  3N4Z A;  5GAP K;  1VQM F;  3OBW A;  3OW2 F;  2KTV A;  1GO0 A;  3CCS F;  2OTJ F;  2LBW A;  2LBX A;  3V7E A;  3LWO C;  3I55 F;  1X7P A;  3MCA B;  2OHW A;  3LWQ C;  1YJW F;  5GIN C;  3ON1 A;  4X3M A;  1VQ5 F;  3NMU C;  2OZB A;  3OBY A;  5DCV A;  2QA4 F;  3CXC F;  1E7K A;  3SIU A;  1PXW A;  3CPW F;  1W42 A;  2OTL F;  3WXM B;  1QVF F;  3CCV F;  1Q82 H;  5G4V C;  3J7A R;  1RLG A;  2FC3 A;  3PLA C;  5GIO C;  2BO1 A;  5GAN K;  3G4S F;  1VQ9 F;  4BW0 B;  1W2B F;  2VGM A;  1X7O A;  3JAM M;  3O85 A;  2I6D A;  1W40 A;  3CCU F;  2JNB A;  4C4W C;  3J80 M;  3VMF B;  2ALE A;  1Q7Y H;  5A2Q M;  3PAF A;  1KQS F;  2KG4 A;  3SIV A;  1K73 H;  3CG6 A;  1VQK F;  1KC8 H;  3CCJ F;  1XBI A;  1GO1 A;  1DT9 A;  3GYQ A;  3CC4 F;  1W41 A;  2WAL A;  3NVK E;  1GZ0 A;  1X52 A;  3LWV C;  3CCQ F;  1Q81 H;  3CC7 F;  3HJW C;  1VQ7 F;  1H7M A;  3E1Y A;  1KD1 H;  3LWR C;  2KTU A;  1NJI H;  3VI6 A;  3CCE F;  1ZWZ A;  3J81 M;  1K8A H;  3NK7 A;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 3FFM A;  1UI9 A;  3VOB A;  4BY9 D;  5HY4 A;  2H6L A;  4IIJ A;  4BT5 A;  1W58 1;  4F6R B;  3HKB B;  5GIP C;  4O2A B;  3CC2 F;  4TZZ A;  2Z1T A;  3Q8H A;  5BMV B;  1Q8R A;  3WJP A;  3I56 F;  4O4J A;  1VH8 A;  2PHN A;  1XRG A;  3C9R A;  4X3L A;  3KE1 A;  3V7Q A;  1YIJ F;  1TUB B;  2G9I A;  3D54 A;  2NMU A;  3G71 F;  2IAF A;  3MQW A;  4ZOL A;  3AGK A;  2CHT A;  5LXT B;  2AIZ P;  2R75 1;  1VK3 A;  3IEQ A;  1M1K H;  3LFO A;  3UT5 A;  4U3J A;  5FNV B;  3S06 A;  1OFU A;  5B8F A;  2BTO A;  3S03 A;  1YJ9 F;  3N4Z A;  5GAP K;  3RYC B;  4BVT A;  3ZP7 A;  3CCS F;  3V7E A;  1PF5 A;  1QU9 A;  4ZHQ B;  3LWO C;  3I55 F;  2L26 A;  1X7P A;  3KJK A;  2H8C A;  1YJW F;  4X3M A;  4F6R A;  1VQ5 F;  2HS0 A;  3HKB A;  2OZB A;  3WGK A;  4O2A A;  1QAH A;  5DCV A;  1XV2 A;  2QA4 F;  5EB1 B;  1U43 A;  5CA1 B;  1H48 A;  5BMV A;  3JAK B;  2Z01 A;  2BTQ B;  2DT4 A;  4ZHY B;  1IV1 A;  3IKE A;  2ZOV A;  1W5B A;  5G4V C;  3CYP B;  1Q82 H;  4B62 A;  2GLZ A;  2MQE A;  1CLI A;  2QTP A;  5HXU A;  3G4S F;  2Z1U A;  4XCQ A;  3ZO8 A;  1W2B F;  2RHJ A;  1X7O A;  4FFB B;  3WGJ A;  5EB0 A;  1TUB A;  3CCU F;  4B45 A;  5LXT A;  2VAM A;  5FNV A;  3S0H A;  3MDO A;  2IQQ A;  3CCJ F;  2HX0 A;  1U3L A;  1W5E A;  3DDN A;  4R40 B;  1W41 A;  2F9Z C;  4TUY B;  4TV8 B;  3RYC A;  4PWT A;  3E22 B;  2UYN B;  2ZOD A;  4ZHV A;  5JH7 B;  3J81 M;  1K8A H;  4BT2 A;  3NK7 A;  1R1M A;  5GON B;  1IV2 A;  1W55 A;  5JQG B;  3FPI A;  5CA1 A;  1IV3 A;  4I4T B;  5IYZ B;  3FBA A;  2CHS A;  2RB9 A;  3U0O A;  3FD6 A;  3GHZ A;  3L7Q A;  4EI9 A;  3S02 A;  1IPA A;  1SDS A;  1OAP A;  5LP6 B;  5EWR A;  5EYP A;  1M90 H;  2VGN A;  4FFB A;  1VQV A;  4ZI7 B;  3CCM F;  1SA0 B;  1J7H A;  5LA6 B;  2HVY D;  5MN6 A;  3CD6 F;  4YJ2 B;  3RA5 A;  2VXY A;  3ERN A;  4O4L A;  4E6E A;  3LDT A;  1ODE A;  1RQ2 A;  4ERH A;  3HKC B;  3HTN A;  3WPX A;  2Q1Y A;  4TUY A;  3G6E F;  5CA0 B;  3P4E A;  3C9T A;  4TV8 A;  4C81 A;  3E22 A;  3M1X A;  1FNK A;  4RQO A;  2UYN A;  2VAW A;  3LYB A;  3M84 A;  3OBW A;  3GTZ A;  3ESJ A;  3JVH A;  1GO0 A;  5JH7 A;  2OTJ F;  2LBW A;  4HNA B;  3BYQ A;  4I55 B;  5GON A;  3V4D A;  4BT4 A;  3EOR A;  4X1Y B;  2OHW A;  3D01 A;  3LWQ C;  5JQG A;  2FGY A;  3ON1 A;  4I4T A;  5IYZ A;  3IKF A;  3VYT C;  2HS3 A;  5KX5 B;  3VO8 A;  3CPW F;  3J7A R;  3N2K A;  5LP6 A;  2GVI A;  1U3P A;  5GIO C;  5HY0 A;  4ZI7 A;  1YGY A;  5EZY B;  2PMP A;  3JAL B;  1SA0 A;  1GX1 A;  5LA6 A;  2YXZ A;  1YQN A;  4YJ2 A;  5JCO C;  1H47 A;  2I6D A;  4BT6 A;  3F0F A;  2LBT A;  4C4W C;  3J80 M;  3VMF B;  1Q7Y H;  3WPW A;  3F0G A;  3PAF A;  3HKC A;  2KG4 A;  3SIV A;  2W8B C;  1K73 H;  1KC8 H;  4BT7 A;  5CA0 A;  5HXZ A;  2ZVZ A;  3GYQ A;  2Z1F A;  3RE3 A;  1X52 A;  3LWV C;  3WGL A;  3CB2 A;  4BT3 A;  3RYH B;  2UYK A;  3CCQ F;  3HJW C;  4O4H B;  3E1Y A;  1KD1 H;  4HNA A;  4I55 A;  2KTU A;  3IEW A;  1NJI H;  5EYP B;  2CWJ A;  2RHO A;  4X1Y A;  3WJQ A;  1ONI A;  3WGN A;  5FJ4 C;  5HP7 A;  2CZW A;  1S72 F;  3QUW A;  3CMA F;  1SZQ A;  2QEX F;  3VOA A;  1YHQ F;  5KX5 A;  1W3E X;  4C82 A;  3JAW B;  4O4L B;  1VQ4 F;  3HKE B;  1N8R H;  3CCR F;  4LCK A;  4NUT A;  5J2T B;  1Z5W A;  5HWE A;  3CPQ A;  5EZY A;  3JAL A;  3LME A;  2RHL A;  1QVG F;  4B5C A;  2EWC A;  1CK2 A;  4C8I A;  1RA4 A;  3MBM A;  2UYP A;  3HKD B;  2ZF8 A;  3CME F;  3QHD A;  2K1S A;  3KIZ A;  2HQS C;  3VCZ A;  3M4S A;  1XHO A;  1VQP F;  3E20 B;  3CCL F;  4C8G A;  4X20 B;  5IT9 M;  2QI2 A;  3K2X A;  2HRY A;  1VQO F;  1FFX B;  5KMG B;  5EO3 A;  2KGW A;  3RYH A;  3WGM A;  4DRX B;  4O4H A;  1W59 A;  2OTM A;  3N2K B;  1VQM F;  4O2B B;  2HP0 B;  3D00 A;  2UYJ A;  2GZL A;  2HRU A;  3B6N A;  4X1K B;  5HP8 A;  5HY2 A;  3FD5 A;  4C8E A;  5GIN C;  4G4W A;  3ZP4 A;  3JAW A;  3NMU C;  2CW4 A;  2YYE A;  2Q1X A;  3HKE A;  5ITZ B;  4G4Z A;  1E7K A;  3IMP A;  5J2U B;  5JVD B;  3TD4 A;  3VIU A;  4B46 A;  1W42 A;  5EAZ A;  3WXM B;  5J2T A;  2OTL F;  4O4I B;  1QVF F;  1QD9 A;  2ZAU A;  3JAR A;  3JAT B;  1VQ9 F;  4NQ3 A;  4EB6 B;  3HKD A;  3JAM M;  3K14 A;  2CVL A;  1Z5V A;  1W40 A;  3S0W A;  5HY1 A;  2ZVY A;  5C8Y B;  1KQS F;  3P0Z A;  4X20 A;  2I6R A;  3CG6 A;  1VQK F;  1FFX A;  3K0T A;  5KMG A;  1XBI A;  1JFF B;  1DT9 A;  4LNU B;  4DRX A;  4EI8 A;  3CC4 F;  4ZK7 A;  1FNJ A;  4G4X A;  3NVK E;  1X25 A;  4O2B A;  3VTI C;  2HP0 A;  3CC7 F;  1VQ7 F;  1KNJ A;  3I3F A;  5IJ0 B;  3CYQ A;  3MCQ A;  4YJ3 B;  3VI6 A;  1ZWZ A;  4X1K A;  1VHA A;  4X1I B;  1Q86 H;  4IHJ B;  1W5F A;  1JJ2 F;  3OON A;  5AVM A;  1VQL F;  4BVS A;  1JN1 A;  3KJJ A;  3VYS C;  4M8I A;  5ITZ A;  1NMU B;  5J2U A;  5JVD A;  5LOV B;  1YI2 F;  1VQ6 F;  4O4I A;  5G4U C;  3HWU A;  2HP3 A;  3JAS B;  3WJR A;  2AIF A;  4U39 A;  5CB4 B;  4KWE A;  3JAT A;  2UZH A;  1RQ7 A;  3HAX D;  1DBF A;  4ZHW A;  3JCM M;  3RYF B;  5EIB C;  3IR9 A;  4EB6 A;  4TV9 B;  4I50 B;  1VQ8 F;  3F0D A;  1K9M H;  1KNK A;  1TVK B;  2V9Y A;  5FLX M;  4WBN B;  5C8Y A;  4EI7 A;  1YIT F;  1CN7 A;  1RLU A;  3ELC A;  3DC2 A;  1NQ3 A;  3NK6 A;  2DYY A;  5LYJ B;  3RA6 A;  1JFF A;  1YJN F;  4LNU A;  3LWP C;  3RYI B;  2N48 A;  1VQN F;  3N4Y A;  2B33 A;  3NVI B;  1T0K B;  4RHA A;  1W5A A;  2LCA A;  5IJ0 A;  3OW2 F;  4YJ3 A;  2KTV A;  4X1I A;  4IHJ A;  3JAR B;  3TD5 A;  4BVR A;  2LBX A;  3S0Y A;  2BTU A;  1U40 A;  3MCA B;  3C9S A;  5IJ9 B;  3N2G B;  3ZOP A;  1JY8 A;  1W57 A;  5LOV A;  3OBY A;  5MN4 A;  1T0A A;  4G4V A;  3C9U A;  3V3T A;  4IIJ B;  3CXC F;  2HS4 A;  1JD1 A;  2AMT A;  3K12 A;  1PXW A;  2R6R 1;  3SIU A;  5JCO A;  3JAS A;  4G88 A;  2RHH A;  4DXD A;  3F0E A;  5CB4 A;  3CCV F;  1UFY A;  2FC3 A;  1RLG A;  3KHN A;  3PLA C;  3RYF A;  2BO1 A;  5GAN K;  4TV9 A;  4I50 A;  4O4J B;  4ZHQ A;  4NWO B;  4BW0 B;  5MN5 A;  2VGM A;  4BVQ A;  2IG8 A;  2VAP A;  2H8E A;  3O85 A;  1TVK A;  3VYU C;  4WBN A;  2JNB A;  2Z1E A;  5LP6 C;  1COM A;  3I7T A;  4G4Y A;  3R0P A;  3QTY A;  2ALE A;  3T80 A;  5LYJ A;  5A2Q M;  3JAK A;  5EIB D;  4ZOL B;  1FSZ A;  3RYI A;  3UT5 B;  4U3J B;  1GO1 A;  3TD3 A;  2WAL A;  1IV4 A;  2P6Y A;  1GZ0 A;  1Q81 H;  3C8L A;  1H7M A;  3LWR C;  3CCE F;  2CSL A;  3F6M A;  5IJ9 A;  3P10 A;  3N2G A; 
#chains in the Genus database with same CATH homology
 1VQL F;  5FJ4 C;  2CZW A;  4BVS A;  3CMA F;  3FFM A;  1S72 F;  2QEX F;  1YHQ F;  1W3E X;  4BY9 D;  5HY4 A;  1NMU B;  5GIP C;  3CC2 F;  4TZZ A;  1YI2 F;  1VQ6 F;  1VQ4 F;  1N8R H;  3CCR F;  5G4U C;  4EI9 A;  4LCK A;  1Q86 H;  4NUT A;  2AIF A;  1IPA A;  1SDS A;  5HWE A;  3CPQ A;  3I56 F;  3HAX D;  5EWR A;  1M90 H;  3JCM M;  2VGN A;  3IR9 A;  1QVG F;  3CCM F;  4X3L A;  1VQ8 F;  1CK2 A;  2HVY D;  1RA4 A;  3V7Q A;  1K9M H;  1YIJ F;  3CD6 F;  3RA5 A;  3CME F;  5FLX M;  4EI7 A;  1YIT F;  1CN7 A;  3G71 F;  3NK6 A;  1VQP F;  3AGK A;  3E20 B;  3CCL F;  1M1K H;  3RA6 A;  1YJN F;  3LFO A;  5IT9 M;  2QI2 A;  3LWP C;  1VQO F;  3G6E F;  5EO3 A;  1VQN F;  1YJ9 F;  3N4Y A;  3NVI B;  1T0K B;  3N4Z A;  5GAP K;  1VQM F;  3OBW A;  4BVT A;  3OW2 F;  2KTV A;  3D00 A;  1GO0 A;  3CCS F;  4BVR A;  2OTJ F;  2LBW A;  2LBX A;  3V7E A;  3LWO C;  3I55 F;  5HY2 A;  1X7P A;  3MCA B;  2OHW A;  3LWQ C;  1YJW F;  5GIN C;  2FGY A;  3ON1 A;  4X3M A;  1VQ5 F;  3NMU C;  2OZB A;  3OBY A;  5DCV A;  2QA4 F;  3V3T A;  3CXC F;  1E7K A;  3SIU A;  1PXW A;  3CPW F;  1W42 A;  2OTL F;  3WXM B;  1QVF F;  3CCV F;  1Q82 H;  5G4V C;  3J7A R;  1RLG A;  2FC3 A;  2GLZ A;  3PLA C;  5GIO C;  5HY0 A;  2BO1 A;  5HXU A;  5GAN K;  3G4S F;  4XCQ A;  1VQ9 F;  4NQ3 A;  4BW0 B;  1W2B F;  2VGM A;  4BVQ A;  1X7O A;  3JAM M;  3O85 A;  2I6D A;  1W40 A;  3CCU F;  2JNB A;  5HY1 A;  4C4W C;  3J80 M;  3VMF B;  2ALE A;  1Q7Y H;  5A2Q M;  3PAF A;  1KQS F;  2KG4 A;  3SIV A;  1K73 H;  3CG6 A;  1VQK F;  1KC8 H;  3CCJ F;  1XBI A;  5HXZ A;  1GO1 A;  1DT9 A;  4EI8 A;  3GYQ A;  3CC4 F;  1W41 A;  2F9Z C;  2WAL A;  3NVK E;  1GZ0 A;  1X52 A;  3LWV C;  3CCQ F;  1Q81 H;  3CC7 F;  3HJW C;  1VQ7 F;  1H7M A;  3E1Y A;  1KD1 H;  3LWR C;  2KTU A;  1NJI H;  3VI6 A;  3CCE F;  1ZWZ A;  3J81 M;  1K8A H;  3NK7 A;  1JJ2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...