5HY0A

Orotic acid hydrolase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
377
structure length
362
Chain Sequence
b'RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVTSMCWSNDASALGVAVALGEVKRDLVADDRIRFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNHMGPPGGNPVAAVVRRLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 110
structure length 362
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy0A01
4NQ3A 4BVTA 4BVRA 4BVSA 5HXZA 5HY0A 5HY2A 5HXUA 5HY4A 5HY1A 4BVQA 5HWEA
chains in the Genus database with same CATH superfamily
3DDNA 3VO8A 4G88A 2LBWA 3G4SF 4C81A 3J81M 5IJ0B 1K8AH 2L26A 4X1IB 2HRYA 4X20A 3R0PA 4XCQA 4IHJB 2GZLA 4TUYA 3ESJA 3HKBA 3WGMA 4YJ2B 1NJIH 1H7MA 2VAPA 5JCOC 5JVDA 3PAFA 4BT2A 4R40B 1K9MH 4E6EA 2HX0A 5DCVA 4HNAA 3N2GB 4X1YB 5EO3A 4LCKA 3KHNA 1W41A 1FFXB 4X3LA 3T80A 3NMUC 4BW0B 3I7TA 5G4UC 2HP0A 1UFYA 3MDOA 1K73H 5GINC 1H48A 3KIZA 5KX5A 3LWQC 2VXYA 3VOBA 1RLGA 4BVSA 1W59A 5FLXM 3DC2A 2W8BC 4X20B 2KTUA 4TV9B 4B5CA 2UYPA 4G4ZA 4TUYB 3HKBB 3E22A 3S0WA 3GHZA 5JVDB 3RYIA 2RHJA 3CC2F 2MQEA 3V4DA 4C8EA 3GYQA 4O4HA 3VI6A 1Q81H 3FD6A 4HNAB 5J2TA 4I50A 4ZHQA 2HS0A 2KGWA 2H8EA 1W40A 5LXTA 5LA6A 1IV3A 5LP6C 1VQLF 2HP0B 1QVFF 1YHQF 1YJWF 5KX5B 3WJRA 3CMEF 3JARA 2N48A 4NUTA 2VAMA 1VQ5F 1M1KH 4O4LA 1KC8H 3RYHA 3J7AR 3FPIA 3V7QA 1KD1H 3S0YA 3I56F 5G4VC 3E22B 3L7QA 2Q1YA 4F6RA 1QD9A 3RYIB 5LOVA 3VIUA 1GO0A 5BMVA 5J2UA 1QVGF 2BTQB 1VK3A 4O4HB 4LNUA 1XV2A 5J2TB 2OZBA 4I50B 4ZHQB 4DXDA 2QTPA 2UYNA 5EIBD 5LXTB 5LA6B 3JALA 5EB0A 5HXUA 3CCQF 1H47A 3WXMB 2OTMA 3N2KA 2HVYD 1OAPA 1Q82H 3TD4A 2HS4A 2RHHA 3JARB 4YJ3A 4BVQA 5EWRA 4U39A 4O4LB 5ITZA 3JATA 2PMPA 3RYHB 2H8CA 1RLUA 1YI2F 1VQ8F 3WGNA 1W5AA 2P6YA 3TD3A 1S72F 2CVLA 2UYJA 4F6RB 1E7KA 5LOVB 5BMVB 5J2UB 4C4WC 1VQNF 3V7EA 3CC4F 4BVTA 1W57A 2EWCA 2UYNB 1FNJA 1W42A 3RYFA 4NQ3A 1CK2A 3F0FA 3JALB 5GAPK 1W3EX 5KMGA 3OBWA 3LYBA 3MCQA 3WJQA 2ZVYA 3CCMF 1XHOA 3QHDA 3N2KB 3C9SA 4YJ3B 1YQNA 1COMA 3CPQA 1JN1A 1RQ2A 4BT6A 5GONA 1W581 3JATB 5ITZB 1TVKA 3FBAA 3SIVA 3TD5A 4ZHYB 2FC3A 2LBTA 5JQGA 5C8YB 2IG8A 3VYUC 3N4ZA 3HJWC 3SIUA 3CD6F 1IV4A 3M4SA 4O2AA 3LWVC 1VQPF 2R6R1 3I55F 4ZHWA 5GIOC 3CXCF 5HWEA 2HQSC 1IV1A 3P10A 3RYFB 3D54A 3EORA 4NWOB 3VOAA 4BT7A 3JAMM 5EYPA 5KMGB 1T0AA 3JASA 1FNKA 2CWJA 4B46A 4G4WA 5HY1A 4C82A 1RQ7A 3F6MA 5IYZA 4EI9A 2QI2A 5IT9M 3K0TA 5GONB 1TVKB 2Z1FA 5MN4A 1Z5VA 5JQGB 4EI7A 2LCAA 4O4IA 1YJ9F 1KQSF 3B6NA 1R1MA 4G4VA 1X7PA 4O4JA 4X3MA 3OW2F 4O2AB 3CYQA 3C9UA 4I4TA 5EIBC 1JFFA 1X25A 3VTIC 3S0HA 2OTLF 3WJPA 1QU9A 1DT9A 5EYPB 2OTJF 3E1YA 4RQOA 3BYQA 3JASB 1XRGA 2CZWA 5MN5A 1M90H 1UI9A 1GO1A 1RA4A 5CA0A 2Z1TA 3CCSF 1VQ6F 4RHAA 5IYZB 1VQ9F 4BY9D 1NMUB 2ZAUA 1VH8A 3FFMA 1IPAA 3K14A 3LWOC 1ZWZA 1IV2A 4O4IB 3C8LA 3VMFB 2AIZP 3E20B 2BO1A 2ALEA 4O4JB 3U0OA 3ERNA 2Q1XA 4EB6A 1X7OA 2ZVZA 3KJKA 3CCVF 3NVIB 3LDTA 2QA4F 3Q8HA 1GX1A 3HKCA 3F0GA 1JFFB 5GIPC 2ZF8A 4I55A 3P0ZA 2OHWA 3K2XA 3IEQA 2RB9A 3IEWA 3ZOPA 3NK6A 2AMTA 4ZOLA 5HY2A 2FGYA 3F0EA 5JCOA 5EAZA 2KTVA 5CA0B 5AVMA 3RYCA 2UZHA 3CYPB 1T0KB 1W5FA 3MQWA 3KE1A 3NK7A 4B62A 2UYKA 3MBMA 3VCZA 4G4XA 1VQOF 1VQMF 5CA1A 3MCAB 4LNUB 1VQ4F 1U40A 1XBIA 2K1SA 2CHSA 2VGNA 4DRXA 2HS3A 2G9IA 3FD5A 4EI8A 4ZI7A 5CB4A 4BT4A 4EB6B 3IR9A 3S02A 2V9YA 1VQ7F 3ZO8A 1VQKF 2YYEA 1W5EA 3HKCB 4I55B 1PF5A 5JH7A 1W2BF 4G4YA 5GANK 4ZOLB 3D00A 2I6DA 4TZZA 2RHLA 3HWUA 2BTUA 5EB1B 4FFBA 4O2BA 3RYCB 2CSLA 1GZ0A 3JVHA 4PWTA 3LWRC 2WALA 3F0DA 4TV9A 1QAHA 3HAXD 5CA1B 4B45A 3O85A 3UT5A 5LP6A 3IKFA 3ON1A 3S03A 1YGYA 4DRXB 4C8GA 3JAWA 2F9ZC 2I6RA 4ZI7B 5CB4B 1YITF 3G71F 4U3JA 4IIJA 1TUBA 5IJ9A 1JJ2F 3LWPC 4BT5A 3S06A 1CN7A 4X1KA 5JH7B 3IKEA 3P4EA 4KWEA 4BT3A 3K12A 2KG4A 1VQVA 4WBNA 4FFBB 4O2BB 2AIFA 3ZP7A 3M84A 5HY4A 1Q86H 3OONA 2LBXA 1PXWA 1VHAA 3V3TA 3WGLA 2R751 1DBFA 2Z1EA 3WPXA 3G6EF 1ONIA 3UT5B 1ODEA 5LP6B 3HKEA 3HTNA 3CCJF 3JAKA 5B8FA 3CCLF 3JAWB 2CHTA 3RE3A 5HP8A 4ZHVA 3HKDA 1Q8RA 2H6LA 4M8IA 4U3JB 2CW4A 4IIJB 1TUBB 5IJ9B 1SA0A 3CCEF 2IQQA 4BVRA 5FNVA 3QTYA 3J80M 5EZYA 1U3PA 3RA6A 2VGMA 4X1KB 1YJNF 3I3FA 4TV8A 3WGJA 4ZK7A 3CCRF 5LYJA 2PHNA 3ZP4A 3AGKA 3CB2A 4WBNB 3OBYA 1JY8A 2QEXF 3CCUF 3PLAC 3LFOA 1Z5WA 5HXZA 1CLIA 2YXZA 2VAWA 5FJ4C 4I4TB 1YIJF 1OFUA 3QUWA 3HKEB 2BTOA 3JAKB 4C8IA 2NMUA 1FSZA 1KNJA 3HKDB 3WPWA 1U3LA 1U43A 2ZOVA 1NQ3A 1SA0B 5FNVB 5IJ0A 2HRUA 5EZYB 4X1IA 2HP3A 3CC7F 4TV8B 3LMEA 1W55A 3KJJA 4IHJA 5A2QM 3RA5A 5LYJB 1KNKA 3CMAF 5HP7A 2Z1UA 2DYYA 2GLZA 4YJ2A 3VYSC 1JD1A 2B33A 3GTZA 1W5BA 3C9TA 1N8RH 3ELCA 3CPWF 1SDSA 3N4YA 2DT4A 1X52A 3D01A 2RHOA 3N2GA 4X1YA 4ERHA 3M1XA 5C8YA 5MN6A 2JNBA 2IAFA 3CG6A 1FFXA 1J7HA 2Z01A 1Q7YH 2ZODA 3C9RA 3JCMM 3VYTC 2GVIA 1SZQA 3IMPA 3WGKA 5HY0A 3NVKE
chains in the Genus database with same CATH topology
1DT9A 3WXMB 1CN7A 2HVYD 2LBWA 1Q82H 3E1YA 3G4SF 1M90H 2OTJF 2CZWA 3J81M 1K8AH 1GO1A 1RA4A 3CCSF 4BVQA 5EWRA 2KG4A 4XCQA 1VQ6F 2AIFA 1VQ9F 4BY9D 1NMUB 5HY4A 1Q86H 1YI2F 1VQ8F 2LBXA 1NJIH 1PXWA 1IPAA 1H7MA 3FFMA 3PAFA 3V3TA 1K9MH 3LWOC 1S72F 1ZWZA 1E7KA 3G6EF 3VMFB 3E20B 5DCVA 2BO1A 5EO3A 2ALEA 4C4WC 1VQNF 4LCKA 3CCJF 1W41A 3CCLF 3V7EA 4X3LA 1X7OA 3NMUC 4BW0B 3CC4F 3CCVF 3NVIB 5G4UC 4BVTA 2QA4F 1W42A 5GIPC 1K73H 2OHWA 4NQ3A 1CK2A 5GINC 5GAPK 1W3EX 4BVRA 3OBWA 3CCEF 3LWQC 3NK6A 3J80M 3RA6A 2VGMA 2FGYA 5HY2A 3CCMF 1YJNF 3CCRF 1RLGA 4BVSA 2KTVA 5FLXM 3AGKA 3CPQA 1T0KB 2KTUA 3OBYA 3NK7A 3SIVA 2QEXF 1VQOF 3CCUF 1VQMF 2FC3A 3PLAC 3MCAB 3HJWC 3LFOA 3N4ZA 3CC2F 1VQ4F 3SIUA 1XBIA 5HXZA 3CD6F 2VGNA 3GYQA 3VI6A 1Q81H 5FJ4C 1YIJF 4EI8A 3LWVC 1VQPF 3I55F 1W40A 3IR9A 5GIOC 3CXCF 1VQ7F 1VQKF 5HWEA 1VQLF 1QVFF 3JAMM 1YHQF 1YJWF 1W2BF 5GANK 3CMEF 3CCQF 3CC7F 3D00A 2I6DA 4TZZA 4NUTA 1VQ5F 5A2QM 5HY1A 1M1KH 3RA5A 1KC8H 3CMAF 3J7AR 4EI9A 2QI2A 5IT9M 2GLZA 3V7QA 1GZ0A 1KD1H 3LWRC 3I56F 2WALA 5G4VC 3HAXD 1N8RH 4EI7A 3CPWF 1YJ9F 3N4YA 1KQSF 1X52A 3O85A 1SDSA 1GO0A 1QVGF 1X7PA 4X3MA 3ON1A 3LWPC 2JNBA 3CG6A 3OW2F 2F9ZC 1Q7YH 2OZBA 3JCMM 1YITF 3G71F 1JJ2F 2OTLF 5HXUA 5HY0A 3NVKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ3 A;  4BVT A;  4BVR A;  4BVS A;  5HXZ A;  5HY0 A;  5HY2 A;  5HXU A;  5HY4 A;  5HY1 A;  4BVQ A;  5HWE A; 
#chains in the Genus database with same CATH topology
 3DDN A;  3VO8 A;  4G88 A;  2LBW A;  3G4S F;  4C81 A;  3J81 M;  5IJ0 B;  1K8A H;  2L26 A;  4X1I B;  2HRY A;  4X20 A;  3R0P A;  4XCQ A;  4IHJ B;  2GZL A;  4TUY A;  3ESJ A;  3HKB A;  3WGM A;  4YJ2 B;  1NJI H;  1H7M A;  2VAP A;  5JCO C;  5JVD A;  3PAF A;  4BT2 A;  4R40 B;  1K9M H;  4E6E A;  2HX0 A;  5DCV A;  4HNA A;  3N2G B;  4X1Y B;  5EO3 A;  4LCK A;  3KHN A;  1W41 A;  1FFX B;  4X3L A;  3T80 A;  3NMU C;  4BW0 B;  3I7T A;  5G4U C;  2HP0 A;  1UFY A;  3MDO A;  1K73 H;  5GIN C;  1H48 A;  3KIZ A;  5KX5 A;  3LWQ C;  2VXY A;  3VOB A;  1RLG A;  4BVS A;  1W59 A;  5FLX M;  3DC2 A;  2W8B C;  4X20 B;  2KTU A;  4TV9 B;  4B5C A;  2UYP A;  4G4Z A;  4TUY B;  3HKB B;  3E22 A;  3S0W A;  3GHZ A;  5JVD B;  3RYI A;  2RHJ A;  3CC2 F;  2MQE A;  3V4D A;  4C8E A;  3GYQ A;  4O4H A;  3VI6 A;  1Q81 H;  3FD6 A;  4HNA B;  5J2T A;  4I50 A;  4ZHQ A;  2HS0 A;  2KGW A;  2H8E A;  1W40 A;  5LXT A;  5LA6 A;  1IV3 A;  5LP6 C;  1VQL F;  2HP0 B;  1QVF F;  1YHQ F;  1YJW F;  5KX5 B;  3WJR A;  3CME F;  3JAR A;  2N48 A;  4NUT A;  2VAM A;  1VQ5 F;  1M1K H;  4O4L A;  1KC8 H;  3RYH A;  3J7A R;  3FPI A;  3V7Q A;  1KD1 H;  3S0Y A;  3I56 F;  5G4V C;  3E22 B;  3L7Q A;  2Q1Y A;  4F6R A;  1QD9 A;  3RYI B;  5LOV A;  3VIU A;  1GO0 A;  5BMV A;  5J2U A;  1QVG F;  2BTQ B;  1VK3 A;  4O4H B;  4LNU A;  1XV2 A;  5J2T B;  2OZB A;  4I50 B;  4ZHQ B;  4DXD A;  2QTP A;  2UYN A;  5EIB D;  5LXT B;  5LA6 B;  3JAL A;  5EB0 A;  5HXU A;  3CCQ F;  1H47 A;  3WXM B;  2OTM A;  3N2K A;  2HVY D;  1OAP A;  1Q82 H;  3TD4 A;  2HS4 A;  2RHH A;  3JAR B;  4YJ3 A;  4BVQ A;  5EWR A;  4U39 A;  4O4L B;  5ITZ A;  3JAT A;  2PMP A;  3RYH B;  2H8C A;  1RLU A;  1YI2 F;  1VQ8 F;  3WGN A;  1W5A A;  2P6Y A;  3TD3 A;  1S72 F;  2CVL A;  2UYJ A;  4F6R B;  1E7K A;  5LOV B;  5BMV B;  5J2U B;  4C4W C;  1VQN F;  3V7E A;  3CC4 F;  4BVT A;  1W57 A;  2EWC A;  2UYN B;  1FNJ A;  1W42 A;  3RYF A;  4NQ3 A;  1CK2 A;  3F0F A;  3JAL B;  5GAP K;  1W3E X;  5KMG A;  3OBW A;  3LYB A;  3MCQ A;  3WJQ A;  2ZVY A;  3CCM F;  1XHO A;  3QHD A;  3N2K B;  3C9S A;  4YJ3 B;  1YQN A;  1COM A;  3CPQ A;  1JN1 A;  1RQ2 A;  4BT6 A;  5GON A;  1W58 1;  3JAT B;  5ITZ B;  1TVK A;  3FBA A;  3SIV A;  3TD5 A;  4ZHY B;  2FC3 A;  2LBT A;  5JQG A;  5C8Y B;  2IG8 A;  3VYU C;  3N4Z A;  3HJW C;  3SIU A;  3CD6 F;  1IV4 A;  3M4S A;  4O2A A;  3LWV C;  1VQP F;  2R6R 1;  3I55 F;  4ZHW A;  5GIO C;  3CXC F;  5HWE A;  2HQS C;  1IV1 A;  3P10 A;  3RYF B;  3D54 A;  3EOR A;  4NWO B;  3VOA A;  4BT7 A;  3JAM M;  5EYP A;  5KMG B;  1T0A A;  3JAS A;  1FNK A;  2CWJ A;  4B46 A;  4G4W A;  5HY1 A;  4C82 A;  1RQ7 A;  3F6M A;  5IYZ A;  4EI9 A;  2QI2 A;  5IT9 M;  3K0T A;  5GON B;  1TVK B;  2Z1F A;  5MN4 A;  1Z5V A;  5JQG B;  4EI7 A;  2LCA A;  4O4I A;  1YJ9 F;  1KQS F;  3B6N A;  1R1M A;  4G4V A;  1X7P A;  4O4J A;  4X3M A;  3OW2 F;  4O2A B;  3CYQ A;  3C9U A;  4I4T A;  5EIB C;  1JFF A;  1X25 A;  3VTI C;  3S0H A;  2OTL F;  3WJP A;  1QU9 A;  1DT9 A;  5EYP B;  2OTJ F;  3E1Y A;  4RQO A;  3BYQ A;  3JAS B;  1XRG A;  2CZW A;  5MN5 A;  1M90 H;  1UI9 A;  1GO1 A;  1RA4 A;  5CA0 A;  2Z1T A;  3CCS F;  1VQ6 F;  4RHA A;  5IYZ B;  1VQ9 F;  4BY9 D;  1NMU B;  2ZAU A;  1VH8 A;  3FFM A;  1IPA A;  3K14 A;  3LWO C;  1ZWZ A;  1IV2 A;  4O4I B;  3C8L A;  3VMF B;  2AIZ P;  3E20 B;  2BO1 A;  2ALE A;  4O4J B;  3U0O A;  3ERN A;  2Q1X A;  4EB6 A;  1X7O A;  2ZVZ A;  3KJK A;  3CCV F;  3NVI B;  3LDT A;  2QA4 F;  3Q8H A;  1GX1 A;  3HKC A;  3F0G A;  1JFF B;  5GIP C;  2ZF8 A;  4I55 A;  3P0Z A;  2OHW A;  3K2X A;  3IEQ A;  2RB9 A;  3IEW A;  3ZOP A;  3NK6 A;  2AMT A;  4ZOL A;  5HY2 A;  2FGY A;  3F0E A;  5JCO A;  5EAZ A;  2KTV A;  5CA0 B;  5AVM A;  3RYC A;  2UZH A;  3CYP B;  1T0K B;  1W5F A;  3MQW A;  3KE1 A;  3NK7 A;  4B62 A;  2UYK A;  3MBM A;  3VCZ A;  4G4X A;  1VQO F;  1VQM F;  5CA1 A;  3MCA B;  4LNU B;  1VQ4 F;  1U40 A;  1XBI A;  2K1S A;  2CHS A;  2VGN A;  4DRX A;  2HS3 A;  2G9I A;  3FD5 A;  4EI8 A;  4ZI7 A;  5CB4 A;  4BT4 A;  4EB6 B;  3IR9 A;  3S02 A;  2V9Y A;  1VQ7 F;  3ZO8 A;  1VQK F;  2YYE A;  1W5E A;  3HKC B;  4I55 B;  1PF5 A;  5JH7 A;  1W2B F;  4G4Y A;  5GAN K;  4ZOL B;  3D00 A;  2I6D A;  4TZZ A;  2RHL A;  3HWU A;  2BTU A;  5EB1 B;  4FFB A;  4O2B A;  3RYC B;  2CSL A;  1GZ0 A;  3JVH A;  4PWT A;  3LWR C;  2WAL A;  3F0D A;  4TV9 A;  1QAH A;  3HAX D;  5CA1 B;  4B45 A;  3O85 A;  3UT5 A;  5LP6 A;  3IKF A;  3ON1 A;  3S03 A;  1YGY A;  4DRX B;  4C8G A;  3JAW A;  2F9Z C;  2I6R A;  4ZI7 B;  5CB4 B;  1YIT F;  3G71 F;  4U3J A;  4IIJ A;  1TUB A;  5IJ9 A;  1JJ2 F;  3LWP C;  4BT5 A;  3S06 A;  1CN7 A;  4X1K A;  5JH7 B;  3IKE A;  3P4E A;  4KWE A;  4BT3 A;  3K12 A;  2KG4 A;  1VQV A;  4WBN A;  4FFB B;  4O2B B;  2AIF A;  3ZP7 A;  3M84 A;  5HY4 A;  1Q86 H;  3OON A;  2LBX A;  1PXW A;  1VHA A;  3V3T A;  3WGL A;  2R75 1;  1DBF A;  2Z1E A;  3WPX A;  3G6E F;  1ONI A;  3UT5 B;  1ODE A;  5LP6 B;  3HKE A;  3HTN A;  3CCJ F;  3JAK A;  5B8F A;  3CCL F;  3JAW B;  2CHT A;  3RE3 A;  5HP8 A;  4ZHV A;  3HKD A;  1Q8R A;  2H6L A;  4M8I A;  4U3J B;  2CW4 A;  4IIJ B;  1TUB B;  5IJ9 B;  1SA0 A;  3CCE F;  2IQQ A;  4BVR A;  5FNV A;  3QTY A;  3J80 M;  5EZY A;  1U3P A;  3RA6 A;  2VGM A;  4X1K B;  1YJN F;  3I3F A;  4TV8 A;  3WGJ A;  4ZK7 A;  3CCR F;  5LYJ A;  2PHN A;  3ZP4 A;  3AGK A;  3CB2 A;  4WBN B;  3OBY A;  1JY8 A;  2QEX F;  3CCU F;  3PLA C;  3LFO A;  1Z5W A;  5HXZ A;  1CLI A;  2YXZ A;  2VAW A;  5FJ4 C;  4I4T B;  1YIJ F;  1OFU A;  3QUW A;  3HKE B;  2BTO A;  3JAK B;  4C8I A;  2NMU A;  1FSZ A;  1KNJ A;  3HKD B;  3WPW A;  1U3L A;  1U43 A;  2ZOV A;  1NQ3 A;  1SA0 B;  5FNV B;  5IJ0 A;  2HRU A;  5EZY B;  4X1I A;  2HP3 A;  3CC7 F;  4TV8 B;  3LME A;  1W55 A;  3KJJ A;  4IHJ A;  5A2Q M;  3RA5 A;  5LYJ B;  1KNK A;  3CMA F;  5HP7 A;  2Z1U A;  2DYY A;  2GLZ A;  4YJ2 A;  3VYS C;  1JD1 A;  2B33 A;  3GTZ A;  1W5B A;  3C9T A;  1N8R H;  3ELC A;  3CPW F;  1SDS A;  3N4Y A;  2DT4 A;  1X52 A;  3D01 A;  2RHO A;  3N2G A;  4X1Y A;  4ERH A;  3M1X A;  5C8Y A;  5MN6 A;  2JNB A;  2IAF A;  3CG6 A;  1FFX A;  1J7H A;  2Z01 A;  1Q7Y H;  2ZOD A;  3C9R A;  3JCM M;  3VYT C;  2GVI A;  1SZQ A;  3IMP A;  3WGK A;  5HY0 A;  3NVK E; 
#chains in the Genus database with same CATH homology
 1DT9 A;  3WXM B;  1CN7 A;  2HVY D;  2LBW A;  1Q82 H;  3E1Y A;  3G4S F;  1M90 H;  2OTJ F;  2CZW A;  3J81 M;  1K8A H;  1GO1 A;  1RA4 A;  3CCS F;  4BVQ A;  5EWR A;  2KG4 A;  4XCQ A;  1VQ6 F;  2AIF A;  1VQ9 F;  4BY9 D;  1NMU B;  5HY4 A;  1Q86 H;  1YI2 F;  1VQ8 F;  2LBX A;  1NJI H;  1PXW A;  1IPA A;  1H7M A;  3FFM A;  3PAF A;  3V3T A;  1K9M H;  3LWO C;  1S72 F;  1ZWZ A;  1E7K A;  3G6E F;  3VMF B;  3E20 B;  5DCV A;  2BO1 A;  5EO3 A;  2ALE A;  4C4W C;  1VQN F;  4LCK A;  3CCJ F;  1W41 A;  3CCL F;  3V7E A;  4X3L A;  1X7O A;  3NMU C;  4BW0 B;  3CC4 F;  3CCV F;  3NVI B;  5G4U C;  4BVT A;  2QA4 F;  1W42 A;  5GIP C;  1K73 H;  2OHW A;  4NQ3 A;  1CK2 A;  5GIN C;  5GAP K;  1W3E X;  4BVR A;  3OBW A;  3CCE F;  3LWQ C;  3NK6 A;  3J80 M;  3RA6 A;  2VGM A;  2FGY A;  5HY2 A;  3CCM F;  1YJN F;  3CCR F;  1RLG A;  4BVS A;  2KTV A;  5FLX M;  3AGK A;  3CPQ A;  1T0K B;  2KTU A;  3OBY A;  3NK7 A;  3SIV A;  2QEX F;  1VQO F;  3CCU F;  1VQM F;  2FC3 A;  3PLA C;  3MCA B;  3HJW C;  3LFO A;  3N4Z A;  3CC2 F;  1VQ4 F;  3SIU A;  1XBI A;  5HXZ A;  3CD6 F;  2VGN A;  3GYQ A;  3VI6 A;  1Q81 H;  5FJ4 C;  1YIJ F;  4EI8 A;  3LWV C;  1VQP F;  3I55 F;  1W40 A;  3IR9 A;  5GIO C;  3CXC F;  1VQ7 F;  1VQK F;  5HWE A;  1VQL F;  1QVF F;  3JAM M;  1YHQ F;  1YJW F;  1W2B F;  5GAN K;  3CME F;  3CCQ F;  3CC7 F;  3D00 A;  2I6D A;  4TZZ A;  4NUT A;  1VQ5 F;  5A2Q M;  5HY1 A;  1M1K H;  3RA5 A;  1KC8 H;  3CMA F;  3J7A R;  4EI9 A;  2QI2 A;  5IT9 M;  2GLZ A;  3V7Q A;  1GZ0 A;  1KD1 H;  3LWR C;  3I56 F;  2WAL A;  5G4V C;  3HAX D;  1N8R H;  4EI7 A;  3CPW F;  1YJ9 F;  3N4Y A;  1KQS F;  1X52 A;  3O85 A;  1SDS A;  1GO0 A;  1QVG F;  1X7P A;  4X3M A;  3ON1 A;  3LWP C;  2JNB A;  3CG6 A;  3OW2 F;  2F9Z C;  1Q7Y H;  2OZB A;  3JCM M;  1YIT F;  3G71 F;  1JJ2 F;  2OTL F;  5HXU A;  5HY0 A;  3NVK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...