5HY0A

Orotic acid hydrolase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
377
structure length
362
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVTSMCWSNDASALGVAVALGEVKRDLVADDRIRFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNHMGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
total genus 110
structure length 362
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A01
4BVQA 5HWEA 5HXUA 5HXZA 5HY0A 5HY1A 5HY2A 5HY4A 4BVSA 4NQ3A 4BVTA 4BVRA
chains in the Genus database with same CATH superfamily
1RLUA 5GIOC 2RHOA 3WGMA 3LMEA 1W55A 5BMVB 2UYKA 3VIUA 4ZOLA 1W5AA 2CWJA 3V4DA 3NK7A 4U39A 1GO1A 2N48A 5DCVA 4ZHYB 3JATA 3RA5A 3EORA 2OTMA 5IT9M 3CMEF 1FNKA 3CCEF 4NUTA 1YHQF 1X7OA 4C81A 4WBNB 5HWEA 1VQ9F 3S0WA 1QD9A 2OTJF 3CYPB 1CN7A 2ZOVA 3SIVA 1VQLF 4DRXB 5JCOC 3RYCB 1Z5WA 3ZP7A 4X3LA 3HKCA 3T80A 4ZOLB 5MN6A 3JAMM 3IKEA 1CLIA 1H7MA 5CB4B 2PMPA 4TV9B 3C9RA 3JAKA 4BT4A 1XBIA 5GANK 1RQ2A 1S72F 3WXMB 5GONA 4ZHQB 1QVGF 4X1IB 4O2BA 1W5BA 2VXYA 5EIBC 3ZP4A 4BT7A 2HS4A 3G6EF 4O4LB 4U3JA 1VQ5F 1JY8A 3JASA 5LOVB 2UYNB 3KHNA 1KNKA 3C9SA 1TUBA 3CG6A 3WPXA 1W581 3MCQA 1VQ4F 3N2KB 5EZYA 2Q1XA 2OTLF 2F9ZC 1COMA 3R0PA 3HKBA 1FFXA 1IV3A 1PF5A 2VAPA 2ALEA 1YJ9F 2Z1EA 1SA0B 1YJNF 2H6LA 4ZHVA 2W8BC 3JAWB 2HQSC 1JFFA 4EI7A 3WGLA 2GZLA 1VK3A 1IV4A 1JFFB 4B5CA 1GO0A 5J2UB 3TD5A 1W5EA 2RB9A 4BVTA 2HP3A 2FGYA 3OW2F 1Q86H 1X25A 3CCVF 3NMUC 1J7HA 3P0ZA 2HS3A 1FFXB 3K2XA 4YJ3B 3JARB 4DXDA 3MQWA 5FJ4C 3S0HA 3VYSC 3VOBA 3MDOA 3FPIA 1W57A 4B45A 3RA6A 3N2GA 5MN5A 3HWUA 4C8GA 1YQNA 3CCQF 5FNVB 2R751 3JALB 3D00A 1NQ3A 2YXZA 3OBWA 3CCSF 3RYHA 4XCQA 3C9UA 5HY4A 4R40B 5HP7A 4IHJA 3I55F 3N2KA 3VMFB 1W41A 4ERHA 3P4EA 2AIFA 5ITZA 2RHLA 4NWOB 1GX1A 2CSLA 3F0FA 3IMPA 5JH7B 2DYYA 3JASB 3D54A 3NK6A 5KX5A 4I50A 2ZAUA 5LP6B 2Z1UA 2Z01A 5IYZA 4BVSA 2ZVZA 4RQOA 1Q8RA 1H47A 4FFBA 5HY0A 1TVKA 5EWRA 3TD3A 4BVQA 5J2TA 2EWCA 3RYCA 3CCLF 1Q7YH 1QU9A 1TVKB 5HXUA 4DRXA 3P10A 3UT5A 4F6RB 1VQMF 1VQ6F 4EI8A 1QVFF 3N4ZA 3S02A 3DC2A 2L26A 2MQEA 5KX5B 3ELCA 3JAKB 4LCKA 5EYPB 3LYBA 4I4TB 5C8YA 5LXTA 2YYEA 1VQKF 4LNUA 3OBYA 3E22A 2VAMA 2KTUA 3LFOA 3QTYA 3GHZA 1Q82H 3HKDA 3WGJA 1U43A 1YIJF 2OHWA 2HP0B 2GLZA 2GVIA 3I7TA 1X7PA 2HS0A 3Q8HA 5J2UA 5FLXM 4BVRA 5JVDA 3JALA 3FD5A 3RYFA 3M84A 1U3LA 2FC3A 4I55B 1T0KB 1YJWF 5JQGA 3V7EA 5ITZB 3JAWA 3QUWA 1SZQA 3HKEB 1W5FA 2Z1FA 4G4ZA 2P6YA 1XRGA 3WJRA 3CXCF 2BTQB 1W2BF 3LWOC 5CA0B 3CB2A 4BT3A 1Q81H 2UYNA 1Z5VA 4X1KA 3E1YA 3RYIB 4O4JA 5JVDB 1KD1H 3WGNA 4X1YB 1W42A 2NMUA 4M8IA 3RE3A 4B62A 5KMGB 1VQPF 5HP8A 3F0GA 3K14A 5JCOA 5HY1A 3CCMF 2JNBA 3G4SF 3HKBB 3F6MA 3UT5B 3JCMM 3ZO8A 4TV9A 5GINC 3IEWA 3CPWF 3U0OA 5G4VC 3HKCB 1E7KA 4BT5A 2KGWA 4U3JB 1TUBB 5EYPA 3F0EA 1IV1A 5LOVA 3RYFB 2BTUA 5LA6A 4O4IA 5CA1A 2K1SA 1U3PA 1XHOA 5GONB 2CHSA 3C9TA 3B6NA 5A2QM 4TZZA 3S03A 2UZHA 3CC4F 3HKDB 1VHAA 2CHTA 3FFMA 4TUYA 2I6RA 5LA6B 5EZYB 5CA1B 2Z1TA 1VQ8F 5AVMA 4TV8A 1W3EX 3VYUC 3LWPC 2AIZP 3KJKA 5EB1B 1VQOF 3O85A 5IJ9B 1ZWZA 4BT6A 3CPQA 2BTOA 5LXTB 3IEQA 5B8FA 3PLAC 5HXZA 2RHJA 4IIJB 2V9YA 3PAFA 4TUYB 5IYZB 4O2BB 4FFBB 3ERNA 4I50B 4O4IB 1KQSF 3S0YA 3QHDA 4O4HB 3TD4A 3CMAF 5LYJB 5EAZA 3HJWC 4ZI7A 2UYJA 3WJPA 1YI2F 2QEXF 1KC8H 3K0TA 1DBFA 1IV2A 2IAFA 2CW4A 4TV8B 2HVYD 3NVKE 5EB0A 3MBMA 2HX0A 4BT2A 2VAWA 2LBXA 5KMGA 3KE1A 5LP6A 1NJIH 3WJQA 4EB6A 1K73H 4X20B 1JN1A 3G71F 5JH7A 3JATB 3VYTC 2QI2A 2ZF8A 3BYQA 2H8CA 2IG8A 2IQQA 5IJ0B 2CVLA 4YJ3A 3MCAB 3OONA 4G4VA 1GZ0A 3J81M 4ZHWA 3KIZA 3RYHB 3CCRF 2VGNA 3M4SA 1H48A 2CZWA 4X1YA 5EO3A 4YJ2B 1M90H 2WALA 5IJ0A 3N2GB 3VOAA 3GYQA 4I4TA 1RQ7A 5C8YB 4EB6B 4O4HA 2LBWA 2LCAA 1OAPA 3L7QA 1W40A 2PHNA 2I6DA 2UYPA 4X1IA 5G4UC 5MN4A 1NMUB 3KJJA 1QAHA 3K12A 1IPAA 3JVHA 1YITF 2Q1YA 2OZBA 1RLGA 3AGKA 3S06A 1PXWA 3ON1A 4HNAA 2HRYA 3V3TA 3CYQA 2ZVYA 2B33A 4C8IA 3E22B 5HY2A 2VGMA 1OFUA 4ZI7B 4X20A 2RHHA 3N4YA 3VCZA 3LWRC 3VO8A 4O4LA 3CC2F 5GAPK 4C8EA 3SIUA 1K9MH 2KG4A 3VI6A 4F6RA 2HP0A 3V7QA 1T0AA 4IIJA 4ZHQA 2AMTA 1YGYA 3CCUF 3LWQC 3J80M 5CB4A 3GTZA 3CCJF 1CK2A 5J2TB 4E6EA 2QTPA 2ZODA 2G9IA 3DDNA 4KWEA 5IJ9A 1XV2A 1VQNF 5LP6C 4G88A 4PWTA 3LWVC 4C4WC 1K8AH 1X52A 1U40A 1M1KH 4IHJB 4WBNA 3M1XA 4NQ3A 3CC7F 3FBAA 4O2AB 4G4XA 1ODEA 3HTNA 3I56F 3LDTA 3E20B 1RA4A 3CD6F 1JD1A 3C8LA 2LBTA 1VH8A 1VQVA 3D01A 5CA0A 1ONIA 3F0DA 3IKFA 4G4YA 1FNJA 3J7AR 3JARA 5EIBD 4RHAA 5BMVA 1VQ7F 3WGKA 4B46A 2R6R1 4C82A 1UI9A 5FNVA 4G4WA 2HRUA 2H8EA 2BO1A 1R1MA 4X1KB 1KNJA 4O4JB 4BW0B 4I55A 3IR9A 5GIPC 3I3FA 1SDSA 4HNAB 2KTVA 3HAXD 1UFYA 4ZK7A 3NVIB 3VTIC 1SA0A 4X3MA 2DT4A 3HKEA 3FD6A 1JJ2F 3ESJA 1W59A 3WPWA 1DT9A 3ZOPA 4BY9D 4LNUB 3RYIA 5JQGB 4EI9A 5LYJA 1FSZA 2QA4F 4YJ2A 1N8RH 4O2AA
chains in the Genus database with same CATH topology
1VQPF 1W40A 2I6DA 5HY1A 5GIOC 3OBWA 3CCMF 2JNBA 3CCSF 3G4SF 5G4UC 4XCQA 5HY4A 1NMUB 3I55F 3VMFB 3JCMM 1IPAA 1YITF 2OZBA 1RLGA 1W41A 3AGKA 5GINC 1PXWA 2AIFA 3ON1A 3CPWF 5G4VC 3V3TA 1E7KA 3NK7A 5DCVA 1GO1A 3RA5A 5HY2A 2VGMA 5IT9M 3N4YA 3LWRC 3CC2F 3NK6A 3CMEF 3CCEF 5GAPK 4NUTA 1YHQF 3SIUA 1K9MH 1X7OA 2KG4A 3VI6A 4BVSA 3V7QA 5HWEA 1VQ9F 5HY0A 5A2QM 4TZZA 3CC4F 3FFMA 2OTJF 1CN7A 3SIVA 3CCUF 1VQLF 5EWRA 3LWQC 1VQ8F 3J80M 1W3EX 4BVQA 3LWPC 3CCJF 1CK2A 1VQOF 3O85A 1ZWZA 4X3LA 3CCLF 1Q7YH 3CPQA 3PLAC 1VQNF 3LWVC 4C4WC 5HXUA 5HXZA 3JAMM 1H7MA 1K8AH 1X52A 1M1KH 1XBIA 3PAFA 5GANK 1VQMF 1VQ6F 4NQ3A 3WXMB 4EI8A 1S72F 1QVGF 3CC7F 1QVFF 3N4ZA 1KQSF 4LCKA 3G6EF 3CMAF 3HJWC 3I56F 1VQ5F 3E20B 1YI2F 1RA4A 2QEXF 3OBYA 1VQKF 3CD6F 1KC8H 3CG6A 2KTUA 3LFOA 1VQ4F 2HVYD 3J7AR 3NVKE 2OTLF 2F9ZC 1Q82H 2ALEA 1YIJF 1VQ7F 2OHWA 2GLZA 1YJ9F 2LBXA 1YJNF 1X7PA 1NJIH 5FLXM 4BVRA 2BO1A 1K73H 4EI7A 3G71F 2FC3A 4BW0B 2QI2A 1T0KB 3IR9A 5GIPC 1YJWF 3V7EA 1SDSA 1GO0A 2KTVA 3HAXD 3NVIB 4BVTA 3MCAB 2FGYA 4X3MA 3OW2F 1GZ0A 1Q86H 3CCVF 3J81M 3NMUC 3CXCF 3CCRF 1W2BF 2VGNA 1JJ2F 2CZWA 3LWOC 5FJ4C 5EO3A 1M90H 1DT9A 2WALA 1Q81H 1W42A 4BY9D 3E1YA 3RA6A 3GYQA 4EI9A 2QA4F 2LBWA 1KD1H 3CCQF 1N8RH 3D00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVQ A;  5HWE A;  5HXU A;  5HXZ A;  5HY0 A;  5HY1 A;  5HY2 A;  5HY4 A;  4BVS A;  4NQ3 A;  4BVT A;  4BVR A; 
#chains in the Genus database with same CATH topology
 1RLU A;  5GIO C;  2RHO A;  3WGM A;  3LME A;  1W55 A;  5BMV B;  2UYK A;  3VIU A;  4ZOL A;  1W5A A;  2CWJ A;  3V4D A;  3NK7 A;  4U39 A;  1GO1 A;  2N48 A;  5DCV A;  4ZHY B;  3JAT A;  3RA5 A;  3EOR A;  2OTM A;  5IT9 M;  3CME F;  1FNK A;  3CCE F;  4NUT A;  1YHQ F;  1X7O A;  4C81 A;  4WBN B;  5HWE A;  1VQ9 F;  3S0W A;  1QD9 A;  2OTJ F;  3CYP B;  1CN7 A;  2ZOV A;  3SIV A;  1VQL F;  4DRX B;  5JCO C;  3RYC B;  1Z5W A;  3ZP7 A;  4X3L A;  3HKC A;  3T80 A;  4ZOL B;  5MN6 A;  3JAM M;  3IKE A;  1CLI A;  1H7M A;  5CB4 B;  2PMP A;  4TV9 B;  3C9R A;  3JAK A;  4BT4 A;  1XBI A;  5GAN K;  1RQ2 A;  1S72 F;  3WXM B;  5GON A;  4ZHQ B;  1QVG F;  4X1I B;  4O2B A;  1W5B A;  2VXY A;  5EIB C;  3ZP4 A;  4BT7 A;  2HS4 A;  3G6E F;  4O4L B;  4U3J A;  1VQ5 F;  1JY8 A;  3JAS A;  5LOV B;  2UYN B;  3KHN A;  1KNK A;  3C9S A;  1TUB A;  3CG6 A;  3WPX A;  1W58 1;  3MCQ A;  1VQ4 F;  3N2K B;  5EZY A;  2Q1X A;  2OTL F;  2F9Z C;  1COM A;  3R0P A;  3HKB A;  1FFX A;  1IV3 A;  1PF5 A;  2VAP A;  2ALE A;  1YJ9 F;  2Z1E A;  1SA0 B;  1YJN F;  2H6L A;  4ZHV A;  2W8B C;  3JAW B;  2HQS C;  1JFF A;  4EI7 A;  3WGL A;  2GZL A;  1VK3 A;  1IV4 A;  1JFF B;  4B5C A;  1GO0 A;  5J2U B;  3TD5 A;  1W5E A;  2RB9 A;  4BVT A;  2HP3 A;  2FGY A;  3OW2 F;  1Q86 H;  1X25 A;  3CCV F;  3NMU C;  1J7H A;  3P0Z A;  2HS3 A;  1FFX B;  3K2X A;  4YJ3 B;  3JAR B;  4DXD A;  3MQW A;  5FJ4 C;  3S0H A;  3VYS C;  3VOB A;  3MDO A;  3FPI A;  1W57 A;  4B45 A;  3RA6 A;  3N2G A;  5MN5 A;  3HWU A;  4C8G A;  1YQN A;  3CCQ F;  5FNV B;  2R75 1;  3JAL B;  3D00 A;  1NQ3 A;  2YXZ A;  3OBW A;  3CCS F;  3RYH A;  4XCQ A;  3C9U A;  5HY4 A;  4R40 B;  5HP7 A;  4IHJ A;  3I55 F;  3N2K A;  3VMF B;  1W41 A;  4ERH A;  3P4E A;  2AIF A;  5ITZ A;  2RHL A;  4NWO B;  1GX1 A;  2CSL A;  3F0F A;  3IMP A;  5JH7 B;  2DYY A;  3JAS B;  3D54 A;  3NK6 A;  5KX5 A;  4I50 A;  2ZAU A;  5LP6 B;  2Z1U A;  2Z01 A;  5IYZ A;  4BVS A;  2ZVZ A;  4RQO A;  1Q8R A;  1H47 A;  4FFB A;  5HY0 A;  1TVK A;  5EWR A;  3TD3 A;  4BVQ A;  5J2T A;  2EWC A;  3RYC A;  3CCL F;  1Q7Y H;  1QU9 A;  1TVK B;  5HXU A;  4DRX A;  3P10 A;  3UT5 A;  4F6R B;  1VQM F;  1VQ6 F;  4EI8 A;  1QVF F;  3N4Z A;  3S02 A;  3DC2 A;  2L26 A;  2MQE A;  5KX5 B;  3ELC A;  3JAK B;  4LCK A;  5EYP B;  3LYB A;  4I4T B;  5C8Y A;  5LXT A;  2YYE A;  1VQK F;  4LNU A;  3OBY A;  3E22 A;  2VAM A;  2KTU A;  3LFO A;  3QTY A;  3GHZ A;  1Q82 H;  3HKD A;  3WGJ A;  1U43 A;  1YIJ F;  2OHW A;  2HP0 B;  2GLZ A;  2GVI A;  3I7T A;  1X7P A;  2HS0 A;  3Q8H A;  5J2U A;  5FLX M;  4BVR A;  5JVD A;  3JAL A;  3FD5 A;  3RYF A;  3M84 A;  1U3L A;  2FC3 A;  4I55 B;  1T0K B;  1YJW F;  5JQG A;  3V7E A;  5ITZ B;  3JAW A;  3QUW A;  1SZQ A;  3HKE B;  1W5F A;  2Z1F A;  4G4Z A;  2P6Y A;  1XRG A;  3WJR A;  3CXC F;  2BTQ B;  1W2B F;  3LWO C;  5CA0 B;  3CB2 A;  4BT3 A;  1Q81 H;  2UYN A;  1Z5V A;  4X1K A;  3E1Y A;  3RYI B;  4O4J A;  5JVD B;  1KD1 H;  3WGN A;  4X1Y B;  1W42 A;  2NMU A;  4M8I A;  3RE3 A;  4B62 A;  5KMG B;  1VQP F;  5HP8 A;  3F0G A;  3K14 A;  5JCO A;  5HY1 A;  3CCM F;  2JNB A;  3G4S F;  3HKB B;  3F6M A;  3UT5 B;  3JCM M;  3ZO8 A;  4TV9 A;  5GIN C;  3IEW A;  3CPW F;  3U0O A;  5G4V C;  3HKC B;  1E7K A;  4BT5 A;  2KGW A;  4U3J B;  1TUB B;  5EYP A;  3F0E A;  1IV1 A;  5LOV A;  3RYF B;  2BTU A;  5LA6 A;  4O4I A;  5CA1 A;  2K1S A;  1U3P A;  1XHO A;  5GON B;  2CHS A;  3C9T A;  3B6N A;  5A2Q M;  4TZZ A;  3S03 A;  2UZH A;  3CC4 F;  3HKD B;  1VHA A;  2CHT A;  3FFM A;  4TUY A;  2I6R A;  5LA6 B;  5EZY B;  5CA1 B;  2Z1T A;  1VQ8 F;  5AVM A;  4TV8 A;  1W3E X;  3VYU C;  3LWP C;  2AIZ P;  3KJK A;  5EB1 B;  1VQO F;  3O85 A;  5IJ9 B;  1ZWZ A;  4BT6 A;  3CPQ A;  2BTO A;  5LXT B;  3IEQ A;  5B8F A;  3PLA C;  5HXZ A;  2RHJ A;  4IIJ B;  2V9Y A;  3PAF A;  4TUY B;  5IYZ B;  4O2B B;  4FFB B;  3ERN A;  4I50 B;  4O4I B;  1KQS F;  3S0Y A;  3QHD A;  4O4H B;  3TD4 A;  3CMA F;  5LYJ B;  5EAZ A;  3HJW C;  4ZI7 A;  2UYJ A;  3WJP A;  1YI2 F;  2QEX F;  1KC8 H;  3K0T A;  1DBF A;  1IV2 A;  2IAF A;  2CW4 A;  4TV8 B;  2HVY D;  3NVK E;  5EB0 A;  3MBM A;  2HX0 A;  4BT2 A;  2VAW A;  2LBX A;  5KMG A;  3KE1 A;  5LP6 A;  1NJI H;  3WJQ A;  4EB6 A;  1K73 H;  4X20 B;  1JN1 A;  3G71 F;  5JH7 A;  3JAT B;  3VYT C;  2QI2 A;  2ZF8 A;  3BYQ A;  2H8C A;  2IG8 A;  2IQQ A;  5IJ0 B;  2CVL A;  4YJ3 A;  3MCA B;  3OON A;  4G4V A;  1GZ0 A;  3J81 M;  4ZHW A;  3KIZ A;  3RYH B;  3CCR F;  2VGN A;  3M4S A;  1H48 A;  2CZW A;  4X1Y A;  5EO3 A;  4YJ2 B;  1M90 H;  2WAL A;  5IJ0 A;  3N2G B;  3VOA A;  3GYQ A;  4I4T A;  1RQ7 A;  5C8Y B;  4EB6 B;  4O4H A;  2LBW A;  2LCA A;  1OAP A;  3L7Q A;  1W40 A;  2PHN A;  2I6D A;  2UYP A;  4X1I A;  5G4U C;  5MN4 A;  1NMU B;  3KJJ A;  1QAH A;  3K12 A;  1IPA A;  3JVH A;  1YIT F;  2Q1Y A;  2OZB A;  1RLG A;  3AGK A;  3S06 A;  1PXW A;  3ON1 A;  4HNA A;  2HRY A;  3V3T A;  3CYQ A;  2ZVY A;  2B33 A;  4C8I A;  3E22 B;  5HY2 A;  2VGM A;  1OFU A;  4ZI7 B;  4X20 A;  2RHH A;  3N4Y A;  3VCZ A;  3LWR C;  3VO8 A;  4O4L A;  3CC2 F;  5GAP K;  4C8E A;  3SIU A;  1K9M H;  2KG4 A;  3VI6 A;  4F6R A;  2HP0 A;  3V7Q A;  1T0A A;  4IIJ A;  4ZHQ A;  2AMT A;  1YGY A;  3CCU F;  3LWQ C;  3J80 M;  5CB4 A;  3GTZ A;  3CCJ F;  1CK2 A;  5J2T B;  4E6E A;  2QTP A;  2ZOD A;  2G9I A;  3DDN A;  4KWE A;  5IJ9 A;  1XV2 A;  1VQN F;  5LP6 C;  4G88 A;  4PWT A;  3LWV C;  4C4W C;  1K8A H;  1X52 A;  1U40 A;  1M1K H;  4IHJ B;  4WBN A;  3M1X A;  4NQ3 A;  3CC7 F;  3FBA A;  4O2A B;  4G4X A;  1ODE A;  3HTN A;  3I56 F;  3LDT A;  3E20 B;  1RA4 A;  3CD6 F;  1JD1 A;  3C8L A;  2LBT A;  1VH8 A;  1VQV A;  3D01 A;  5CA0 A;  1ONI A;  3F0D A;  3IKF A;  4G4Y A;  1FNJ A;  3J7A R;  3JAR A;  5EIB D;  4RHA A;  5BMV A;  1VQ7 F;  3WGK A;  4B46 A;  2R6R 1;  4C82 A;  1UI9 A;  5FNV A;  4G4W A;  2HRU A;  2H8E A;  2BO1 A;  1R1M A;  4X1K B;  1KNJ A;  4O4J B;  4BW0 B;  4I55 A;  3IR9 A;  5GIP C;  3I3F A;  1SDS A;  4HNA B;  2KTV A;  3HAX D;  1UFY A;  4ZK7 A;  3NVI B;  3VTI C;  1SA0 A;  4X3M A;  2DT4 A;  3HKE A;  3FD6 A;  1JJ2 F;  3ESJ A;  1W59 A;  3WPW A;  1DT9 A;  3ZOP A;  4BY9 D;  4LNU B;  3RYI A;  5JQG B;  4EI9 A;  5LYJ A;  1FSZ A;  2QA4 F;  4YJ2 A;  1N8R H;  4O2A A; 
#chains in the Genus database with same CATH homology
 1VQP F;  1W40 A;  2I6D A;  5HY1 A;  5GIO C;  3OBW A;  3CCM F;  2JNB A;  3CCS F;  3G4S F;  5G4U C;  4XCQ A;  5HY4 A;  1NMU B;  3I55 F;  3VMF B;  3JCM M;  1IPA A;  1YIT F;  2OZB A;  1RLG A;  1W41 A;  3AGK A;  5GIN C;  1PXW A;  2AIF A;  3ON1 A;  3CPW F;  5G4V C;  3V3T A;  1E7K A;  3NK7 A;  5DCV A;  1GO1 A;  3RA5 A;  5HY2 A;  2VGM A;  5IT9 M;  3N4Y A;  3LWR C;  3CC2 F;  3NK6 A;  3CME F;  3CCE F;  5GAP K;  4NUT A;  1YHQ F;  3SIU A;  1K9M H;  1X7O A;  2KG4 A;  3VI6 A;  4BVS A;  3V7Q A;  5HWE A;  1VQ9 F;  5HY0 A;  5A2Q M;  4TZZ A;  3CC4 F;  3FFM A;  2OTJ F;  1CN7 A;  3SIV A;  3CCU F;  1VQL F;  5EWR A;  3LWQ C;  1VQ8 F;  3J80 M;  1W3E X;  4BVQ A;  3LWP C;  3CCJ F;  1CK2 A;  1VQO F;  3O85 A;  1ZWZ A;  4X3L A;  3CCL F;  1Q7Y H;  3CPQ A;  3PLA C;  1VQN F;  3LWV C;  4C4W C;  5HXU A;  5HXZ A;  3JAM M;  1H7M A;  1K8A H;  1X52 A;  1M1K H;  1XBI A;  3PAF A;  5GAN K;  1VQM F;  1VQ6 F;  4NQ3 A;  3WXM B;  4EI8 A;  1S72 F;  1QVG F;  3CC7 F;  1QVF F;  3N4Z A;  1KQS F;  4LCK A;  3G6E F;  3CMA F;  3HJW C;  3I56 F;  1VQ5 F;  3E20 B;  1YI2 F;  1RA4 A;  2QEX F;  3OBY A;  1VQK F;  3CD6 F;  1KC8 H;  3CG6 A;  2KTU A;  3LFO A;  1VQ4 F;  2HVY D;  3J7A R;  3NVK E;  2OTL F;  2F9Z C;  1Q82 H;  2ALE A;  1YIJ F;  1VQ7 F;  2OHW A;  2GLZ A;  1YJ9 F;  2LBX A;  1YJN F;  1X7P A;  1NJI H;  5FLX M;  4BVR A;  2BO1 A;  1K73 H;  4EI7 A;  3G71 F;  2FC3 A;  4BW0 B;  2QI2 A;  1T0K B;  3IR9 A;  5GIP C;  1YJW F;  3V7E A;  1SDS A;  1GO0 A;  2KTV A;  3HAX D;  3NVI B;  4BVT A;  3MCA B;  2FGY A;  4X3M A;  3OW2 F;  1GZ0 A;  1Q86 H;  3CCV F;  3J81 M;  3NMU C;  3CXC F;  3CCR F;  1W2B F;  2VGN A;  1JJ2 F;  2CZW A;  3LWO C;  5FJ4 C;  5EO3 A;  1M90 H;  1DT9 A;  2WAL A;  1Q81 H;  1W42 A;  4BY9 D;  3E1Y A;  3RA6 A;  3GYQ A;  4EI9 A;  2QA4 F;  2LBW A;  1KD1 H;  3CCQ F;  1N8R H;  3D00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...