5HY0A

Orotic acid hydrolase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
377
structure length
362
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVTSMCWSNDASALGVAVALGEVKRDLVADDRIRFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNHMGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
total genus 110
structure length 362
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A01
5HXUA 5HWEA 4BVQA 5HY2A 5HXZA 5HY1A 4BVRA 5HY4A 4BVTA 4NQ3A 5HY0A 4BVSA
chains in the Genus database with same CATH superfamily
5ITZA 5LYJB 2N48A 3JARB 3NK6A 3CCJF 1QD9A 4O4IB 3B6NA 3VMFB 3IMPA 4G4VA 2Q1XA 4X20A 4B62A 1TVKA 5CB4A 3KJKA 3WJPA 1W5FA 4ZHQB 3HKBA 1W2BF 1Q7YH 3LMEA 3JASA 3MQWA 3OBWA 3IKFA 3MCAB 4X1IB 3WGJA 3OONA 3F0DA 3RA6A 5HY1A 2BTUA 1IPAA 3PAFA 4G4XA 2OZBA 3AGKA 1H7MA 5MN4A 2VGNA 1IV3A 4I55A 3HWUA 4X1YA 1JFFA 3RYFA 5EAZA 1YGYA 4TV8A 1Q86H 3CPQA 3D54A 2I6RA 5GIPC 1K8AH 1J7HA 5EIBC 3ESJA 3T80A 5GIOC 3M4SA 3RA5A 1TVKB 2VXYA 5EIBD 4ZHWA 3LWVC 5KMGA 3JASB 5FNVA 5CA1B 3CCUF 5JCOA 5IJ0A 3F0GA 5HY2A 4IIJB 1X52A 4NUTA 2KG4A 2ZVZA 2H8EA 5LA6A 3CG6A 2KTVA 2Z1FA 4ZHVA 3RYIA 4BVTA 1YITF 4B46A 4ZI7A 2GLZA 4YJ2A 1UFYA 4ERHA 1GZ0A 2Z1EA 3CMEF 2DT4A 3JCMM 4X3MA 3V7EA 5LOVA 2UYPA 3ON1A 2OHWA 3F6MA 3WJQA 3WGLA 4C82A 3WXMB 4O2AB 1Q81H 2GZLA 2RHJA 3V3TA 4WBNB 4FFBA 1IV1A 3CXCF 4O4HA 3N2GA 3S0HA 2F9ZC 5MN5A 3VYTC 1T0AA 2HX0A 3VOBA 3M84A 2HS0A 1M90H 5JCOC 4ZOLA 4XCQA 3RYIB 4TZZA 5EB0A 4ZI7B 1S72F 3N2KA 4F6RB 3E1YA 1QVFF 3S06A 2R751 4EI9A 1VH8A 5J2TB 1JY8A 3OBYA 3G71F 2AMTA 1RA4A 3V7QA 4EI7A 3JAMM 3I7TA 1FSZA 1PXWA 2VAWA 5EYPB 4ZK7A 5LXTA 4O4JB 3ZP4A 2PHNA 4LCKA 1W5AA 1XV2A 3DDNA 1K73H 1RLGA 1X7PA 3QHDA 3ZP7A 4C8EA 1VQ5F 3RYCA 3CC2F 3K12A 1TUBB 3CCLF 1KNKA 3N2KB 4LNUB 3HKCB 3ERNA 4C8GA 1R1MA 5LYJA 3JARA 4O4IA 1VQOF 3G6EF 4HNAB 4I4TB 5CA0B 3U0OA 3N4YA 3CCQF 3CCSF 5LXTB 3E20B 5MN6A 4ZHQA 4X1IA 2AIZP 4IHJA 1VQ8F 3R0PA 3NK7A 1Q8RA 3KE1A 3LFOA 1YI2F 2Q1YA 1K9MH 1ONIA 2HVYD 2FGYA 3JVHA 3FD6A 3I56F 3O85A 1ZWZA 3RE3A 1VQ4F 3CCRF 5BMVA 1E7KA 4BT3A 2VAMA 4G4WA 4BT2A 1QU9A 3C9UA 5CA1A 4IHJB 4IIJA 3HJWC 3D00A 3S02A 3VOAA 2VAPA 3CYQA 3K0TA 3ZOPA 2ZVYA 1SA0A 5BMVB 2HS3A 4TV9A 2IAFA 2ZOVA 4TUYB 1U43A 3E22A 3GTZA 3KHNA 3C9SA 3WGMA 4BT4A 4I50B 1ODEA 2CZWA 1T0KB 4O2AA 4EB6B 4WBNA 1YJ9F 1DBFA 2Z1TA 5EZYB 3MBMA 1NJIH 1YJWF 5HP7A 1W5EA 3VIUA 1W41A 2KTUA 2KGWA 3TD4A 4G4ZA 5LP6A 2HP3A 2QA4F 2VGMA 1YQNA 4F6RA 1SA0B 5JQGB 2UYKA 1RQ2A 3CCEF 3IEWA 4TV9B 4M8IA 2PMPA 5J2TA 2RB9A 3JALA 1Z5VA 3E22B 5B8FA 1YJNF 1SDSA 5IJ9A 1W42A 5G4VC 2L26A 5EYPA 5KX5A 1JD1A 3DC2A 4O4JA 4BT5A 1VK3A 1RLUA 5AVMA 3I3FA 3N4ZA 4O4LB 3P0ZA 4R40B 4BT6A 3CPWF 3J7AR 4DRXB 5LP6B 3VYUC 1TUBA 4PWTA 5C8YB 3J80M 3OW2F 3SIVA 2ZF8A 4LNUA 3HKCA 3UT5B 5LP6C 3TD3A 4NQ3A 5IYZB 3JALB 5HWEA 4HNAA 4RHAA 3P10A 4I4TA 5CA0A 5IJ9B 3VO8A 3WGNA 5KX5B 1RQ7A 2CW4A 5J2UB 1VQVA 5JVDB 4EI8A 3WPXA 2LBWA 1XBIA 4U3JA 5GINC 2BTQB 4E6EA 1W40A 3RYHB 1VQLF 2IG8A 3CD6F 2YYEA 4O2BB 3WPWA 2UYNB 2QEXF 3G4SF 4YJ3B 3K2XA 1VQPF 3M1XA 2HP0B 1FNKA 2W8BC 3S03A 5EWRA 3D01A 3WJRA 2WALA 3C9RA 2CWJA 1IV2A 2HS4A 2QI2A 2CSLA 3QUWA 1W581 4B45A 3V4DA 2FC3A 1XHOA 1H48A 1DT9A 4U3JB 1SZQA 1YIJF 4BT7A 5EB1B 1U3PA 1W57A 3JAKB 1GO0A 3F0FA 3FPIA 1OAPA 2I6DA 1W59A 2LBTA 3K14A 1CN7A 1X7OA 4NWOB 1FFXB 1W55A 4TUYA 2Z1UA 3JAWB 3TD5A 2AIFA 2H6LA 2HRYA 3GYQA 3VTIC 1GX1A 4I50A 2EWCA 3LDTA 4DXDA 5IT9M 2RHOA 3SIUA 4G88A 1FNJA 4EB6A 3CCMF 3FBAA 4U39A 3GHZA 5EZYA 1XRGA 3CMAF 1PF5A 2K1SA 1JJ2F 2LCAA 3LWOC 1Q82H 2UYJA 4C81A 1X25A 3VCZA 4BVQA 2P6YA 5GANK 3C9TA 5JQGA 4X1KB 3LWRC 2HRUA 3IEQA 3LWQC 3JATA 1VQMF 2GVIA 2Z01A 3ZO8A 1VQ9F 3HKDB 5A2QM 3FFMA 3FD5A 1H47A 1VQ6F 3HKEB 4O4LA 5GONB 5HY0A 2V9YA 3WGKA 1M1KH 1UI9A 1KD1H 1QVGF 4DRXA 3CC7F 1KQSF 5ITZB 4G4YA 5C8YA 1COMA 2BTOA 3UT5A 2ALEA 4X20B 1CLIA 2IQQA 5IYZA 5FLXM 5CB4B 3JATB 2NMUA 3HKBB 4BVRA 1U3LA 3ELCA 3CB2A 2OTLF 5J2UA 2B33A 5JVDA 3S0YA 5HXZA 4RQOA 1CK2A 4I55B 3RYHA 4X1YB 1JFFB 3J81M 3RYFB 2CVLA 3HAXD 2JNBA 4O2BA 2OTMA 2UYNA 4TV8B 3I55F 2LBXA 2QTPA 4YJ3A 3C8LA 2HP0A 1VHAA 4BVSA 1VQKF 5DCVA 1GO1A 3EORA 5KMGB 5FNVB 3NVKE 3IKEA 5IJ0B 2DYYA 5FJ4C 1W5BA 3LWPC 3KJJA 3NMUC 3PLAC 3HTNA 2OTJF 2RHLA 3F0EA 5LA6B 2CHSA 5HP8A 3MDOA 2UZHA 5JH7A 1IV4A 4YJ2B 2ZAUA 2RHHA 3CYPB 1KC8H 3JAKA 3P4EA 1QAHA 5LOVB 3BYQA 1Z5WA 2CHTA 2H8CA 1FFXA 3JAWA 3IR9A 4ZHYB 3MCQA 2YXZA 4FFBB 5G4UC 1U40A 4O4HB 4C8IA 3N2GB 1W3EX 3VYSC 3QTYA 4C4WC 3CCVF 4ZOLB 3LYBA 5JH7B 3CC4F 3VI6A 5GAPK 4X3LA 1N8RH 5EO3A 3S0WA 5HY4A 2ZODA 1JN1A 4X1KA 2G9IA 1KNJA 1NQ3A 2MQEA 2R6R1 3NVIB 1VQNF 3HKDA 5HXUA 1OFUA 3KIZA 1YHQF 4BY9D 1VQ7F 2BO1A 3HKEA 5GONA 4B5CA 3RYCB 1NMUB 2HQSC 3L7QA 3Q8HA 4KWEA 4BW0B
chains in the Genus database with same CATH topology
3J80M 3OW2F 3SIVA 3NK6A 3CCJF 4NQ3A 3VMFB 2ALEA 3G6EF 1VQOF 5HWEA 3N4YA 5FLXM 3CCQF 3CCSF 3E20B 4BVRA 1W2BF 1Q7YH 3OBWA 4EI8A 2OTLF 3MCAB 2LBWA 3RA6A 5HXZA 5HY1A 1VQ8F 1IPAA 1CK2A 3PAFA 1XBIA 2OZBA 3AGKA 1H7MA 3NK7A 5GINC 1W40A 2VGNA 1VQLF 3LFOA 1YI2F 1K9MH 3J81M 3CD6F 2HVYD 2FGYA 3I56F 3O85A 1ZWZA 2JNBA 2QEXF 3HAXD 1VQ4F 3G4SF 3I55F 3CCRF 2LBXA 1Q86H 1VQPF 3CPQA 1KQSF 1E7KA 5EWRA 4BVSA 5GIPC 1K8AH 1VQKF 2WALA 5GIOC 5DCVA 3RA5A 1GO1A 2QI2A 3LWVC 3NVKE 3CCUF 5FJ4C 5HY2A 3LWPC 2FC3A 3NMUC 1X52A 4NUTA 3PLAC 3HJWC 2OTJF 2KG4A 3D00A 1DT9A 1YIJF 3CG6A 2KTVA 4BVTA 1KC8H 1YITF 1GO0A 2GLZA 1GZ0A 2I6DA 3CMEF 3JCMM 4X3MA 3V7EA 3ON1A 1X7OA 2OHWA 1CN7A 3WXMB 2AIFA 3GYQA 2CZWA 3IR9A 1T0KB 1Q81H 5IT9M 3V3TA 3SIUA 5G4UC 3CXCF 1YJ9F 1W3EX 3CCMF 1NJIH 2F9ZC 1YJWF 4C4WC 3CMAF 1M90H 1W41A 3CCVF 2KTUA 1JJ2F 4XCQA 3CC4F 4TZZA 2QA4F 3VI6A 5GAPK 3LWOC 1S72F 1Q82H 2VGMA 4X3LA 3E1YA 5EO3A 1N8RH 4BVQA 1QVFF 5GANK 4EI9A 5HY4A 3CCEF 3LWRC 3OBYA 3G71F 1RA4A 3V7QA 4EI7A 3LWQC 3JAMM 1YJNF 1PXWA 1SDSA 1W42A 5G4VC 1VQMF 1VQ9F 3NVIB 5A2QM 3FFMA 1VQNF 5HXUA 4LCKA 1YHQF 1VQ6F 4BY9D 1K73H 1VQ7F 3N4ZA 1RLGA 2BO1A 5HY0A 1X7PA 1M1KH 3CPWF 3J7AR 1NMUB 1KD1H 1VQ5F 3CC2F 1QVGF 3CC7F 3CCLF 4BW0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXU A;  5HWE A;  4BVQ A;  5HY2 A;  5HXZ A;  5HY1 A;  4BVR A;  5HY4 A;  4BVT A;  4NQ3 A;  5HY0 A;  4BVS A; 
#chains in the Genus database with same CATH topology
 5ITZ A;  5LYJ B;  2N48 A;  3JAR B;  3NK6 A;  3CCJ F;  1QD9 A;  4O4I B;  3B6N A;  3VMF B;  3IMP A;  4G4V A;  2Q1X A;  4X20 A;  4B62 A;  1TVK A;  5CB4 A;  3KJK A;  3WJP A;  1W5F A;  4ZHQ B;  3HKB A;  1W2B F;  1Q7Y H;  3LME A;  3JAS A;  3MQW A;  3OBW A;  3IKF A;  3MCA B;  4X1I B;  3WGJ A;  3OON A;  3F0D A;  3RA6 A;  5HY1 A;  2BTU A;  1IPA A;  3PAF A;  4G4X A;  2OZB A;  3AGK A;  1H7M A;  5MN4 A;  2VGN A;  1IV3 A;  4I55 A;  3HWU A;  4X1Y A;  1JFF A;  3RYF A;  5EAZ A;  1YGY A;  4TV8 A;  1Q86 H;  3CPQ A;  3D54 A;  2I6R A;  5GIP C;  1K8A H;  1J7H A;  5EIB C;  3ESJ A;  3T80 A;  5GIO C;  3M4S A;  3RA5 A;  1TVK B;  2VXY A;  5EIB D;  4ZHW A;  3LWV C;  5KMG A;  3JAS B;  5FNV A;  5CA1 B;  3CCU F;  5JCO A;  5IJ0 A;  3F0G A;  5HY2 A;  4IIJ B;  1X52 A;  4NUT A;  2KG4 A;  2ZVZ A;  2H8E A;  5LA6 A;  3CG6 A;  2KTV A;  2Z1F A;  4ZHV A;  3RYI A;  4BVT A;  1YIT F;  4B46 A;  4ZI7 A;  2GLZ A;  4YJ2 A;  1UFY A;  4ERH A;  1GZ0 A;  2Z1E A;  3CME F;  2DT4 A;  3JCM M;  4X3M A;  3V7E A;  5LOV A;  2UYP A;  3ON1 A;  2OHW A;  3F6M A;  3WJQ A;  3WGL A;  4C82 A;  3WXM B;  4O2A B;  1Q81 H;  2GZL A;  2RHJ A;  3V3T A;  4WBN B;  4FFB A;  1IV1 A;  3CXC F;  4O4H A;  3N2G A;  3S0H A;  2F9Z C;  5MN5 A;  3VYT C;  1T0A A;  2HX0 A;  3VOB A;  3M84 A;  2HS0 A;  1M90 H;  5JCO C;  4ZOL A;  4XCQ A;  3RYI B;  4TZZ A;  5EB0 A;  4ZI7 B;  1S72 F;  3N2K A;  4F6R B;  3E1Y A;  1QVF F;  3S06 A;  2R75 1;  4EI9 A;  1VH8 A;  5J2T B;  1JY8 A;  3OBY A;  3G71 F;  2AMT A;  1RA4 A;  3V7Q A;  4EI7 A;  3JAM M;  3I7T A;  1FSZ A;  1PXW A;  2VAW A;  5EYP B;  4ZK7 A;  5LXT A;  4O4J B;  3ZP4 A;  2PHN A;  4LCK A;  1W5A A;  1XV2 A;  3DDN A;  1K73 H;  1RLG A;  1X7P A;  3QHD A;  3ZP7 A;  4C8E A;  1VQ5 F;  3RYC A;  3CC2 F;  3K12 A;  1TUB B;  3CCL F;  1KNK A;  3N2K B;  4LNU B;  3HKC B;  3ERN A;  4C8G A;  1R1M A;  5LYJ A;  3JAR A;  4O4I A;  1VQO F;  3G6E F;  4HNA B;  4I4T B;  5CA0 B;  3U0O A;  3N4Y A;  3CCQ F;  3CCS F;  5LXT B;  3E20 B;  5MN6 A;  4ZHQ A;  4X1I A;  2AIZ P;  4IHJ A;  1VQ8 F;  3R0P A;  3NK7 A;  1Q8R A;  3KE1 A;  3LFO A;  1YI2 F;  2Q1Y A;  1K9M H;  1ONI A;  2HVY D;  2FGY A;  3JVH A;  3FD6 A;  3I56 F;  3O85 A;  1ZWZ A;  3RE3 A;  1VQ4 F;  3CCR F;  5BMV A;  1E7K A;  4BT3 A;  2VAM A;  4G4W A;  4BT2 A;  1QU9 A;  3C9U A;  5CA1 A;  4IHJ B;  4IIJ A;  3HJW C;  3D00 A;  3S02 A;  3VOA A;  2VAP A;  3CYQ A;  3K0T A;  3ZOP A;  2ZVY A;  1SA0 A;  5BMV B;  2HS3 A;  4TV9 A;  2IAF A;  2ZOV A;  4TUY B;  1U43 A;  3E22 A;  3GTZ A;  3KHN A;  3C9S A;  3WGM A;  4BT4 A;  4I50 B;  1ODE A;  2CZW A;  1T0K B;  4O2A A;  4EB6 B;  4WBN A;  1YJ9 F;  1DBF A;  2Z1T A;  5EZY B;  3MBM A;  1NJI H;  1YJW F;  5HP7 A;  1W5E A;  3VIU A;  1W41 A;  2KTU A;  2KGW A;  3TD4 A;  4G4Z A;  5LP6 A;  2HP3 A;  2QA4 F;  2VGM A;  1YQN A;  4F6R A;  1SA0 B;  5JQG B;  2UYK A;  1RQ2 A;  3CCE F;  3IEW A;  4TV9 B;  4M8I A;  2PMP A;  5J2T A;  2RB9 A;  3JAL A;  1Z5V A;  3E22 B;  5B8F A;  1YJN F;  1SDS A;  5IJ9 A;  1W42 A;  5G4V C;  2L26 A;  5EYP A;  5KX5 A;  1JD1 A;  3DC2 A;  4O4J A;  4BT5 A;  1VK3 A;  1RLU A;  5AVM A;  3I3F A;  3N4Z A;  4O4L B;  3P0Z A;  4R40 B;  4BT6 A;  3CPW F;  3J7A R;  4DRX B;  5LP6 B;  3VYU C;  1TUB A;  4PWT A;  5C8Y B;  3J80 M;  3OW2 F;  3SIV A;  2ZF8 A;  4LNU A;  3HKC A;  3UT5 B;  5LP6 C;  3TD3 A;  4NQ3 A;  5IYZ B;  3JAL B;  5HWE A;  4HNA A;  4RHA A;  3P10 A;  4I4T A;  5CA0 A;  5IJ9 B;  3VO8 A;  3WGN A;  5KX5 B;  1RQ7 A;  2CW4 A;  5J2U B;  1VQV A;  5JVD B;  4EI8 A;  3WPX A;  2LBW A;  1XBI A;  4U3J A;  5GIN C;  2BTQ B;  4E6E A;  1W40 A;  3RYH B;  1VQL F;  2IG8 A;  3CD6 F;  2YYE A;  4O2B B;  3WPW A;  2UYN B;  2QEX F;  3G4S F;  4YJ3 B;  3K2X A;  1VQP F;  3M1X A;  2HP0 B;  1FNK A;  2W8B C;  3S03 A;  5EWR A;  3D01 A;  3WJR A;  2WAL A;  3C9R A;  2CWJ A;  1IV2 A;  2HS4 A;  2QI2 A;  2CSL A;  3QUW A;  1W58 1;  4B45 A;  3V4D A;  2FC3 A;  1XHO A;  1H48 A;  1DT9 A;  4U3J B;  1SZQ A;  1YIJ F;  4BT7 A;  5EB1 B;  1U3P A;  1W57 A;  3JAK B;  1GO0 A;  3F0F A;  3FPI A;  1OAP A;  2I6D A;  1W59 A;  2LBT A;  3K14 A;  1CN7 A;  1X7O A;  4NWO B;  1FFX B;  1W55 A;  4TUY A;  2Z1U A;  3JAW B;  3TD5 A;  2AIF A;  2H6L A;  2HRY A;  3GYQ A;  3VTI C;  1GX1 A;  4I50 A;  2EWC A;  3LDT A;  4DXD A;  5IT9 M;  2RHO A;  3SIU A;  4G88 A;  1FNJ A;  4EB6 A;  3CCM F;  3FBA A;  4U39 A;  3GHZ A;  5EZY A;  1XRG A;  3CMA F;  1PF5 A;  2K1S A;  1JJ2 F;  2LCA A;  3LWO C;  1Q82 H;  2UYJ A;  4C81 A;  1X25 A;  3VCZ A;  4BVQ A;  2P6Y A;  5GAN K;  3C9T A;  5JQG A;  4X1K B;  3LWR C;  2HRU A;  3IEQ A;  3LWQ C;  3JAT A;  1VQM F;  2GVI A;  2Z01 A;  3ZO8 A;  1VQ9 F;  3HKD B;  5A2Q M;  3FFM A;  3FD5 A;  1H47 A;  1VQ6 F;  3HKE B;  4O4L A;  5GON B;  5HY0 A;  2V9Y A;  3WGK A;  1M1K H;  1UI9 A;  1KD1 H;  1QVG F;  4DRX A;  3CC7 F;  1KQS F;  5ITZ B;  4G4Y A;  5C8Y A;  1COM A;  2BTO A;  3UT5 A;  2ALE A;  4X20 B;  1CLI A;  2IQQ A;  5IYZ A;  5FLX M;  5CB4 B;  3JAT B;  2NMU A;  3HKB B;  4BVR A;  1U3L A;  3ELC A;  3CB2 A;  2OTL F;  5J2U A;  2B33 A;  5JVD A;  3S0Y A;  5HXZ A;  4RQO A;  1CK2 A;  4I55 B;  3RYH A;  4X1Y B;  1JFF B;  3J81 M;  3RYF B;  2CVL A;  3HAX D;  2JNB A;  4O2B A;  2OTM A;  2UYN A;  4TV8 B;  3I55 F;  2LBX A;  2QTP A;  4YJ3 A;  3C8L A;  2HP0 A;  1VHA A;  4BVS A;  1VQK F;  5DCV A;  1GO1 A;  3EOR A;  5KMG B;  5FNV B;  3NVK E;  3IKE A;  5IJ0 B;  2DYY A;  5FJ4 C;  1W5B A;  3LWP C;  3KJJ A;  3NMU C;  3PLA C;  3HTN A;  2OTJ F;  2RHL A;  3F0E A;  5LA6 B;  2CHS A;  5HP8 A;  3MDO A;  2UZH A;  5JH7 A;  1IV4 A;  4YJ2 B;  2ZAU A;  2RHH A;  3CYP B;  1KC8 H;  3JAK A;  3P4E A;  1QAH A;  5LOV B;  3BYQ A;  1Z5W A;  2CHT A;  2H8C A;  1FFX A;  3JAW A;  3IR9 A;  4ZHY B;  3MCQ A;  2YXZ A;  4FFB B;  5G4U C;  1U40 A;  4O4H B;  4C8I A;  3N2G B;  1W3E X;  3VYS C;  3QTY A;  4C4W C;  3CCV F;  4ZOL B;  3LYB A;  5JH7 B;  3CC4 F;  3VI6 A;  5GAP K;  4X3L A;  1N8R H;  5EO3 A;  3S0W A;  5HY4 A;  2ZOD A;  1JN1 A;  4X1K A;  2G9I A;  1KNJ A;  1NQ3 A;  2MQE A;  2R6R 1;  3NVI B;  1VQN F;  3HKD A;  5HXU A;  1OFU A;  3KIZ A;  1YHQ F;  4BY9 D;  1VQ7 F;  2BO1 A;  3HKE A;  5GON A;  4B5C A;  3RYC B;  1NMU B;  2HQS C;  3L7Q A;  3Q8H A;  4KWE A;  4BW0 B; 
#chains in the Genus database with same CATH homology
 3J80 M;  3OW2 F;  3SIV A;  3NK6 A;  3CCJ F;  4NQ3 A;  3VMF B;  2ALE A;  3G6E F;  1VQO F;  5HWE A;  3N4Y A;  5FLX M;  3CCQ F;  3CCS F;  3E20 B;  4BVR A;  1W2B F;  1Q7Y H;  3OBW A;  4EI8 A;  2OTL F;  3MCA B;  2LBW A;  3RA6 A;  5HXZ A;  5HY1 A;  1VQ8 F;  1IPA A;  1CK2 A;  3PAF A;  1XBI A;  2OZB A;  3AGK A;  1H7M A;  3NK7 A;  5GIN C;  1W40 A;  2VGN A;  1VQL F;  3LFO A;  1YI2 F;  1K9M H;  3J81 M;  3CD6 F;  2HVY D;  2FGY A;  3I56 F;  3O85 A;  1ZWZ A;  2JNB A;  2QEX F;  3HAX D;  1VQ4 F;  3G4S F;  3I55 F;  3CCR F;  2LBX A;  1Q86 H;  1VQP F;  3CPQ A;  1KQS F;  1E7K A;  5EWR A;  4BVS A;  5GIP C;  1K8A H;  1VQK F;  2WAL A;  5GIO C;  5DCV A;  3RA5 A;  1GO1 A;  2QI2 A;  3LWV C;  3NVK E;  3CCU F;  5FJ4 C;  5HY2 A;  3LWP C;  2FC3 A;  3NMU C;  1X52 A;  4NUT A;  3PLA C;  3HJW C;  2OTJ F;  2KG4 A;  3D00 A;  1DT9 A;  1YIJ F;  3CG6 A;  2KTV A;  4BVT A;  1KC8 H;  1YIT F;  1GO0 A;  2GLZ A;  1GZ0 A;  2I6D A;  3CME F;  3JCM M;  4X3M A;  3V7E A;  3ON1 A;  1X7O A;  2OHW A;  1CN7 A;  3WXM B;  2AIF A;  3GYQ A;  2CZW A;  3IR9 A;  1T0K B;  1Q81 H;  5IT9 M;  3V3T A;  3SIU A;  5G4U C;  3CXC F;  1YJ9 F;  1W3E X;  3CCM F;  1NJI H;  2F9Z C;  1YJW F;  4C4W C;  3CMA F;  1M90 H;  1W41 A;  3CCV F;  2KTU A;  1JJ2 F;  4XCQ A;  3CC4 F;  4TZZ A;  2QA4 F;  3VI6 A;  5GAP K;  3LWO C;  1S72 F;  1Q82 H;  2VGM A;  4X3L A;  3E1Y A;  5EO3 A;  1N8R H;  4BVQ A;  1QVF F;  5GAN K;  4EI9 A;  5HY4 A;  3CCE F;  3LWR C;  3OBY A;  3G71 F;  1RA4 A;  3V7Q A;  4EI7 A;  3LWQ C;  3JAM M;  1YJN F;  1PXW A;  1SDS A;  1W42 A;  5G4V C;  1VQM F;  1VQ9 F;  3NVI B;  5A2Q M;  3FFM A;  1VQN F;  5HXU A;  4LCK A;  1YHQ F;  1VQ6 F;  4BY9 D;  1K73 H;  1VQ7 F;  3N4Z A;  1RLG A;  2BO1 A;  5HY0 A;  1X7P A;  1M1K H;  3CPW F;  3J7A R;  1NMU B;  1KD1 H;  1VQ5 F;  3CC2 F;  1QVG F;  3CC7 F;  3CCL F;  4BW0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...