3C8LA

Crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
GMARKRLIIEMGMGIDQHGQEPTIAASRAVRNAIAHNALPGVWEVAGLSHPNEMIIEVQVAVPYPEQVREEEVLAVLPFGRKTLTVESGGMIVQGRAIPELNDKNDEMLIAIAAVTVLIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords FtsZ-like protein of unknown function
publication title Crystal structure of FtsZ-like protein of unknown function (ZP_00109722.1) from Nostoc punctiforme PCC 73102 at 1.22 A resolution.
rcsb
source organism Nostoc punctiforme
total genus 27
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3c8lA00
5IJ0A 4HNAB 5ITZA 5LOVA 5GONB 5CB4B 4EB6A 4O4LA 1TUBA 1FFXA 4X1KA 3WGKA 5LP6B 4B46A 2VXYA 5FNVA 3HKCA 5JCOC 4TUYB 2Q1YA 4WBNB 3WGJA 3N2KA 3VOBA 4ZI7A 4ZHQA 5EYPB 4IIJB 5JQGB 3UT5B 3RYHA 3RYIA 3JASB 5CA1A 3JAWA 1RQ7A 4X1IB 4E6EA 4LNUA 2VAWA 1W581 1TVKA 4TV8A 5EIBD 5JH7B 3JALA 4DXDA 4O4JA 2R751 5JVDA 2VAPA 2Q1XA 4ZOLA 5MN4A 4YJ3A 5KX5A 4IHJA 4F6RB 3VO8A 2BTOA 5EIBC 5IYZB 5IJ9A 4X1YB 3E22A 4O4LB 2BTQB 4FFBA 4O2AA 3RYCA 4X1KB 3CB2A 4O2BB 3HKBA 1W5EA 5J2TA 1SA0A 5MN6A 4TV9A 4O4IA 2RHOA 4YJ2A 3JATA 3N2KB 5C8YA 1JFFA 2RHHA 3JAKB 5J2UA 2RHJA 3N2GB 3VOAA 3RYHB 1W59A 4HNAA 3RYIB 4I50B 5GONA 5CA0B 3HKDA 4U3JA 5LP6A 3JALB 5JVDB 5MN5A 5EZYB 3WGMA 4YJ3B 3JARA 4I4TA 4I55B 4IHJB 4TUYA 3RYFA 4X20A 5LA6A 4WBNA 5IJ0B 5ITZB 5LOVB 4IIJA 1W5BA 4EB6B 1TUBB 1FFXB 5IJ9B 3E22B 4X1IA 4FFBB 5LXTA 3RYCB 2R6R1 5FNVB 3HKCB 3HKBB 3HKEA 5JH7A 5BMVA 5LYJA 1W5FA 4ZI7B 5KMGA 5J2TB 4O4IB 4YJ2B 4DRXA 4ZHQB 1Z5WA 1Z5VA 4O4HA 4F6RA 1JFFB 5C8YB 2VAMA 4M8IA 1FSZA 5CA1B 3JAWB 2GVIA 5CB4A 4LNUB 5IYZA 1TVKB 1W5AA 4TV8B 4X1YA 3C8LA 4O4JB 4B45A 3HKDB 4U3JB 1RQ2A 4ZOLB 5JCOA 4O2BA 5LP6C 5KX5B 3WGLA 2RHLA 3JARB 4I4TB 4KWEA 4U39A 5EYPA 3RYFB 4X20B 5LA6B 5JQGA 3UT5A 3JAKA 3JASA 3N2GA 3WGNA 4O2AB 4I50A 1RLUA 5CA0A 5LXTB 1SA0B 4TV9B 3HKEB 3JATB 5BMVB 5LYJB 1OFUA 5EZYA 5KMGB 5J2UB 4DRXB 4I55A 4O4HB
chains in the Genus database with same CATH superfamily
5IJ0A 1GZ0A 3ZO8A 5GONB 5GINC 3KHNA 3PAFA 3S0YA 1T0AA 5HXZA 3NK6A 3HKCA 4BY9D 2Q1YA 1H48A 3N2KA 3WGJA 3VI6A 3O85A 4IIJB 4C4WC 2ZVZA 2BTUA 2NMUA 3NK7A 1FNKA 5HY0A 1RQ7A 5HY4A 2Z1FA 1UI9A 4DXDA 2VAPA 3RA5A 4YJ3A 5KX5A 4IHJA 3ELCA 2H6LA 1W2BF 2ZVYA 5IJ9A 3I7TA 3HAXD 3E22A 5GAPK 5HWEA 4O2BB 3K14A 1N8RH 4G4ZA 3N2GB 3VOAA 1ONIA 3CPQA 3RYIB 2CVLA 1T0KB 3N4ZA 4NUTA 3SIVA 2I6DA 5JVDB 3U0OA 5MN5A 1ZWZA 2BO1A 2AIFA 5A2QM 4X20A 5HP7A 5LOVB 3J81M 4BT5A 3S0WA 3V3TA 3PLAC 2KTVA 1FFXB 1PF5A 2QA4F 4PWTA 2UZHA 5FNVB 1VQNF 5BMVA 5LYJA 3MBMA 4ZI7B 3CCMF 4DRXA 1KNKA 3G6EF 1Z5VA 4O4HA 4F6RA 5C8YB 3CCSF 4M8IA 4BVSA 1GO1A 4EI9A 2OHWA 2MQEA 3D54A 1IV3A 3S02A 1RQ2A 1W3EX 4G4XA 4RQOA 3SIUA 3EORA 4NQ3A 3JARB 5HY2A 1XHOA 1U40A 3WGNA 4BT2A 1NMUB 4O2AB 1VQ7F 5CA0A 5LXTB 3IKEA 1VQ4F 1VK3A 1VQ9F 2JNBA 3D01A 3HKEB 2K1SA 3IEQA 2KTUA 3JAMM 1GX1A 1YHQF 1YITF 1K73H 3G71F 2HRUA 1X25A 1S72F 1W55A 5ITZA 2OZBA 3HTNA 4NWOB 4EB6A 3CD6F 1TUBA 1XBIA 4G4YA 5GIPC 4X1KA 3WGKA 5LP6B 3LFOA 1M90H 2GLZA 2IG8A 3C9TA 2HQSC 4ZHQA 4EI8A 2VGNA 3RYHA 5CA1A 3JAWA 2H8CA 1XRGA 4E6EA 3OW2F 3GYQA 4TV8A 4EI7A 1QU9A 1VHAA 3P4EA 1U3PA 3K2XA 4O4JA 3B6NA 1VQ5F 2ZAUA 3S03A 3MCQA 3VO8A 2F9ZC 5EIBC 3N4YA 1Q81H 2LBWA 4X1YB 1CK2A 3CYPB 1COMA 5EB0A 3GHZA 2P6YA 3RYCA 3CXCF 1W40A 1IV4A 3F0GA 3HKBA 3ZOPA 1SA0A 3LDTA 5MN6A 4YJ2A 3JATA 3N2KB 2RHHA 3JAKB 5J2UA 4TZZA 2RHJA 3IR9A 2HP0A 3I55F 4I50B 5GONA 3LWQC 3F0EA 4ERHA 1QVFF 3K0TA 3HKDA 1Q82H 3P10A 2L26A 5EZYB 3CYQA 3WGMA 4YJ3B 2ALEA 2I6RA 4I4TA 4I55B 1VQVA 4IHJB 5LA6A 3RYFA 2HX0A 4IIJA 1W5BA 1YJ9F 5IJ9B 3E22B 2VGMA 2PMPA 3LWVC 2EWCA 2WALA 3KJKA 1KD1H 3V7QA 3I56F 3FD5A 5KMGA 3HJWC 1FSZA 1Q7YH 1H47A 3M1XA 5CB4A 4LNUB 1NJIH 5GIOC 1TVKB 1W5AA 1VQPF 5GANK 3RA6A 4ZOLB 4O2BA 3E1YA 3J80M 3WGLA 3RE3A 2RHLA 5EYPA 3VIUA 3CMAF 4X20B 5JQGA 3UT5A 1QD9A 3LMEA 2CWJA 3JASA 3N2GA 5EAZA 2CHTA 1W42A 1DBFA 3KIZA 3Q8HA 2QEXF 1RLUA 1YJNF 1JY8A 4ZHWA 2N48A 5G4VC 3NVKE 4TV9B 5BMVB 1XV2A 5LYJB 3CCEF 1R1MA 3LWPC 4DRXB 4X3LA 2LBXA 4O4HB 5G4UC 1OAPA 4HNAB 5LOVA 4O4LA 3WJQA 1FFXA 2UYNA 4C8EA 4BT7A 3ZP4A 4BVRA 3IEWA 2V9YA 4ZHVA 2VXYA 2ZODA 5FNVA 4TUYB 4WBNB 1X52A 4BT4A 2UYPA 2Z1UA 3I3FA 2CW4A 4ZI7A 3G4SF 1Q86H 3JVHA 4X1IB 2VAWA 2HVYD 4R40B 2B33A 5JH7B 3JALA 2R751 5MN4A 4X3MA 3WXMB 3TD4A 1VQLF 1GO0A 4BT6A 2KG4A 2OTLF 5IYZB 3CC7F 3VYUC 1YI2F 4FFBA 2UYJA 3MQWA 4O2AA 3S0HA 4X1KB 3CB2A 1SDSA 1VQMF 2LCAA 5J2TA 4O4IA 3CCLF 3MCAB 1JFFA 2QTPA 1VQOF 1K9MH 1H7MA 2KGWA 1IV1A 3RYHB 2RB9A 3CCQF 2W8BC 4U3JA 2ZF8A 5LP6A 4C8GA 1YJWF 3IKFA 2HP3A 2HS4A 5IJ0B 3L7QA 5IT9M 3HWUA 4G88A 2ZOVA 3P0ZA 3CCVF 3RYCB 2R6R1 2Z1TA 3HKCB 3HKBB 5EO3A 1W5FA 4YJ2B 1Z5WA 3KE1A 2VAMA 4C82A 1CN7A 2HS0A 3DDNA 3WJPA 3CC4F 1DT9A 3GTZA 2HP0B 2QI2A 4X1YA 3S06A 3T80A 2H8EA 4B45A 3HKDB 3CC2F 3ZP7A 3IMPA 5JCOA 3BYQA 5LP6C 5KX5B 3ERNA 1RLGA 3WPWA 4I4TB 3RYFB 2GZLA 3FBAA 5LA6B 1PXWA 5HY1A 3JAKA 4G4VA 5EWRA 3QUWA 4C81A 3F0FA 3K12A 3QTYA 3LYBA 4I50A 5HXUA 3OBYA 1VH8A 3VYSC 3VYTC 3F0DA 5EZYA 5KMGB 2BTOA 4I55A 3VCZA 3WJRA 5CB4B 3OBWA 3R0PA 5EB1B 5DCVA 4B46A 3TD3A 5JCOC 2FC3A 3VOBA 5EYPB 2CZWA 5JQGB 3UT5B 3RYIA 3JASB 2YYEA 5FJ4C 3CCUF 4LNUA 1X7OA 2DYYA 4B62A 3CMEF 1W581 1QAHA 1TVKA 2UYKA 5EIBD 4C8IA 1KQSF 5JVDA 4LCKA 1Q8RA 2Q1XA 4ZOLA 3C9UA 1FNJA 1W57A 4F6RB 2CHSA 4XCQA 3NMUC 2Z01A 3WPXA 3C9SA 2OTJF 3CCRF 1U3LA 2PHNA 4O4LB 2BTQB 3NVIB 3M84A 2UYNB 1NQ3A 2IAFA 5HP8A 4B5CA 1W5EA 3OONA 3CG6A 1X7PA 2HRYA 3FPIA 1JD1A 4TV9A 2RHOA 5C8YA 1YIJF 1UFYA 3J7AR 2AIZP 1VQ8F 3FFMA 3QHDA 1W59A 4HNAA 2HS3A 1M1KH 5CA0B 1VQ6F 3FD6A 1RA4A 3JALB 3MDOA 1KC8H 1CLIA 1JN1A 1JJ2F 2LBTA 3JARA 4TUYA 4WBNA 5AVMA 1E7KA 1QVGF 2DT4A 2Z1EA 5ITZB 2FGYA 1IPAA 3M4SA 3V7EA 4EB6B 1IV2A 1TUBB 2G9IA 4ZK7A 4BVQA 4X1IA 4BT3A 1ODEA 4FFBB 1YQNA 3V4DA 1W41A 5LXTA 3LWOC 1K8AH 1VQKF 5JH7A 3HKEA 5J2TB 4O4IB 4ZHQB 3JCMM 3DC2A 1JFFB 1YGYA 3E20B 3CCJF 3LWRC 2YXZA 5CA1B 2CSLA 3JAWB 1U43A 2GVIA 4BW0B 4ZHYB 5IYZA 4G4WA 1SZQA 4TV8B 3C8LA 4O4JB 3VMFB 2AMTA 2IQQA 5FLXM 4U3JB 3ON1A 3KJJA 2OTMA 4KWEA 4RHAA 4U39A 5B8FA 3CPWF 3VTIC 3TD5A 1KNJA 3C9RA 3D00A 1SA0B 1J7HA 3JATB 1OFUA 5J2UB 3AGKA 3F6MA 4BVTA 3ESJA
chains in the Genus database with same CATH topology
5IJ0A 4HNAB 5ITZA 5LOVA 5GONB 5CB4B 4EB6A 4O4LA 1TUBA 1FFXA 4X1KA 3WGKA 5LP6B 4B46A 2VXYA 5FNVA 3HKCA 5JCOC 4TUYB 2Q1YA 4WBNB 3WGJA 3N2KA 3VOBA 4ZI7A 4ZHQA 5EYPB 4IIJB 5JQGB 3UT5B 3RYHA 3RYIA 3JASB 5CA1A 3JAWA 1RQ7A 4X1IB 4E6EA 4LNUA 2VAWA 1W581 1TVKA 4TV8A 5EIBD 5JH7B 3JALA 4DXDA 4O4JA 2R751 5JVDA 2VAPA 2Q1XA 4ZOLA 5MN4A 4YJ3A 5KX5A 4IHJA 4F6RB 3VO8A 2BTOA 5EIBC 5IYZB 5IJ9A 4X1YB 3E22A 4O4LB 2BTQB 4FFBA 4O2AA 3RYCA 4X1KB 3CB2A 4O2BB 3HKBA 1W5EA 5J2TA 1SA0A 5MN6A 4TV9A 4O4IA 2RHOA 4YJ2A 3JATA 3N2KB 5C8YA 1JFFA 2RHHA 3JAKB 5J2UA 2RHJA 3N2GB 3VOAA 3RYHB 1W59A 4HNAA 3RYIB 4I50B 5GONA 5CA0B 3HKDA 4U3JA 5LP6A 3JALB 5JVDB 5MN5A 5EZYB 3WGMA 4YJ3B 3JARA 4I4TA 4I55B 4IHJB 4TUYA 3RYFA 4X20A 5LA6A 4WBNA 5IJ0B 5ITZB 5LOVB 4IIJA 1W5BA 4EB6B 1TUBB 1FFXB 5IJ9B 3E22B 4X1IA 4FFBB 5LXTA 3RYCB 2R6R1 5FNVB 3HKCB 3HKBB 3HKEA 5JH7A 5BMVA 5LYJA 1W5FA 4ZI7B 5KMGA 5J2TB 4O4IB 4YJ2B 4DRXA 4ZHQB 1Z5WA 1Z5VA 4O4HA 4F6RA 1JFFB 5C8YB 2VAMA 4M8IA 1FSZA 5CA1B 3JAWB 2GVIA 5CB4A 4LNUB 5IYZA 1TVKB 1W5AA 4TV8B 4X1YA 3C8LA 4O4JB 4B45A 3HKDB 4U3JB 1RQ2A 4ZOLB 5JCOA 4O2BA 5LP6C 5KX5B 3WGLA 2RHLA 3JARB 4I4TB 4KWEA 4U39A 5EYPA 3RYFB 4X20B 5LA6B 5JQGA 3UT5A 3JAKA 3JASA 3N2GA 3WGNA 4O2AB 4I50A 1RLUA 5CA0A 5LXTB 1SA0B 4TV9B 3HKEB 3JATB 5BMVB 5LYJB 1OFUA 5EZYA 5KMGB 5J2UB 4DRXB 4I55A 4O4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJ0 A;  4HNA B;  5ITZ A;  5LOV A;  5GON B;  5CB4 B;  4EB6 A;  4O4L A;  1TUB A;  1FFX A;  4X1K A;  3WGK A;  5LP6 B;  4B46 A;  2VXY A;  5FNV A;  3HKC A;  5JCO C;  4TUY B;  2Q1Y A;  4WBN B;  3WGJ A;  3N2K A;  3VOB A;  4ZI7 A;  4ZHQ A;  5EYP B;  4IIJ B;  5JQG B;  3UT5 B;  3RYH A;  3RYI A;  3JAS B;  5CA1 A;  3JAW A;  1RQ7 A;  4X1I B;  4E6E A;  4LNU A;  2VAW A;  1W58 1;  1TVK A;  4TV8 A;  5EIB D;  5JH7 B;  3JAL A;  4DXD A;  4O4J A;  2R75 1;  5JVD A;  2VAP A;  2Q1X A;  4ZOL A;  5MN4 A;  4YJ3 A;  5KX5 A;  4IHJ A;  4F6R B;  3VO8 A;  2BTO A;  5EIB C;  5IYZ B;  5IJ9 A;  4X1Y B;  3E22 A;  4O4L B;  2BTQ B;  4FFB A;  4O2A A;  3RYC A;  4X1K B;  3CB2 A;  4O2B B;  3HKB A;  1W5E A;  5J2T A;  1SA0 A;  5MN6 A;  4TV9 A;  4O4I A;  2RHO A;  4YJ2 A;  3JAT A;  3N2K B;  5C8Y A;  1JFF A;  2RHH A;  3JAK B;  5J2U A;  2RHJ A;  3N2G B;  3VOA A;  3RYH B;  1W59 A;  4HNA A;  3RYI B;  4I50 B;  5GON A;  5CA0 B;  3HKD A;  4U3J A;  5LP6 A;  3JAL B;  5JVD B;  5MN5 A;  5EZY B;  3WGM A;  4YJ3 B;  3JAR A;  4I4T A;  4I55 B;  4IHJ B;  4TUY A;  3RYF A;  4X20 A;  5LA6 A;  4WBN A;  5IJ0 B;  5ITZ B;  5LOV B;  4IIJ A;  1W5B A;  4EB6 B;  1TUB B;  1FFX B;  5IJ9 B;  3E22 B;  4X1I A;  4FFB B;  5LXT A;  3RYC B;  2R6R 1;  5FNV B;  3HKC B;  3HKB B;  3HKE A;  5JH7 A;  5BMV A;  5LYJ A;  1W5F A;  4ZI7 B;  5KMG A;  5J2T B;  4O4I B;  4YJ2 B;  4DRX A;  4ZHQ B;  1Z5W A;  1Z5V A;  4O4H A;  4F6R A;  1JFF B;  5C8Y B;  2VAM A;  4M8I A;  1FSZ A;  5CA1 B;  3JAW B;  2GVI A;  5CB4 A;  4LNU B;  5IYZ A;  1TVK B;  1W5A A;  4TV8 B;  4X1Y A;  3C8L A;  4O4J B;  4B45 A;  3HKD B;  4U3J B;  1RQ2 A;  4ZOL B;  5JCO A;  4O2B A;  5LP6 C;  5KX5 B;  3WGL A;  2RHL A;  3JAR B;  4I4T B;  4KWE A;  4U39 A;  5EYP A;  3RYF B;  4X20 B;  5LA6 B;  5JQG A;  3UT5 A;  3JAK A;  3JAS A;  3N2G A;  3WGN A;  4O2A B;  4I50 A;  1RLU A;  5CA0 A;  5LXT B;  1SA0 B;  4TV9 B;  3HKE B;  3JAT B;  5BMV B;  5LYJ B;  1OFU A;  5EZY A;  5KMG B;  5J2U B;  4DRX B;  4I55 A;  4O4H B; 
#chains in the Genus database with same CATH topology
 5IJ0 A;  1GZ0 A;  3ZO8 A;  5GON B;  5GIN C;  3KHN A;  3PAF A;  3S0Y A;  1T0A A;  5HXZ A;  3NK6 A;  3HKC A;  4BY9 D;  2Q1Y A;  1H48 A;  3N2K A;  3WGJ A;  3VI6 A;  3O85 A;  4IIJ B;  4C4W C;  2ZVZ A;  2BTU A;  2NMU A;  3NK7 A;  1FNK A;  5HY0 A;  1RQ7 A;  5HY4 A;  2Z1F A;  1UI9 A;  4DXD A;  2VAP A;  3RA5 A;  4YJ3 A;  5KX5 A;  4IHJ A;  3ELC A;  2H6L A;  1W2B F;  2ZVY A;  5IJ9 A;  3I7T A;  3HAX D;  3E22 A;  5GAP K;  5HWE A;  4O2B B;  3K14 A;  1N8R H;  4G4Z A;  3N2G B;  3VOA A;  1ONI A;  3CPQ A;  3RYI B;  2CVL A;  1T0K B;  3N4Z A;  4NUT A;  3SIV A;  2I6D A;  5JVD B;  3U0O A;  5MN5 A;  1ZWZ A;  2BO1 A;  2AIF A;  5A2Q M;  4X20 A;  5HP7 A;  5LOV B;  3J81 M;  4BT5 A;  3S0W A;  3V3T A;  3PLA C;  2KTV A;  1FFX B;  1PF5 A;  2QA4 F;  4PWT A;  2UZH A;  5FNV B;  1VQN F;  5BMV A;  5LYJ A;  3MBM A;  4ZI7 B;  3CCM F;  4DRX A;  1KNK A;  3G6E F;  1Z5V A;  4O4H A;  4F6R A;  5C8Y B;  3CCS F;  4M8I A;  4BVS A;  1GO1 A;  4EI9 A;  2OHW A;  2MQE A;  3D54 A;  1IV3 A;  3S02 A;  1RQ2 A;  1W3E X;  4G4X A;  4RQO A;  3SIU A;  3EOR A;  4NQ3 A;  3JAR B;  5HY2 A;  1XHO A;  1U40 A;  3WGN A;  4BT2 A;  1NMU B;  4O2A B;  1VQ7 F;  5CA0 A;  5LXT B;  3IKE A;  1VQ4 F;  1VK3 A;  1VQ9 F;  2JNB A;  3D01 A;  3HKE B;  2K1S A;  3IEQ A;  2KTU A;  3JAM M;  1GX1 A;  1YHQ F;  1YIT F;  1K73 H;  3G71 F;  2HRU A;  1X25 A;  1S72 F;  1W55 A;  5ITZ A;  2OZB A;  3HTN A;  4NWO B;  4EB6 A;  3CD6 F;  1TUB A;  1XBI A;  4G4Y A;  5GIP C;  4X1K A;  3WGK A;  5LP6 B;  3LFO A;  1M90 H;  2GLZ A;  2IG8 A;  3C9T A;  2HQS C;  4ZHQ A;  4EI8 A;  2VGN A;  3RYH A;  5CA1 A;  3JAW A;  2H8C A;  1XRG A;  4E6E A;  3OW2 F;  3GYQ A;  4TV8 A;  4EI7 A;  1QU9 A;  1VHA A;  3P4E A;  1U3P A;  3K2X A;  4O4J A;  3B6N A;  1VQ5 F;  2ZAU A;  3S03 A;  3MCQ A;  3VO8 A;  2F9Z C;  5EIB C;  3N4Y A;  1Q81 H;  2LBW A;  4X1Y B;  1CK2 A;  3CYP B;  1COM A;  5EB0 A;  3GHZ A;  2P6Y A;  3RYC A;  3CXC F;  1W40 A;  1IV4 A;  3F0G A;  3HKB A;  3ZOP A;  1SA0 A;  3LDT A;  5MN6 A;  4YJ2 A;  3JAT A;  3N2K B;  2RHH A;  3JAK B;  5J2U A;  4TZZ A;  2RHJ A;  3IR9 A;  2HP0 A;  3I55 F;  4I50 B;  5GON A;  3LWQ C;  3F0E A;  4ERH A;  1QVF F;  3K0T A;  3HKD A;  1Q82 H;  3P10 A;  2L26 A;  5EZY B;  3CYQ A;  3WGM A;  4YJ3 B;  2ALE A;  2I6R A;  4I4T A;  4I55 B;  1VQV A;  4IHJ B;  5LA6 A;  3RYF A;  2HX0 A;  4IIJ A;  1W5B A;  1YJ9 F;  5IJ9 B;  3E22 B;  2VGM A;  2PMP A;  3LWV C;  2EWC A;  2WAL A;  3KJK A;  1KD1 H;  3V7Q A;  3I56 F;  3FD5 A;  5KMG A;  3HJW C;  1FSZ A;  1Q7Y H;  1H47 A;  3M1X A;  5CB4 A;  4LNU B;  1NJI H;  5GIO C;  1TVK B;  1W5A A;  1VQP F;  5GAN K;  3RA6 A;  4ZOL B;  4O2B A;  3E1Y A;  3J80 M;  3WGL A;  3RE3 A;  2RHL A;  5EYP A;  3VIU A;  3CMA F;  4X20 B;  5JQG A;  3UT5 A;  1QD9 A;  3LME A;  2CWJ A;  3JAS A;  3N2G A;  5EAZ A;  2CHT A;  1W42 A;  1DBF A;  3KIZ A;  3Q8H A;  2QEX F;  1RLU A;  1YJN F;  1JY8 A;  4ZHW A;  2N48 A;  5G4V C;  3NVK E;  4TV9 B;  5BMV B;  1XV2 A;  5LYJ B;  3CCE F;  1R1M A;  3LWP C;  4DRX B;  4X3L A;  2LBX A;  4O4H B;  5G4U C;  1OAP A;  4HNA B;  5LOV A;  4O4L A;  3WJQ A;  1FFX A;  2UYN A;  4C8E A;  4BT7 A;  3ZP4 A;  4BVR A;  3IEW A;  2V9Y A;  4ZHV A;  2VXY A;  2ZOD A;  5FNV A;  4TUY B;  4WBN B;  1X52 A;  4BT4 A;  2UYP A;  2Z1U A;  3I3F A;  2CW4 A;  4ZI7 A;  3G4S F;  1Q86 H;  3JVH A;  4X1I B;  2VAW A;  2HVY D;  4R40 B;  2B33 A;  5JH7 B;  3JAL A;  2R75 1;  5MN4 A;  4X3M A;  3WXM B;  3TD4 A;  1VQL F;  1GO0 A;  4BT6 A;  2KG4 A;  2OTL F;  5IYZ B;  3CC7 F;  3VYU C;  1YI2 F;  4FFB A;  2UYJ A;  3MQW A;  4O2A A;  3S0H A;  4X1K B;  3CB2 A;  1SDS A;  1VQM F;  2LCA A;  5J2T A;  4O4I A;  3CCL F;  3MCA B;  1JFF A;  2QTP A;  1VQO F;  1K9M H;  1H7M A;  2KGW A;  1IV1 A;  3RYH B;  2RB9 A;  3CCQ F;  2W8B C;  4U3J A;  2ZF8 A;  5LP6 A;  4C8G A;  1YJW F;  3IKF A;  2HP3 A;  2HS4 A;  5IJ0 B;  3L7Q A;  5IT9 M;  3HWU A;  4G88 A;  2ZOV A;  3P0Z A;  3CCV F;  3RYC B;  2R6R 1;  2Z1T A;  3HKC B;  3HKB B;  5EO3 A;  1W5F A;  4YJ2 B;  1Z5W A;  3KE1 A;  2VAM A;  4C82 A;  1CN7 A;  2HS0 A;  3DDN A;  3WJP A;  3CC4 F;  1DT9 A;  3GTZ A;  2HP0 B;  2QI2 A;  4X1Y A;  3S06 A;  3T80 A;  2H8E A;  4B45 A;  3HKD B;  3CC2 F;  3ZP7 A;  3IMP A;  5JCO A;  3BYQ A;  5LP6 C;  5KX5 B;  3ERN A;  1RLG A;  3WPW A;  4I4T B;  3RYF B;  2GZL A;  3FBA A;  5LA6 B;  1PXW A;  5HY1 A;  3JAK A;  4G4V A;  5EWR A;  3QUW A;  4C81 A;  3F0F A;  3K12 A;  3QTY A;  3LYB A;  4I50 A;  5HXU A;  3OBY A;  1VH8 A;  3VYS C;  3VYT C;  3F0D A;  5EZY A;  5KMG B;  2BTO A;  4I55 A;  3VCZ A;  3WJR A;  5CB4 B;  3OBW A;  3R0P A;  5EB1 B;  5DCV A;  4B46 A;  3TD3 A;  5JCO C;  2FC3 A;  3VOB A;  5EYP B;  2CZW A;  5JQG B;  3UT5 B;  3RYI A;  3JAS B;  2YYE A;  5FJ4 C;  3CCU F;  4LNU A;  1X7O A;  2DYY A;  4B62 A;  3CME F;  1W58 1;  1QAH A;  1TVK A;  2UYK A;  5EIB D;  4C8I A;  1KQS F;  5JVD A;  4LCK A;  1Q8R A;  2Q1X A;  4ZOL A;  3C9U A;  1FNJ A;  1W57 A;  4F6R B;  2CHS A;  4XCQ A;  3NMU C;  2Z01 A;  3WPX A;  3C9S A;  2OTJ F;  3CCR F;  1U3L A;  2PHN A;  4O4L B;  2BTQ B;  3NVI B;  3M84 A;  2UYN B;  1NQ3 A;  2IAF A;  5HP8 A;  4B5C A;  1W5E A;  3OON A;  3CG6 A;  1X7P A;  2HRY A;  3FPI A;  1JD1 A;  4TV9 A;  2RHO A;  5C8Y A;  1YIJ F;  1UFY A;  3J7A R;  2AIZ P;  1VQ8 F;  3FFM A;  3QHD A;  1W59 A;  4HNA A;  2HS3 A;  1M1K H;  5CA0 B;  1VQ6 F;  3FD6 A;  1RA4 A;  3JAL B;  3MDO A;  1KC8 H;  1CLI A;  1JN1 A;  1JJ2 F;  2LBT A;  3JAR A;  4TUY A;  4WBN A;  5AVM A;  1E7K A;  1QVG F;  2DT4 A;  2Z1E A;  5ITZ B;  2FGY A;  1IPA A;  3M4S A;  3V7E A;  4EB6 B;  1IV2 A;  1TUB B;  2G9I A;  4ZK7 A;  4BVQ A;  4X1I A;  4BT3 A;  1ODE A;  4FFB B;  1YQN A;  3V4D A;  1W41 A;  5LXT A;  3LWO C;  1K8A H;  1VQK F;  5JH7 A;  3HKE A;  5J2T B;  4O4I B;  4ZHQ B;  3JCM M;  3DC2 A;  1JFF B;  1YGY A;  3E20 B;  3CCJ F;  3LWR C;  2YXZ A;  5CA1 B;  2CSL A;  3JAW B;  1U43 A;  2GVI A;  4BW0 B;  4ZHY B;  5IYZ A;  4G4W A;  1SZQ A;  4TV8 B;  3C8L A;  4O4J B;  3VMF B;  2AMT A;  2IQQ A;  5FLX M;  4U3J B;  3ON1 A;  3KJJ A;  2OTM A;  4KWE A;  4RHA A;  4U39 A;  5B8F A;  3CPW F;  3VTI C;  3TD5 A;  1KNJ A;  3C9R A;  3D00 A;  1SA0 B;  1J7H A;  3JAT B;  1OFU A;  5J2U B;  3AGK A;  3F6M A;  4BVT A;  3ESJ A; 
#chains in the Genus database with same CATH homology
 5IJ0 A;  4HNA B;  5ITZ A;  5LOV A;  5GON B;  5CB4 B;  4EB6 A;  4O4L A;  1TUB A;  1FFX A;  4X1K A;  3WGK A;  5LP6 B;  4B46 A;  2VXY A;  5FNV A;  3HKC A;  5JCO C;  4TUY B;  2Q1Y A;  4WBN B;  3WGJ A;  3N2K A;  3VOB A;  4ZI7 A;  4ZHQ A;  5EYP B;  4IIJ B;  5JQG B;  3UT5 B;  3RYH A;  3RYI A;  3JAS B;  5CA1 A;  3JAW A;  1RQ7 A;  4X1I B;  4E6E A;  4LNU A;  2VAW A;  1W58 1;  1TVK A;  4TV8 A;  5EIB D;  5JH7 B;  3JAL A;  4DXD A;  4O4J A;  2R75 1;  5JVD A;  2VAP A;  2Q1X A;  4ZOL A;  5MN4 A;  4YJ3 A;  5KX5 A;  4IHJ A;  4F6R B;  3VO8 A;  2BTO A;  5EIB C;  5IYZ B;  5IJ9 A;  4X1Y B;  3E22 A;  4O4L B;  2BTQ B;  4FFB A;  4O2A A;  3RYC A;  4X1K B;  3CB2 A;  4O2B B;  3HKB A;  1W5E A;  5J2T A;  1SA0 A;  5MN6 A;  4TV9 A;  4O4I A;  2RHO A;  4YJ2 A;  3JAT A;  3N2K B;  5C8Y A;  1JFF A;  2RHH A;  3JAK B;  5J2U A;  2RHJ A;  3N2G B;  3VOA A;  3RYH B;  1W59 A;  4HNA A;  3RYI B;  4I50 B;  5GON A;  5CA0 B;  3HKD A;  4U3J A;  5LP6 A;  3JAL B;  5JVD B;  5MN5 A;  5EZY B;  3WGM A;  4YJ3 B;  3JAR A;  4I4T A;  4I55 B;  4IHJ B;  4TUY A;  3RYF A;  4X20 A;  5LA6 A;  4WBN A;  5IJ0 B;  5ITZ B;  5LOV B;  4IIJ A;  1W5B A;  4EB6 B;  1TUB B;  1FFX B;  5IJ9 B;  3E22 B;  4X1I A;  4FFB B;  5LXT A;  3RYC B;  2R6R 1;  5FNV B;  3HKC B;  3HKB B;  3HKE A;  5JH7 A;  5BMV A;  5LYJ A;  1W5F A;  4ZI7 B;  5KMG A;  5J2T B;  4O4I B;  4YJ2 B;  4DRX A;  4ZHQ B;  1Z5W A;  1Z5V A;  4O4H A;  4F6R A;  1JFF B;  5C8Y B;  2VAM A;  4M8I A;  1FSZ A;  5CA1 B;  3JAW B;  2GVI A;  5CB4 A;  4LNU B;  5IYZ A;  1TVK B;  1W5A A;  4TV8 B;  4X1Y A;  3C8L A;  4O4J B;  4B45 A;  3HKD B;  4U3J B;  1RQ2 A;  4ZOL B;  5JCO A;  4O2B A;  5LP6 C;  5KX5 B;  3WGL A;  2RHL A;  3JAR B;  4I4T B;  4KWE A;  4U39 A;  5EYP A;  3RYF B;  4X20 B;  5LA6 B;  5JQG A;  3UT5 A;  3JAK A;  3JAS A;  3N2G A;  3WGN A;  4O2A B;  4I50 A;  1RLU A;  5CA0 A;  5LXT B;  1SA0 B;  4TV9 B;  3HKE B;  3JAT B;  5BMV B;  5LYJ B;  1OFU A;  5EZY A;  5KMG B;  5J2U B;  4DRX B;  4I55 A;  4O4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...