5HY0A

Orotic acid hydrolase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
377
structure length
362
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVTSMCWSNDASALGVAVALGEVKRDLVADDRIRFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNHMGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
total genus 110
structure length 362
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A01
4NQ3A 4BVRA 4BVTA 4BVSA 5HWEA 5HY4A 5HXUA 5HY0A 4BVQA 5HXZA 5HY2A 5HY1A
chains in the Genus database with same CATH superfamily
1H7MA 2DT4A 2H8CA 4O4JA 3IEQA 2RHOA 3GYQA 5EO3A 1R1MA 1TVKA 3CPWF 3QTYA 1IV2A 3P10A 5GIOC 4RQOA 4F6RA 3CCMF 3LFOA 3L7QA 4G88A 4TV9A 5CB4A 3ZOPA 4IHJB 3N2GB 3K2XA 4FFBA 1JN1A 2BTUA 1FFXB 3JCMM 2KG4A 4BT3A 2BTOA 3C8LA 2EWCA 3GHZA 2HS4A 5IYZA 2FGYA 3F6MA 3O85A 2PHNA 3WPWA 4ZHYB 5HY1A 3HKDB 2HP3A 1T0KB 1UI9A 1U3LA 1KQSF 4ZI7B 5CA1A 3ZP4A 4NWOB 1M1KH 5LA6B 2DYYA 4DRXB 2F9ZC 5HY2A 5EB0A 2Z1UA 4IHJA 4X1KB 3CYPB 1ONIA 2H8EA 5IYZB 5HXZA 4C4WC 3N2KA 5KMGB 1VQ6F 4O2BB 1X52A 3K14A 3ELCA 3MQWA 3RYHA 1H48A 1NMUB 1FSZA 3RA5A 5J2TA 4C81A 3BYQA 3SIVA 1W55A 4PWTA 1W59A 3LWRC 3C9RA 5CA0B 2Q1XA 2ZODA 2KTVA 4TV8B 4B62A 4BVTA 1QVFF 4M8IA 5IJ0A 1NQ3A 3CG6A 2NMUA 4ZK7A 5LOVB 2ZVZA 3ON1A 4DRXA 2K1SA 5BMVA 3NMUC 1JJ2F 5JH7B 3KIZA 4I50A 4BT7A 3JASA 1YIJF 4BVQA 4WBNB 2W8BC 3RYHB 1SA0A 3MBMA 4R40B 3WJPA 2I6DA 4EI7A 3FBAA 3HKEB 5KX5B 4YJ3B 3E22B 5LYJB 1RLGA 4LNUB 4BY9D 5FNVB 3NVKE 3HKCA 1S72F 3WXMB 5JCOA 3OBYA 4ZHQA 1W2BF 2HP0B 1K9MH 2ALEA 1W5BA 3JATB 2ZVYA 1KD1H 1W57A 3CC7F 1YJNF 5G4VC 4FFBB 4BVRA 1RQ2A 2G9IA 2HRUA 5DCVA 3S0WA 2R6R1 3LWQC 1VHAA 3OW2F 2CSLA 2UYNA 1W3EX 2BO1A 5HP8A 4BT6A 1XHOA 3I55F 5IJ9A 2VAWA 5HY4A 1VQ4F 3HWUA 1Q82H 4LCKA 2B33A 2HVYD 1JD1A 5ITZB 3EORA 3P4EA 3D54A 3E1YA 4KWEA 3C9SA 1QU9A 3IR9A 4G4ZA 5IJ9B 5J2UA 5EAZA 3KE1A 3HKBA 4DXDA 1CLIA 2LBXA 1UFYA 2UYKA 2CZWA 5FLXM 4HNAA 1X7PA 1ZWZA 2YXZA 5JVDB 3F0EA 4I4TB 3J7AR 1W40A 5FJ4C 4O4LA 3M4SA 1CN7A 3VCZA 1Q81H 2OTMA 3GTZA 3UT5B 5EB1B 5J2TB 3JAKA 2L26A 3QUWA 3VYTC 4NUTA 3F0GA 3RYCA 2CHTA 1CK2A 5J2UB 3I56F 3WGMA 4C8IA 3VOBA 1PF5A 4O4HB 2VGNA 4YJ2A 1GX1A 5LXTB 1X7OA 5LXTA 2ZOVA 5HWEA 5EIBC 3S03A 2Q1YA 3K12A 4BW0B 3JATA 1FFXA 2QTPA 1VK3A 5C8YA 5HY0A 3CD6F 1VQ5F 2MQEA 5IT9M 5LOVA 3RYFB 3F0FA 3WJQA 3FD6A 4LNUA 4X3LA 5EYPA 3VI6A 5GIPC 3SIUA 5JCOC 3HKEA 3PLAC 5JH7A 3CXCF 1PXWA 2RHHA 3J81M 2Z1TA 4WBNA 1DT9A 3HAXD 3FPIA 1W5FA 4O4JB 1YGYA 2LBWA 2IAFA 1N8RH 2HX0A 1GZ0A 1IV4A 4X1IA 3M84A 5LYJA 1XRGA 5IJ0B 5B8FA 2H6LA 1YHQF 1IPAA 4C8GA 3CCEF 2RHJA 1Z5VA 3LDTA 3MCAB 3MDOA 1VQLF 4X1YB 2ZAUA 1KC8H 3D00A 5BMVB 3MCQA 3CC2F 3CCSF 2YYEA 2HS0A 5HXUA 1QD9A 2HS3A 4ZOLB 2CHSA 3ERNA 5LP6A 5GINC 1ODEA 2HRYA 4IIJB 3WGNA 3S02A 2AIZP 3I7TA 1H47A 3I3FA 2LCAA 4EB6A 1K73H 2QI2A 4BT5A 2I6RA 4XCQA 1YJWF 1VQOF 1IV1A 4U3JB 3V7QA 3WJRA 2VGMA 2HP0A 3CYQA 3CCRF 1RA4A 4O2AB 3KJKA 2UYNB 3IKEA 4O4IA 4TZZA 3N2GA 2OHWA 3TD4A 3NK6A 5LA6A 5KX5A 4O2AA 2OTLF 4IIJA 3CCVF 1NJIH 4G4WA 1W5AA 1W41A 3V3TA 4X3MA 2LBTA 1QAHA 3CC4F 2VAMA 3CCQF 2QA4F 1RQ7A 2R751 3HKCB 1DBFA 4ZHWA 3JALA 3Q8HA 4HNAB 1T0AA 2AIFA 3K0TA 2HQSC 2IG8A 2ZF8A 3HKBB 1TVKB 3JASB 2OTJF 3G71F 1W5EA 3T80A 4E6EA 3FFMA 4TV9B 5LP6C 3C9UA 2BTQB 5CB4B 4I4TA 3WGJA 1TUBB 4O2BA 3N2KB 5A2QM 5KMGA 3JARB 1M90H 3OBWA 3IKFA 3WGKA 3RYIB 2WALA 3RYIA 1OFUA 4ERHA 3JALB 4U39A 1FNKA 3DDNA 5EIBD 3RE3A 1X25A 3CCJF 5G4UC 3LWVC 3IMPA 5C8YB 2CVLA 5ITZA 3QHDA 4B45A 2RHLA 1YQNA 5EZYB 4NQ3A 3ESJA 3HKDA 3RYFA 1COMA 3DC2A 1JY8A 2P6YA 1Q8RA 1VQVA 2GLZA 3E20B 4O4HA 1YI2F 3RA6A 3VYSC 4O4IB 3ZP7A 3JAWA 1VH8A 4ZI7A 5CA1B 5MN5A 2Z1EA 2Z01A 3VTIC 3AGKA 5EYPB 1VQ9F 3G6EF 1KNKA 1GO1A 4ZHVA 3U0OA 4X20B 1Q86H 3G4SF 5JQGA 3LMEA 3S0HA 1J7HA 1W581 2VXYA 3TD3A 2GVIA 3VMFB 5MN4A 4BVSA 4EI8A 4YJ2B 1OAPA 3N4YA 4U3JA 3CCUF 3B6NA 3UT5A 1E7KA 4BT4A 3P0ZA 5JVDA 2N48A 1KNJA 3V4DA 3LWOC 1K8AH 1VQMF 2CWJA 1XBIA 4I55B 5GONB 3JVHA 2IQQA 3ZO8A 4ZOLA 2CW4A 4X1IB 3NVIB 3VO8A 3M1XA 3S06A 3JAMM 3KJJA 3LYBA 4I55A 5GONA 4C8EA 5CA0A 2QEXF 3CPQA 5GAPK 3J80M 3PAFA 4EI9A 1U3PA 3NK7A 2OZBA 1Q7YH 1GO0A 2KGWA 4ZHQB 2KTUA 1Z5WA 2Z1FA 3C9TA 1SDSA 5HP7A 3CCLF 3V7EA 3R0PA 4X1KA 3KHNA 1VQNF 2UZHA 3WPXA 1IV3A 3VYUC 1JFFB 3VIUA 1U40A 2AMTA 2GZLA 3VOAA 1RLUA 1SA0B 1VQPF 4G4VA 2UYJA 5GANK 3IEWA 4G4YA 4RHAA 5FNVA 4B46A 1YITF 5JQGB 3D01A 1YJ9F 4X20A 4YJ3A 3F0DA 3RYCB 3FD5A 4F6RB 1W42A 3HJWC 3E22A 1VQ8F 1SZQA 1FNJA 1VQ7F 3CMEF 4I50B 2FC3A 2V9YA 4TV8A 5EZYA 4O4LB 1JFFA 4X1YA 3OONA 3JAWB 3HTNA 2RB9A 2UYPA 2VAPA 3CB2A 5EWRA 3TD5A 3N4ZA 5MN6A 1QVGF 4C82A 3CMAF 1XV2A 4BT2A 1U43A 3WGLA 3LWPC 4EB6B 4TUYB 2JNBA 4TUYA 3S0YA 1TUBA 5AVMA 5LP6B 3JAKB 1VQKF 4B5CA 3JARA 4G4XA 2PMPA
chains in the Genus database with same CATH topology
1H7MA 2ALEA 3MCAB 1VQLF 3GYQA 5EO3A 1KD1H 3AGKA 1KC8H 1YJNF 3CC7F 3D00A 5G4VC 3CC2F 3G6EF 3CPWF 3CCSF 4BVRA 1VQ9F 1GO1A 5HXUA 5DCVA 5GIOC 1Q86H 3G4SF 5GINC 3LWQC 3OW2F 3CCMF 3LFOA 1K73H 2QI2A 1W3EX 2BO1A 3VMFB 4XCQA 1YJWF 4BVSA 3I55F 5HY4A 4EI8A 1VQ4F 1Q82H 1VQOF 3N4YA 4LCKA 3JCMM 3CCUF 1E7KA 2HVYD 2KG4A 3V7QA 2VGMA 3CCRF 3E1YA 1RA4A 3LWOC 1K8AH 1VQMF 3IR9A 1XBIA 2FGYA 4TZZA 2OHWA 3NK6A 5FLXM 2LBXA 2CZWA 3NVIB 3O85A 5HY1A 1X7PA 2OTLF 3JAMM 1ZWZA 3J7AR 2QEXF 3CCVF 1NJIH 1T0KB 1W40A 3CPQA 5GAPK 3J80M 5FJ4C 1CN7A 1W41A 1KQSF 3PAFA 3V3TA 4EI9A 4X3MA 1Q81H 3CC4F 3CCQF 3NK7A 1M1KH 2QA4F 2OZBA 1Q7YH 2F9ZC 5HY2A 4NUTA 1GO0A 1CK2A 2KTUA 5HXZA 3I56F 4C4WC 2AIFA 1SDSA 3CCLF 3V7EA 1VQ6F 1X52A 1VQNF 1NMUB 2VGNA 3RA5A 2OTJF 3G71F 1X7OA 3SIVA 5HWEA 3FFMA 3LWRC 4BW0B 1VQPF 2KTVA 5GANK 4BVTA 5A2QM 1YITF 1M90H 5HY0A 1QVFF 3CG6A 3OBWA 3CD6F 2WALA 1YJ9F 1VQ5F 5IT9M 1W42A 3ON1A 3HJWC 4X3LA 3VI6A 5GIPC 3SIUA 3NMUC 1JJ2F 3CCJF 1VQ8F 5G4UC 1VQ7F 3LWVC 3CMEF 3PLAC 2FC3A 3CXCF 1PXWA 3J81M 1YIJF 4BVQA 1DT9A 3HAXD 5EWRA 4NQ3A 2LBWA 3N4ZA 1N8RH 1QVGF 2I6DA 4EI7A 3CMAF 1GZ0A 3LWPC 3E20B 2GLZA 1YI2F 1RLGA 4BY9D 3RA6A 3NVKE 2JNBA 1S72F 3WXMB 3OBYA 1YHQF 1IPAA 1VQKF 1W2BF 1K9MH 3CCEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ3 A;  4BVR A;  4BVT A;  4BVS A;  5HWE A;  5HY4 A;  5HXU A;  5HY0 A;  4BVQ A;  5HXZ A;  5HY2 A;  5HY1 A; 
#chains in the Genus database with same CATH topology
 1H7M A;  2DT4 A;  2H8C A;  4O4J A;  3IEQ A;  2RHO A;  3GYQ A;  5EO3 A;  1R1M A;  1TVK A;  3CPW F;  3QTY A;  1IV2 A;  3P10 A;  5GIO C;  4RQO A;  4F6R A;  3CCM F;  3LFO A;  3L7Q A;  4G88 A;  4TV9 A;  5CB4 A;  3ZOP A;  4IHJ B;  3N2G B;  3K2X A;  4FFB A;  1JN1 A;  2BTU A;  1FFX B;  3JCM M;  2KG4 A;  4BT3 A;  2BTO A;  3C8L A;  2EWC A;  3GHZ A;  2HS4 A;  5IYZ A;  2FGY A;  3F6M A;  3O85 A;  2PHN A;  3WPW A;  4ZHY B;  5HY1 A;  3HKD B;  2HP3 A;  1T0K B;  1UI9 A;  1U3L A;  1KQS F;  4ZI7 B;  5CA1 A;  3ZP4 A;  4NWO B;  1M1K H;  5LA6 B;  2DYY A;  4DRX B;  2F9Z C;  5HY2 A;  5EB0 A;  2Z1U A;  4IHJ A;  4X1K B;  3CYP B;  1ONI A;  2H8E A;  5IYZ B;  5HXZ A;  4C4W C;  3N2K A;  5KMG B;  1VQ6 F;  4O2B B;  1X52 A;  3K14 A;  3ELC A;  3MQW A;  3RYH A;  1H48 A;  1NMU B;  1FSZ A;  3RA5 A;  5J2T A;  4C81 A;  3BYQ A;  3SIV A;  1W55 A;  4PWT A;  1W59 A;  3LWR C;  3C9R A;  5CA0 B;  2Q1X A;  2ZOD A;  2KTV A;  4TV8 B;  4B62 A;  4BVT A;  1QVF F;  4M8I A;  5IJ0 A;  1NQ3 A;  3CG6 A;  2NMU A;  4ZK7 A;  5LOV B;  2ZVZ A;  3ON1 A;  4DRX A;  2K1S A;  5BMV A;  3NMU C;  1JJ2 F;  5JH7 B;  3KIZ A;  4I50 A;  4BT7 A;  3JAS A;  1YIJ F;  4BVQ A;  4WBN B;  2W8B C;  3RYH B;  1SA0 A;  3MBM A;  4R40 B;  3WJP A;  2I6D A;  4EI7 A;  3FBA A;  3HKE B;  5KX5 B;  4YJ3 B;  3E22 B;  5LYJ B;  1RLG A;  4LNU B;  4BY9 D;  5FNV B;  3NVK E;  3HKC A;  1S72 F;  3WXM B;  5JCO A;  3OBY A;  4ZHQ A;  1W2B F;  2HP0 B;  1K9M H;  2ALE A;  1W5B A;  3JAT B;  2ZVY A;  1KD1 H;  1W57 A;  3CC7 F;  1YJN F;  5G4V C;  4FFB B;  4BVR A;  1RQ2 A;  2G9I A;  2HRU A;  5DCV A;  3S0W A;  2R6R 1;  3LWQ C;  1VHA A;  3OW2 F;  2CSL A;  2UYN A;  1W3E X;  2BO1 A;  5HP8 A;  4BT6 A;  1XHO A;  3I55 F;  5IJ9 A;  2VAW A;  5HY4 A;  1VQ4 F;  3HWU A;  1Q82 H;  4LCK A;  2B33 A;  2HVY D;  1JD1 A;  5ITZ B;  3EOR A;  3P4E A;  3D54 A;  3E1Y A;  4KWE A;  3C9S A;  1QU9 A;  3IR9 A;  4G4Z A;  5IJ9 B;  5J2U A;  5EAZ A;  3KE1 A;  3HKB A;  4DXD A;  1CLI A;  2LBX A;  1UFY A;  2UYK A;  2CZW A;  5FLX M;  4HNA A;  1X7P A;  1ZWZ A;  2YXZ A;  5JVD B;  3F0E A;  4I4T B;  3J7A R;  1W40 A;  5FJ4 C;  4O4L A;  3M4S A;  1CN7 A;  3VCZ A;  1Q81 H;  2OTM A;  3GTZ A;  3UT5 B;  5EB1 B;  5J2T B;  3JAK A;  2L26 A;  3QUW A;  3VYT C;  4NUT A;  3F0G A;  3RYC A;  2CHT A;  1CK2 A;  5J2U B;  3I56 F;  3WGM A;  4C8I A;  3VOB A;  1PF5 A;  4O4H B;  2VGN A;  4YJ2 A;  1GX1 A;  5LXT B;  1X7O A;  5LXT A;  2ZOV A;  5HWE A;  5EIB C;  3S03 A;  2Q1Y A;  3K12 A;  4BW0 B;  3JAT A;  1FFX A;  2QTP A;  1VK3 A;  5C8Y A;  5HY0 A;  3CD6 F;  1VQ5 F;  2MQE A;  5IT9 M;  5LOV A;  3RYF B;  3F0F A;  3WJQ A;  3FD6 A;  4LNU A;  4X3L A;  5EYP A;  3VI6 A;  5GIP C;  3SIU A;  5JCO C;  3HKE A;  3PLA C;  5JH7 A;  3CXC F;  1PXW A;  2RHH A;  3J81 M;  2Z1T A;  4WBN A;  1DT9 A;  3HAX D;  3FPI A;  1W5F A;  4O4J B;  1YGY A;  2LBW A;  2IAF A;  1N8R H;  2HX0 A;  1GZ0 A;  1IV4 A;  4X1I A;  3M84 A;  5LYJ A;  1XRG A;  5IJ0 B;  5B8F A;  2H6L A;  1YHQ F;  1IPA A;  4C8G A;  3CCE F;  2RHJ A;  1Z5V A;  3LDT A;  3MCA B;  3MDO A;  1VQL F;  4X1Y B;  2ZAU A;  1KC8 H;  3D00 A;  5BMV B;  3MCQ A;  3CC2 F;  3CCS F;  2YYE A;  2HS0 A;  5HXU A;  1QD9 A;  2HS3 A;  4ZOL B;  2CHS A;  3ERN A;  5LP6 A;  5GIN C;  1ODE A;  2HRY A;  4IIJ B;  3WGN A;  3S02 A;  2AIZ P;  3I7T A;  1H47 A;  3I3F A;  2LCA A;  4EB6 A;  1K73 H;  2QI2 A;  4BT5 A;  2I6R A;  4XCQ A;  1YJW F;  1VQO F;  1IV1 A;  4U3J B;  3V7Q A;  3WJR A;  2VGM A;  2HP0 A;  3CYQ A;  3CCR F;  1RA4 A;  4O2A B;  3KJK A;  2UYN B;  3IKE A;  4O4I A;  4TZZ A;  3N2G A;  2OHW A;  3TD4 A;  3NK6 A;  5LA6 A;  5KX5 A;  4O2A A;  2OTL F;  4IIJ A;  3CCV F;  1NJI H;  4G4W A;  1W5A A;  1W41 A;  3V3T A;  4X3M A;  2LBT A;  1QAH A;  3CC4 F;  2VAM A;  3CCQ F;  2QA4 F;  1RQ7 A;  2R75 1;  3HKC B;  1DBF A;  4ZHW A;  3JAL A;  3Q8H A;  4HNA B;  1T0A A;  2AIF A;  3K0T A;  2HQS C;  2IG8 A;  2ZF8 A;  3HKB B;  1TVK B;  3JAS B;  2OTJ F;  3G71 F;  1W5E A;  3T80 A;  4E6E A;  3FFM A;  4TV9 B;  5LP6 C;  3C9U A;  2BTQ B;  5CB4 B;  4I4T A;  3WGJ A;  1TUB B;  4O2B A;  3N2K B;  5A2Q M;  5KMG A;  3JAR B;  1M90 H;  3OBW A;  3IKF A;  3WGK A;  3RYI B;  2WAL A;  3RYI A;  1OFU A;  4ERH A;  3JAL B;  4U39 A;  1FNK A;  3DDN A;  5EIB D;  3RE3 A;  1X25 A;  3CCJ F;  5G4U C;  3LWV C;  3IMP A;  5C8Y B;  2CVL A;  5ITZ A;  3QHD A;  4B45 A;  2RHL A;  1YQN A;  5EZY B;  4NQ3 A;  3ESJ A;  3HKD A;  3RYF A;  1COM A;  3DC2 A;  1JY8 A;  2P6Y A;  1Q8R A;  1VQV A;  2GLZ A;  3E20 B;  4O4H A;  1YI2 F;  3RA6 A;  3VYS C;  4O4I B;  3ZP7 A;  3JAW A;  1VH8 A;  4ZI7 A;  5CA1 B;  5MN5 A;  2Z1E A;  2Z01 A;  3VTI C;  3AGK A;  5EYP B;  1VQ9 F;  3G6E F;  1KNK A;  1GO1 A;  4ZHV A;  3U0O A;  4X20 B;  1Q86 H;  3G4S F;  5JQG A;  3LME A;  3S0H A;  1J7H A;  1W58 1;  2VXY A;  3TD3 A;  2GVI A;  3VMF B;  5MN4 A;  4BVS A;  4EI8 A;  4YJ2 B;  1OAP A;  3N4Y A;  4U3J A;  3CCU F;  3B6N A;  3UT5 A;  1E7K A;  4BT4 A;  3P0Z A;  5JVD A;  2N48 A;  1KNJ A;  3V4D A;  3LWO C;  1K8A H;  1VQM F;  2CWJ A;  1XBI A;  4I55 B;  5GON B;  3JVH A;  2IQQ A;  3ZO8 A;  4ZOL A;  2CW4 A;  4X1I B;  3NVI B;  3VO8 A;  3M1X A;  3S06 A;  3JAM M;  3KJJ A;  3LYB A;  4I55 A;  5GON A;  4C8E A;  5CA0 A;  2QEX F;  3CPQ A;  5GAP K;  3J80 M;  3PAF A;  4EI9 A;  1U3P A;  3NK7 A;  2OZB A;  1Q7Y H;  1GO0 A;  2KGW A;  4ZHQ B;  2KTU A;  1Z5W A;  2Z1F A;  3C9T A;  1SDS A;  5HP7 A;  3CCL F;  3V7E A;  3R0P A;  4X1K A;  3KHN A;  1VQN F;  2UZH A;  3WPX A;  1IV3 A;  3VYU C;  1JFF B;  3VIU A;  1U40 A;  2AMT A;  2GZL A;  3VOA A;  1RLU A;  1SA0 B;  1VQP F;  4G4V A;  2UYJ A;  5GAN K;  3IEW A;  4G4Y A;  4RHA A;  5FNV A;  4B46 A;  1YIT F;  5JQG B;  3D01 A;  1YJ9 F;  4X20 A;  4YJ3 A;  3F0D A;  3RYC B;  3FD5 A;  4F6R B;  1W42 A;  3HJW C;  3E22 A;  1VQ8 F;  1SZQ A;  1FNJ A;  1VQ7 F;  3CME F;  4I50 B;  2FC3 A;  2V9Y A;  4TV8 A;  5EZY A;  4O4L B;  1JFF A;  4X1Y A;  3OON A;  3JAW B;  3HTN A;  2RB9 A;  2UYP A;  2VAP A;  3CB2 A;  5EWR A;  3TD5 A;  3N4Z A;  5MN6 A;  1QVG F;  4C82 A;  3CMA F;  1XV2 A;  4BT2 A;  1U43 A;  3WGL A;  3LWP C;  4EB6 B;  4TUY B;  2JNB A;  4TUY A;  3S0Y A;  1TUB A;  5AVM A;  5LP6 B;  3JAK B;  1VQK F;  4B5C A;  3JAR A;  4G4X A;  2PMP A; 
#chains in the Genus database with same CATH homology
 1H7M A;  2ALE A;  3MCA B;  1VQL F;  3GYQ A;  5EO3 A;  1KD1 H;  3AGK A;  1KC8 H;  1YJN F;  3CC7 F;  3D00 A;  5G4V C;  3CC2 F;  3G6E F;  3CPW F;  3CCS F;  4BVR A;  1VQ9 F;  1GO1 A;  5HXU A;  5DCV A;  5GIO C;  1Q86 H;  3G4S F;  5GIN C;  3LWQ C;  3OW2 F;  3CCM F;  3LFO A;  1K73 H;  2QI2 A;  1W3E X;  2BO1 A;  3VMF B;  4XCQ A;  1YJW F;  4BVS A;  3I55 F;  5HY4 A;  4EI8 A;  1VQ4 F;  1Q82 H;  1VQO F;  3N4Y A;  4LCK A;  3JCM M;  3CCU F;  1E7K A;  2HVY D;  2KG4 A;  3V7Q A;  2VGM A;  3CCR F;  3E1Y A;  1RA4 A;  3LWO C;  1K8A H;  1VQM F;  3IR9 A;  1XBI A;  2FGY A;  4TZZ A;  2OHW A;  3NK6 A;  5FLX M;  2LBX A;  2CZW A;  3NVI B;  3O85 A;  5HY1 A;  1X7P A;  2OTL F;  3JAM M;  1ZWZ A;  3J7A R;  2QEX F;  3CCV F;  1NJI H;  1T0K B;  1W40 A;  3CPQ A;  5GAP K;  3J80 M;  5FJ4 C;  1CN7 A;  1W41 A;  1KQS F;  3PAF A;  3V3T A;  4EI9 A;  4X3M A;  1Q81 H;  3CC4 F;  3CCQ F;  3NK7 A;  1M1K H;  2QA4 F;  2OZB A;  1Q7Y H;  2F9Z C;  5HY2 A;  4NUT A;  1GO0 A;  1CK2 A;  2KTU A;  5HXZ A;  3I56 F;  4C4W C;  2AIF A;  1SDS A;  3CCL F;  3V7E A;  1VQ6 F;  1X52 A;  1VQN F;  1NMU B;  2VGN A;  3RA5 A;  2OTJ F;  3G71 F;  1X7O A;  3SIV A;  5HWE A;  3FFM A;  3LWR C;  4BW0 B;  1VQP F;  2KTV A;  5GAN K;  4BVT A;  5A2Q M;  1YIT F;  1M90 H;  5HY0 A;  1QVF F;  3CG6 A;  3OBW A;  3CD6 F;  2WAL A;  1YJ9 F;  1VQ5 F;  5IT9 M;  1W42 A;  3ON1 A;  3HJW C;  4X3L A;  3VI6 A;  5GIP C;  3SIU A;  3NMU C;  1JJ2 F;  3CCJ F;  1VQ8 F;  5G4U C;  1VQ7 F;  3LWV C;  3CME F;  3PLA C;  2FC3 A;  3CXC F;  1PXW A;  3J81 M;  1YIJ F;  4BVQ A;  1DT9 A;  3HAX D;  5EWR A;  4NQ3 A;  2LBW A;  3N4Z A;  1N8R H;  1QVG F;  2I6D A;  4EI7 A;  3CMA F;  1GZ0 A;  3LWP C;  3E20 B;  2GLZ A;  1YI2 F;  1RLG A;  4BY9 D;  3RA6 A;  3NVK E;  2JNB A;  1S72 F;  3WXM B;  3OBY A;  1YHQ F;  1IPA A;  1VQK F;  1W2B F;  1K9M H;  3CCE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...