5HY0A

Orotic acid hydrolase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
377
structure length
362
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVTSMCWSNDASALGVAVALGEVKRDLVADDRIRFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNHMGPPGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 110
structure length 362
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A01
5HY0A 5HXZA 4NQ3A 5HY4A 5HXUA 5HWEA 4BVQA 4BVRA 4BVSA 5HY2A 4BVTA 5HY1A
chains in the Genus database with same CATH superfamily
3N2KA 4O4HA 4B46A 3JATA 1FNKA 4G4WA 1IPAA 1KQSF 3KE1A 3S03A 4TZZA 1JD1A 1VQ4F 3RYIB 1IV3A 3JAWB 4YJ3A 2ZAUA 5FJ4C 3UT5A 3ELCA 3CCMF 4KWEA 1W41A 2RHOA 3S0YA 4I4TB 3SIVA 1W5AA 3WGKA 1U3LA 3V3TA 1RLUA 3F0DA 4TV8B 4ZI7B 3ESJA 4HNAA 2UZHA 3VCZA 1PXWA 5J2TA 1W5EA 3ZOPA 3BYQA 3V7QA 3NVIB 3S0HA 3NVKE 3RE3A 1KC8H 3C8LA 3C9SA 1K8AH 2CWJA 1RQ2A 3TD4A 1R1MA 4BVQA 3Q8HA 1VH8A 1XRGA 3V7EA 2YYEA 4G4XA 3AGKA 5CA1A 1Z5WA 1XV2A 1SZQA 5EIBC 5BMVB 3ZO8A 5IJ9B 1VQ7F 5EYPB 1TVKA 4IIJB 3HKBA 5KMGB 5LYJA 3CC7F 3SIUA 3V4DA 1YJNF 3WPXA 3M4SA 1QVGF 2Z1FA 5IYZB 5LA6B 1Q81H 3FPIA 1PF5A 3O85A 3CMAF 1VQPF 3KJKA 2ZVZA 5JQGA 2GVIA 2FGYA 2LBWA 1X52A 3CC2F 3LWVC 3CXCF 3CCVF 2OTLF 3WXMB 5ITZB 5LXTB 3CC4F 4C4WC 2OTMA 3WJRA 2FC3A 5MN6A 5B8FA 2CHSA 3P4EA 5GONA 3HKCB 2IG8A 3IKFA 3N4ZA 4NQ3A 3CCUF 4WBNB 5CA0A 1JY8A 5FLXM 4EB6A 1GX1A 2RB9A 5IJ0A 5HY1A 1N8RH 1NMUB 3JAKA 3ZP7A 5JH7A 1KNKA 2F9ZC 3CCSF 3CCRF 4O4IA 4RHAA 3RYHB 3QHDA 5HP8A 2OTJF 4X1KB 2QTPA 1QD9A 2BO1A 5GIOC 4ZHYB 2V9YA 4DRXA 3D54A 2G9IA 1H47A 2H6LA 3WGJA 5KX5A 3CCEF 2BTQB 3OBYA 4C8GA 2L26A 4X3LA 4C8IA 3RYFB 4BT5A 3RYCA 4X1YA 3FFMA 1W40A 3N2GB 2R6R1 2GZLA 2UYJA 4R40B 4U39A 5EZYA 3IEQA 4TUYB 3HWUA 1TUBB 3MCQA 4U3JA 3J80M 1GO0A 4O2BB 3K0TA 2Q1XA 3LWOC 3WJQA 2PHNA 2YXZA 3J81M 4O4LA 3CYPB 3ON1A 3WGLA 3G71F 3CPQA 1M1KH 3JARA 4ZOLB 5GINC 2NMUA 3LWQC 1RLGA 3CD6F 5HY4A 1YJWF 3TD5A 5LP6A 4C81A 4IHJB 1QAHA 2ZOVA 5HY0A 1OFUA 3HKEA 4B62A 4YJ2A 1Q86H 4EI8A 3S02A 3LFOA 1K9MH 4G88A 1T0KB 4RQOA 3LDTA 1FNJA 3FBAA 2WALA 3IMPA 4O2AB 4I50A 3HKDB 5J2UB 1JFFA 2R751 4O4JA 3FD6A 3VOBA 4B5CA 3VIUA 1Z5VA 5EAZA 5JVDA 4X1IA 3GYQA 1KNJA 5LOVA 3HTNA 5EWRA 3E20B 2RHJA 3JASB 5GIPC 4TV9B 1ONIA 1XHOA 3C9RA 3IKEA 3PAFA 3JALA 3E22B 3ZP4A 2CSLA 3U0OA 3WJPA 2I6RA 3PLAC 3D01A 1QU9A 4I55A 2BTOA 4FFBA 3RA5A 3VMFB 4E6EA 2KTVA 2HP3A 3DDNA 5FNVA 3M84A 3S06A 3K2XA 4ZHQB 3M1XA 2Q1YA 3LYBA 2VAPA 1S72F 2HS3A 2VAMA 1YJ9F 3VI6A 4ZHVA 5C8YB 3N2KB 4O4HB 1X7PA 2HRYA 3JATB 3F0EA 5EB0A 1VQOF 1CLIA 2W8BC 3D00A 1E7KA 1VQLF 4YJ3B 1GZ0A 3N4YA 3JAMM 4B45A 3GTZA 1CN7A 4BVTA 4BT3A 2CVLA 1SA0A 2PMPA 2ZVYA 2JNBA 5MN5A 3JVHA 2VAWA 3LMEA 1M90H 3MCAB 2UYPA 3KJJA 2HS0A 3RA6A 2QI2A 2QA4F 5CB4B 4F6RA 1X25A 3WGNA 2UYNA 3CCJF 2HP0A 4TUYA 2H8EA 3MBMA 2KGWA 1VQKF 4G4ZA 3CMEF 2LCAA 1YHQF 3P0ZA 4LNUA 3I7TA 3ERNA 3C9UA 3E1YA 5JCOA 5CA1B 2HX0A 1Q82H 5GAPK 4X3MA 3P10A 1W57A 1YITF 1TVKB 3HKBB 5LYJB 2Z1TA 5LP6C 3RYIA 3KIZA 2AIFA 3JAWA 2H8CA 3I56F 3LWPC 1T0AA 2B33A 2KTUA 1W42A 3I55F 4BVSA 1ZWZA 4I4TA 5JQGB 3VYUC 4TV8A 2IAFA 4ZI7A 1FSZA 1W2BF 3K12A 1DBFA 1VQ5F 1K73H 5GONB 4LCKA 2DYYA 4BVRA 1CK2A 2KG4A 1RA4A 3K14A 5CA0B 1U40A 5IJ0B 3WGMA 2ALEA 3JAKB 2QEXF 3MDOA 5JH7B 3QUWA 1W5FA 2K1SA 1ODEA 4NWOB 5BMVA 3FD5A 1W3EX 3QTYA 4O4IB 5IJ9A 4X20B 5EYPA 4IIJA 5IT9M 5KMGA 3GHZA 1JJ2F 1KD1H 3VO8A 4BW0B 3CCQF 1VK3A 5LA6A 5IYZA 1GO1A 3CCLF 1IV4A 4DRXB 5ITZA 5LXTA 5MN4A 4G4YA 2HS4A 2DT4A 1QVFF 5KX5B 2I6DA 2OHWA 1VQ9F 2EWCA 4C82A 2HRUA 1FFXB 2OZBA 2LBTA 1W581 3HKCA 5AVMA 3CB2A 1UFYA 4BT4A 1OAPA 1VQNF 3RYCB 4X1YB 3G6EF 4WBNA 2UYKA 3F0GA 5HXUA 3OW2F 5EZYB 1XBIA 3IR9A 1IV2A 2VGMA 1H48A 4U3JB 1NJIH 5CB4A 3TD3A 5HP7A 3OBWA 4C8EA 5GANK 4O4LB 1VHAA 3RYHA 3OONA 3JARB 3VYSC 3CPWF 3HAXD 2CZWA 3MQWA 2HVYD 4PWTA 5G4UC 5LP6B 4X1KA 3F0FA 5EB1B 3HKEB 2VXYA 4YJ2B 3KHNA 2CW4A 5G4VC 1RQ7A 3NK7A 3UT5B 3HJWC 5JCOC 4NUTA 1X7OA 3CYQA 3JCMM 5HWEA 4I50B 1Q7YH 5HXZA 1JFFB 4O4JB 1JN1A 1YI2F 3B6NA 3C9TA 3VYTC 2GLZA 3WPWA 3RYFA 4ZK7A 4HNAB 1U3PA 5JVDB 4DXDA 5J2TB 1W55A 4X1IB 2BTUA 2CHTA 5LOVB 2LBXA 3I3FA 1COMA 3N2GA 2RHLA 4BY9D 3R0PA 1TUBA 4O2BA 4XCQA 1VQVA 1NQ3A 1SDSA 3JALB 1VQ8F 2Z1UA 4BT6A 4ZOLA 2MQEA 3NK6A 4I55B 1Q8RA 2AMTA 3VTIC 4FFBB 3LWRC 1YQNA 2HQSC 2ZF8A 3IEWA 4IHJA 5FNVB 2Z01A 3DC2A 2IQQA 2AIZP 2P6YA 3T80A 1YGYA 4X20A 3J7AR 2Z1EA 3NMUC 4O2AA 5A2QM 2N48A 3HKDA 5J2UA 3L7QA 5EO3A 1VQMF 2RHHA 3EORA 1H7MA 2VGNA 1IV1A 1UI9A 2ZODA 3G4SF 4EI9A 1SA0B 3JASA 1VQ6F 4TV9A 1FFXA 4EB6B 1DT9A 1W59A 1U43A 3E22A 1W5BA 1YIJF 3VOAA 4EI7A 4BT2A 5HY2A 4M8IA 4F6RB 3F6MA 1J7HA 2UYNB 2HP0B 4ZHQA 3S0WA 4ERHA 4BT7A 3CG6A 5EIBD 4LNUB 4G4VA 4ZHWA 5C8YA 5DCVA
chains in the Genus database with same CATH topology
3OBWA 3CCEF 5GANK 3RA6A 2QI2A 3OBYA 4X3LA 1IPAA 2QA4F 3CPWF 1KQSF 3HAXD 2CZWA 4TZZA 2HVYD 1VQ4F 5G4UC 3CCJF 5FJ4C 3FFMA 1VQKF 3CMEF 3CCMF 1YHQF 1W40A 1W41A 5G4VC 3SIVA 3NK7A 3J80M 3V3TA 1GO0A 3E1YA 3HJWC 4NUTA 1X7OA 1Q82H 5GAPK 3LWOC 3JCMM 5HWEA 3J81M 1Q7YH 4X3MA 1PXWA 3ON1A 5HXZA 1YITF 3G71F 3CPQA 1M1KH 3V7QA 5GINC 3LWQC 1YI2F 2GLZA 1RLGA 3CD6F 5HY4A 3NVIB 1YJWF 3NVKE 4C4WC 1KC8H 2AIFA 1K8AH 3I56F 3LWPC 5HY0A 2LBXA 2KTUA 1Q86H 1W42A 4EI8A 3I55F 3LFOA 4BVQA 4BVSA 1ZWZA 1K9MH 1T0KB 4BY9D 3V7EA 4XCQA 3AGKA 2WALA 1W2BF 1SDSA 1VQ5F 1VQ8F 1VQ7F 1K73H 4LCKA 3NK6A 3CC7F 4BVRA 3LWRC 1CK2A 2KG4A 3SIUA 1YJNF 3GYQA 1QVGF 1RA4A 1Q81H 3O85A 5EWRA 3CMAF 3E20B 1VQPF 2ALEA 2FGYA 2LBWA 1X52A 5GIPC 3LWVC 3CXCF 2QEXF 3CC2F 3WXMB 3CCVF 2OTLF 3CC4F 3J7AR 3NMUC 3PAFA 2FC3A 1W3EX 5A2QM 3PLAC 5EO3A 1VQMF 5IT9M 3VMFB 1H7MA 3N4ZA 3RA5A 2VGNA 1JJ2F 2KTVA 1KD1H 4NQ3A 4BW0B 3CCUF 3CCQF 5FLXM 3G4SF 4EI9A 5HY1A 1N8RH 1GO1A 1NMUB 3CCLF 1VQ6F 1M90H 1S72F 1YJ9F 3VI6A 2F9ZC 1DT9A 3CCSF 3CCRF 1QVFF 1X7PA 2I6DA 2OHWA 1YIJF 1VQ9F 4EI7A 1VQOF 2OZBA 5HY2A 3D00A 2OTJF 1E7KA 1VQLF 1VQNF 3G6EF 1GZ0A 3N4YA 3JAMM 1CN7A 4BVTA 2BO1A 3CG6A 2JNBA 5HXUA 5GIOC 3OW2F 1XBIA 3IR9A 2VGMA 1NJIH 5DCVA 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HY0 A;  5HXZ A;  4NQ3 A;  5HY4 A;  5HXU A;  5HWE A;  4BVQ A;  4BVR A;  4BVS A;  5HY2 A;  4BVT A;  5HY1 A; 
#chains in the Genus database with same CATH topology
 3N2K A;  4O4H A;  4B46 A;  3JAT A;  1FNK A;  4G4W A;  1IPA A;  1KQS F;  3KE1 A;  3S03 A;  4TZZ A;  1JD1 A;  1VQ4 F;  3RYI B;  1IV3 A;  3JAW B;  4YJ3 A;  2ZAU A;  5FJ4 C;  3UT5 A;  3ELC A;  3CCM F;  4KWE A;  1W41 A;  2RHO A;  3S0Y A;  4I4T B;  3SIV A;  1W5A A;  3WGK A;  1U3L A;  3V3T A;  1RLU A;  3F0D A;  4TV8 B;  4ZI7 B;  3ESJ A;  4HNA A;  2UZH A;  3VCZ A;  1PXW A;  5J2T A;  1W5E A;  3ZOP A;  3BYQ A;  3V7Q A;  3NVI B;  3S0H A;  3NVK E;  3RE3 A;  1KC8 H;  3C8L A;  3C9S A;  1K8A H;  2CWJ A;  1RQ2 A;  3TD4 A;  1R1M A;  4BVQ A;  3Q8H A;  1VH8 A;  1XRG A;  3V7E A;  2YYE A;  4G4X A;  3AGK A;  5CA1 A;  1Z5W A;  1XV2 A;  1SZQ A;  5EIB C;  5BMV B;  3ZO8 A;  5IJ9 B;  1VQ7 F;  5EYP B;  1TVK A;  4IIJ B;  3HKB A;  5KMG B;  5LYJ A;  3CC7 F;  3SIU A;  3V4D A;  1YJN F;  3WPX A;  3M4S A;  1QVG F;  2Z1F A;  5IYZ B;  5LA6 B;  1Q81 H;  3FPI A;  1PF5 A;  3O85 A;  3CMA F;  1VQP F;  3KJK A;  2ZVZ A;  5JQG A;  2GVI A;  2FGY A;  2LBW A;  1X52 A;  3CC2 F;  3LWV C;  3CXC F;  3CCV F;  2OTL F;  3WXM B;  5ITZ B;  5LXT B;  3CC4 F;  4C4W C;  2OTM A;  3WJR A;  2FC3 A;  5MN6 A;  5B8F A;  2CHS A;  3P4E A;  5GON A;  3HKC B;  2IG8 A;  3IKF A;  3N4Z A;  4NQ3 A;  3CCU F;  4WBN B;  5CA0 A;  1JY8 A;  5FLX M;  4EB6 A;  1GX1 A;  2RB9 A;  5IJ0 A;  5HY1 A;  1N8R H;  1NMU B;  3JAK A;  3ZP7 A;  5JH7 A;  1KNK A;  2F9Z C;  3CCS F;  3CCR F;  4O4I A;  4RHA A;  3RYH B;  3QHD A;  5HP8 A;  2OTJ F;  4X1K B;  2QTP A;  1QD9 A;  2BO1 A;  5GIO C;  4ZHY B;  2V9Y A;  4DRX A;  3D54 A;  2G9I A;  1H47 A;  2H6L A;  3WGJ A;  5KX5 A;  3CCE F;  2BTQ B;  3OBY A;  4C8G A;  2L26 A;  4X3L A;  4C8I A;  3RYF B;  4BT5 A;  3RYC A;  4X1Y A;  3FFM A;  1W40 A;  3N2G B;  2R6R 1;  2GZL A;  2UYJ A;  4R40 B;  4U39 A;  5EZY A;  3IEQ A;  4TUY B;  3HWU A;  1TUB B;  3MCQ A;  4U3J A;  3J80 M;  1GO0 A;  4O2B B;  3K0T A;  2Q1X A;  3LWO C;  3WJQ A;  2PHN A;  2YXZ A;  3J81 M;  4O4L A;  3CYP B;  3ON1 A;  3WGL A;  3G71 F;  3CPQ A;  1M1K H;  3JAR A;  4ZOL B;  5GIN C;  2NMU A;  3LWQ C;  1RLG A;  3CD6 F;  5HY4 A;  1YJW F;  3TD5 A;  5LP6 A;  4C81 A;  4IHJ B;  1QAH A;  2ZOV A;  5HY0 A;  1OFU A;  3HKE A;  4B62 A;  4YJ2 A;  1Q86 H;  4EI8 A;  3S02 A;  3LFO A;  1K9M H;  4G88 A;  1T0K B;  4RQO A;  3LDT A;  1FNJ A;  3FBA A;  2WAL A;  3IMP A;  4O2A B;  4I50 A;  3HKD B;  5J2U B;  1JFF A;  2R75 1;  4O4J A;  3FD6 A;  3VOB A;  4B5C A;  3VIU A;  1Z5V A;  5EAZ A;  5JVD A;  4X1I A;  3GYQ A;  1KNJ A;  5LOV A;  3HTN A;  5EWR A;  3E20 B;  2RHJ A;  3JAS B;  5GIP C;  4TV9 B;  1ONI A;  1XHO A;  3C9R A;  3IKE A;  3PAF A;  3JAL A;  3E22 B;  3ZP4 A;  2CSL A;  3U0O A;  3WJP A;  2I6R A;  3PLA C;  3D01 A;  1QU9 A;  4I55 A;  2BTO A;  4FFB A;  3RA5 A;  3VMF B;  4E6E A;  2KTV A;  2HP3 A;  3DDN A;  5FNV A;  3M84 A;  3S06 A;  3K2X A;  4ZHQ B;  3M1X A;  2Q1Y A;  3LYB A;  2VAP A;  1S72 F;  2HS3 A;  2VAM A;  1YJ9 F;  3VI6 A;  4ZHV A;  5C8Y B;  3N2K B;  4O4H B;  1X7P A;  2HRY A;  3JAT B;  3F0E A;  5EB0 A;  1VQO F;  1CLI A;  2W8B C;  3D00 A;  1E7K A;  1VQL F;  4YJ3 B;  1GZ0 A;  3N4Y A;  3JAM M;  4B45 A;  3GTZ A;  1CN7 A;  4BVT A;  4BT3 A;  2CVL A;  1SA0 A;  2PMP A;  2ZVY A;  2JNB A;  5MN5 A;  3JVH A;  2VAW A;  3LME A;  1M90 H;  3MCA B;  2UYP A;  3KJJ A;  2HS0 A;  3RA6 A;  2QI2 A;  2QA4 F;  5CB4 B;  4F6R A;  1X25 A;  3WGN A;  2UYN A;  3CCJ F;  2HP0 A;  4TUY A;  2H8E A;  3MBM A;  2KGW A;  1VQK F;  4G4Z A;  3CME F;  2LCA A;  1YHQ F;  3P0Z A;  4LNU A;  3I7T A;  3ERN A;  3C9U A;  3E1Y A;  5JCO A;  5CA1 B;  2HX0 A;  1Q82 H;  5GAP K;  4X3M A;  3P10 A;  1W57 A;  1YIT F;  1TVK B;  3HKB B;  5LYJ B;  2Z1T A;  5LP6 C;  3RYI A;  3KIZ A;  2AIF A;  3JAW A;  2H8C A;  3I56 F;  3LWP C;  1T0A A;  2B33 A;  2KTU A;  1W42 A;  3I55 F;  4BVS A;  1ZWZ A;  4I4T A;  5JQG B;  3VYU C;  4TV8 A;  2IAF A;  4ZI7 A;  1FSZ A;  1W2B F;  3K12 A;  1DBF A;  1VQ5 F;  1K73 H;  5GON B;  4LCK A;  2DYY A;  4BVR A;  1CK2 A;  2KG4 A;  1RA4 A;  3K14 A;  5CA0 B;  1U40 A;  5IJ0 B;  3WGM A;  2ALE A;  3JAK B;  2QEX F;  3MDO A;  5JH7 B;  3QUW A;  1W5F A;  2K1S A;  1ODE A;  4NWO B;  5BMV A;  3FD5 A;  1W3E X;  3QTY A;  4O4I B;  5IJ9 A;  4X20 B;  5EYP A;  4IIJ A;  5IT9 M;  5KMG A;  3GHZ A;  1JJ2 F;  1KD1 H;  3VO8 A;  4BW0 B;  3CCQ F;  1VK3 A;  5LA6 A;  5IYZ A;  1GO1 A;  3CCL F;  1IV4 A;  4DRX B;  5ITZ A;  5LXT A;  5MN4 A;  4G4Y A;  2HS4 A;  2DT4 A;  1QVF F;  5KX5 B;  2I6D A;  2OHW A;  1VQ9 F;  2EWC A;  4C82 A;  2HRU A;  1FFX B;  2OZB A;  2LBT A;  1W58 1;  3HKC A;  5AVM A;  3CB2 A;  1UFY A;  4BT4 A;  1OAP A;  1VQN F;  3RYC B;  4X1Y B;  3G6E F;  4WBN A;  2UYK A;  3F0G A;  5HXU A;  3OW2 F;  5EZY B;  1XBI A;  3IR9 A;  1IV2 A;  2VGM A;  1H48 A;  4U3J B;  1NJI H;  5CB4 A;  3TD3 A;  5HP7 A;  3OBW A;  4C8E A;  5GAN K;  4O4L B;  1VHA A;  3RYH A;  3OON A;  3JAR B;  3VYS C;  3CPW F;  3HAX D;  2CZW A;  3MQW A;  2HVY D;  4PWT A;  5G4U C;  5LP6 B;  4X1K A;  3F0F A;  5EB1 B;  3HKE B;  2VXY A;  4YJ2 B;  3KHN A;  2CW4 A;  5G4V C;  1RQ7 A;  3NK7 A;  3UT5 B;  3HJW C;  5JCO C;  4NUT A;  1X7O A;  3CYQ A;  3JCM M;  5HWE A;  4I50 B;  1Q7Y H;  5HXZ A;  1JFF B;  4O4J B;  1JN1 A;  1YI2 F;  3B6N A;  3C9T A;  3VYT C;  2GLZ A;  3WPW A;  3RYF A;  4ZK7 A;  4HNA B;  1U3P A;  5JVD B;  4DXD A;  5J2T B;  1W55 A;  4X1I B;  2BTU A;  2CHT A;  5LOV B;  2LBX A;  3I3F A;  1COM A;  3N2G A;  2RHL A;  4BY9 D;  3R0P A;  1TUB A;  4O2B A;  4XCQ A;  1VQV A;  1NQ3 A;  1SDS A;  3JAL B;  1VQ8 F;  2Z1U A;  4BT6 A;  4ZOL A;  2MQE A;  3NK6 A;  4I55 B;  1Q8R A;  2AMT A;  3VTI C;  4FFB B;  3LWR C;  1YQN A;  2HQS C;  2ZF8 A;  3IEW A;  4IHJ A;  5FNV B;  2Z01 A;  3DC2 A;  2IQQ A;  2AIZ P;  2P6Y A;  3T80 A;  1YGY A;  4X20 A;  3J7A R;  2Z1E A;  3NMU C;  4O2A A;  5A2Q M;  2N48 A;  3HKD A;  5J2U A;  3L7Q A;  5EO3 A;  1VQM F;  2RHH A;  3EOR A;  1H7M A;  2VGN A;  1IV1 A;  1UI9 A;  2ZOD A;  3G4S F;  4EI9 A;  1SA0 B;  3JAS A;  1VQ6 F;  4TV9 A;  1FFX A;  4EB6 B;  1DT9 A;  1W59 A;  1U43 A;  3E22 A;  1W5B A;  1YIJ F;  3VOA A;  4EI7 A;  4BT2 A;  5HY2 A;  4M8I A;  4F6R B;  3F6M A;  1J7H A;  2UYN B;  2HP0 B;  4ZHQ A;  3S0W A;  4ERH A;  4BT7 A;  3CG6 A;  5EIB D;  4LNU B;  4G4V A;  4ZHW A;  5C8Y A;  5DCV A; 
#chains in the Genus database with same CATH homology
 3OBW A;  3CCE F;  5GAN K;  3RA6 A;  2QI2 A;  3OBY A;  4X3L A;  1IPA A;  2QA4 F;  3CPW F;  1KQS F;  3HAX D;  2CZW A;  4TZZ A;  2HVY D;  1VQ4 F;  5G4U C;  3CCJ F;  5FJ4 C;  3FFM A;  1VQK F;  3CME F;  3CCM F;  1YHQ F;  1W40 A;  1W41 A;  5G4V C;  3SIV A;  3NK7 A;  3J80 M;  3V3T A;  1GO0 A;  3E1Y A;  3HJW C;  4NUT A;  1X7O A;  1Q82 H;  5GAP K;  3LWO C;  3JCM M;  5HWE A;  3J81 M;  1Q7Y H;  4X3M A;  1PXW A;  3ON1 A;  5HXZ A;  1YIT F;  3G71 F;  3CPQ A;  1M1K H;  3V7Q A;  5GIN C;  3LWQ C;  1YI2 F;  2GLZ A;  1RLG A;  3CD6 F;  5HY4 A;  3NVI B;  1YJW F;  3NVK E;  4C4W C;  1KC8 H;  2AIF A;  1K8A H;  3I56 F;  3LWP C;  5HY0 A;  2LBX A;  2KTU A;  1Q86 H;  1W42 A;  4EI8 A;  3I55 F;  3LFO A;  4BVQ A;  4BVS A;  1ZWZ A;  1K9M H;  1T0K B;  4BY9 D;  3V7E A;  4XCQ A;  3AGK A;  2WAL A;  1W2B F;  1SDS A;  1VQ5 F;  1VQ8 F;  1VQ7 F;  1K73 H;  4LCK A;  3NK6 A;  3CC7 F;  4BVR A;  3LWR C;  1CK2 A;  2KG4 A;  3SIU A;  1YJN F;  3GYQ A;  1QVG F;  1RA4 A;  1Q81 H;  3O85 A;  5EWR A;  3CMA F;  3E20 B;  1VQP F;  2ALE A;  2FGY A;  2LBW A;  1X52 A;  5GIP C;  3LWV C;  3CXC F;  2QEX F;  3CC2 F;  3WXM B;  3CCV F;  2OTL F;  3CC4 F;  3J7A R;  3NMU C;  3PAF A;  2FC3 A;  1W3E X;  5A2Q M;  3PLA C;  5EO3 A;  1VQM F;  5IT9 M;  3VMF B;  1H7M A;  3N4Z A;  3RA5 A;  2VGN A;  1JJ2 F;  2KTV A;  1KD1 H;  4NQ3 A;  4BW0 B;  3CCU F;  3CCQ F;  5FLX M;  3G4S F;  4EI9 A;  5HY1 A;  1N8R H;  1GO1 A;  1NMU B;  3CCL F;  1VQ6 F;  1M90 H;  1S72 F;  1YJ9 F;  3VI6 A;  2F9Z C;  1DT9 A;  3CCS F;  3CCR F;  1QVF F;  1X7P A;  2I6D A;  2OHW A;  1YIJ F;  1VQ9 F;  4EI7 A;  1VQO F;  2OZB A;  5HY2 A;  3D00 A;  2OTJ F;  1E7K A;  1VQL F;  1VQN F;  3G6E F;  1GZ0 A;  3N4Y A;  3JAM M;  1CN7 A;  4BVT A;  2BO1 A;  3CG6 A;  2JNB A;  5HXU A;  5GIO C;  3OW2 F;  1XBI A;  3IR9 A;  2VGM A;  1NJI H;  5DCV A;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...