1K73H

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k73H00
5IT9M 3CPWF 3SIUA 3E20B 2QEXF 3RA5A 1DT9A 5G4UC 3HJWC 2I6DA 1SDSA 1QVFF 3FFMA 4TZZA 1YI2F 2OZBA 5FJ4C 2AIFA 1X7PA 3I56F 5DCVA 1XBIA 2KTUA 1VQNF 1RA4A 1YHQF 3CCQF 3N4YA 2OTLF 3J81M 1K9MH 1X7OA 2BO1A 3CCUF 5GIOC 3CXCF 1Q82H 3LWRC 3OW2F 4X3LA 1JJ2F 1KQSF 3PLAC 3CCVF 4X3MA 3N4ZA 1VQMF 2FC3A 1KD1H 3CD6F 1YITF 2OTJF 3CCEF 1E7KA 1CK2A 2HVYD 1S72F 1VQLF 3JAMM 1QVGF 3VMFB 3CCRF 1W40A 1PXWA 1GZ0A 3MCAB 1VQKF 3NK6A 1M90H 5GIPC 3CCJF 1ZWZA 3CCMF 3NMUC 5G4VC 3V7QA 2KTVA 1VQ5F 1N8RH 1GO0A 3JCMM 1GO1A 5GANK 4C4WC 2VGMA 5GINC 3LFOA 1M1KH 2VGNA 2WALA 1K73H 3J80M 5EO3A 2KG4A 3SIVA 3G6EF 2OHWA 3WXMB 3GYQA 2LBXA 1VQ6F 1T0KB 3IR9A 3J7AR 3CG6A 2QA4F 1H7MA 1CN7A 3LWQC 3VI6A 5A2QM 1K8AH 3G4SF 4NUTA 3I55F 3LWPC 1YIJF 3CCSF 3OBYA 5GAPK 3CCLF 3V7EA 1RLGA 3HAXD 3CC2F 1VQ8F 1YJWF 1NMUB 2CZWA 3NK7A 1YJ9F 3ON1A 1VQ4F 1NJIH 4BW0B 3O85A 1W2BF 1Q81H 3PAFA 2JNBA 1VQ9F 1W42A 3G71F 3NVIB 1W41A 1VQOF 3RA6A 4LCKA 3CPQA 2QI2A 3CMEF 1IPAA 5FLXM 3CC4F 1VQPF 1VQ7F 3AGKA 2ALEA 4BY9D 3LWVC 3CMAF 3CC7F 1W3EX 1X52A 1YJNF 3NVKE 2LBWA 1Q7YH 5EWRA 1KC8H 1Q86H 3E1YA 3OBWA 3LWOC
chains in the Genus database with same CATH superfamily
3WJQA 1COMA 5IT9M 2KGWA 2UYPA 1U40A 3JATB 3WGNA 3RA5A 2G9IA 2W8BC 1DT9A 2B33A 4X1KB 1QVFF 3JAWB 4O4IA 1RQ7A 3JALB 1IV1A 4C8GA 4TZZA 4B62A 1YI2F 1U3PA 4FFBB 2OZBA 4BVTA 5LOVB 1J7HA 1RA4A 5IYZB 3CCQF 1DBFA 2OTLF 3S03A 1K9MH 4ZHQA 2R6R1 4O4HA 1Q82H 3LWRC 3VYSC 4X3LA 3HKBB 3PLAC 4BT6A 3T80A 3CCVF 4X3MA 1KD1H 1VQMF 2FC3A 3JALA 2OTJF 2ZF8A 2CHSA 3WGLA 3WGKA 3CYPB 4ZOLA 5CA1B 1GZ0A 3D00A 2HQSC 3K14A 4I50A 4ZI7A 4TV9B 3S06A 2UYNA 1VHAA 3S0HA 3NMUC 1VQ5F 4ERHA 1GO0A 4YJ3B 1PF5A 3U0OA 2BTUA 4BT4A 2ZODA 3C8LA 4O2AB 1Z5VA 3UT5A 4I55B 3RYFA 4O4LB 2VGNA 4NQ3A 4F6RA 2CHTA 3UT5B 4DRXB 5JQGB 3J80M 3SIVA 4G4XA 4C82A 3HTNA 1IV4A 3E22A 4B46A 4O2BA 1VH8A 2EWCA 2UYJA 3J7AR 3ZP7A 1CN7A 2UYNB 4ZI7B 3VI6A 5EAZA 4HNAA 3TD3A 1K8AH 3ZP4A 2ZAUA 3B6NA 1YIJF 3HKDA 3GTZA 5LP6C 2Z1FA 1OFUA 2ZOVA 1FFXA 3ZOPA 1RLGA 4LNUA 3M1XA 2CZWA 2GZLA 4TV8A 1YJ9F 3ON1A 4DXDA 1Q81H 5CA0B 3ELCA 3E22B 1R1MA 3KE1A 2L26A 5EYPA 3RA6A 5LYJB 2H8EA 4F6RB 1W5AA 3IKEA 2H8CA 3CC4F 3GHZA 1VQPF 3JAKB 2ALEA 3K2XA 2CSLA 1VQVA 3JAWA 4O4IB 1KC8H 1U43A 5MN5A 3LMEA 3HKEA 5LXTB 1FNJA 3D54A 3VOAA 3LWOC 5KMGA 3E20B 3HKEB 2RHJA 5LXTA 2QEXF 4X1IA 2FGYA 1SDSA 2HS4A 3P0ZA 4G4VA 3F0GA 3S0WA 5JVDB 2IAFA 1QAHA 5J2UA 5DCVA 4M8IA 3CYQA 4BVRA 1SA0B 3KJJA 5MN6A 2Z01A 1W581 1FSZA 4BVSA 5CA0A 3I7TA 3RE3A 3LDTA 3QHDA 3RYHA 1W57A 2YYEA 3OONA 4G88A 4DRXA 3OW2F 1JJ2F 2HRYA 2PHNA 5LYJA 5JVDA 2N48A 1TUBA 3HKCB 3RYCB 1H47A 3NK6A 3MBMA 5ITZA 5GIPC 3M84A 3S0YA 3WPWA 3V7QA 4PWTA 4LNUB 5EZYB 4X1YA 2MQEA 5HY4A 5GANK 3F6MA 3MQWA 3L7QA 1U3LA 3BYQA 2WALA 5EIBD 1IV2A 4I4TA 4BT2A 2I6RA 5EO3A 4ZHQB 3G6EF 2OHWA 3WXMB 3WJRA 2GVIA 1T0KB 3IR9A 2QTPA 1YGYA 5ITZB 2QA4F 3RYCA 5KX5B 3VYTC 3G4SF 5CA1A 3WGJA 1QD9A 3LWPC 3CCSF 1XRGA 3V7EA 3N2GA 4X1YB 3FD5A 1VQ8F 1YJWF 1NMUB 5HP8A 1W5BA 3NK7A 4HNAB 2F9ZC 5FNVA 3VOBA 4BW0B 1W2BF 5EB1B 2HX0A 5FNVB 5IJ0B 1W42A 3G71F 3NVIB 1SA0A 2R751 2QI2A 1IPAA 3K0TA 4IIJB 1W55A 3C9UA 3F0FA 4BT5A 1JN1A 2YXZA 2P6YA 3AGKA 4G4YA 3RYHB 2GLZA 3CC7F 4IHJA 3V3TA 1FNKA 2Z1EA 5EWRA 4B45A 4ZHWA 4EI8A 3KIZA 3IKFA 5J2UB 3LYBA 5JCOA 1Z5WA 1XV2A 4C8IA 3ERNA 3MDOA 2Z1TA 4E6EA 1KNJA 2I6DA 1ODEA 3WJPA 4IIJA 3I3FA 3RYFB 2AIFA 3P4EA 4B5CA 2H6LA 2KTUA 5AVMA 2LBTA 3VCZA 1YHQF 4YJ3A 2UYKA 4G4WA 3J81M 4X1IB 1H48A 3CCUF 3CXCF 3Q8HA 3JAKA 4RHAA 2Q1YA 4X20B 4O4JB 3N4ZA 3CD6F 3CCEF 2AMTA 1Q8RA 3JASB 3RYIB 1CK2A 1E7KA 1S72F 3JAMM 5HXZA 4KWEA 3VMFB 3CCRF 5KMGB 1W40A 1JFFA 1SZQA 4EI9A 1VQKF 1W5EA 3WPXA 3VIUA 5G4VC 2KTVA 1OAPA 3P10A 4YJ2B 2VAPA 3F0EA 1RLUA 5GINC 3LFOA 4FFBA 3HKBA 5HY1A 1K73H 4NWOB 2KG4A 1W59A 3F0DA 2DT4A 5EZYA 4WBNA 1ONIA 3KHNA 2RHOA 2LBXA 4ZHVA 4EB6B 3DDNA 4I50B 4ZOLB 4NUTA 3HWUA 4G4ZA 4O2AA 1FFXB 1TUBB 1JY8A 3QUWA 3CC2F 2RB9A 4TUYA 4O4LA 3JATA 5HXUA 5B8FA 4O4HB 5LP6B 3M4SA 3KJKA 5EYPB 2K1SA 1IV3A 4O2BB 1VQ4F 3IEWA 2Z1UA 2JNBA 1VQ9F 2IG8A 1VQOF 4TV8B 4I4TB 1JD1A 4LCKA 3WGMA 5FLXM 3IEQA 4I55A 5CB4B 2ZVZA 5IJ9A 5BMVA 3MCQA 3TD4A 5MN4A 3LWVC 2PMPA 3CMAF 1W3EX 1YJNF 5EIBC 2LBWA 5GONA 1Q7YH 2CWJA 4YJ2A 5LA6B 5LOVA 2NMUA 4ZK7A 1Q86H 3OBWA 2HP0A 4C8EA 3CPWF 3TD5A 3SIUA 1JFFB 4RQOA 3D01A 5G4UC 3HJWC 1XHOA 5HY2A 3ZO8A 2HRUA 4IHJB 5J2TB 3FFMA 3C9RA 5BMVB 5FJ4C 4O4JA 1X7PA 4EI7A 3I56F 1XBIA 5CB4A 1UI9A 2IQQA 2VAWA 1VQNF 4X1KA 2CW4A 3N4YA 2RHHA 4WBNB 2AIZP 5JCOC 1X7OA 3QTYA 2BO1A 4TV9A 1W5FA 5GIOC 2HP0B 2CVLA 5HWEA 1KQSF 1VK3A 5IJ9B 5EB0A 1YITF 2BTOA 1X25A 2HVYD 2OTMA 3HKDB 3K12A 3N2GB 1VQLF 4BVQA 1QVGF 1TVKB 1PXWA 5C8YB 3JARA 3MCAB 5KX5A 1M90H 3S02A 3IMPA 2ZVYA 3CCJF 3JARB 1ZWZA 3CCMF 3R0PA 4TUYB 4EB6A 1N8RH 2BTQB 3JCMM 1GO1A 3JASA 2RHLA 4U3JA 3RYIA 2HS0A 1KNKA 4C4WC 5LP6A 2VGMA 3VTIC 1T0AA 3JVHA 1M1KH 2VAMA 2HP3A 4U3JB 1RQ2A 3CB2A 5IJ0A 4BT3A 3GYQA 1VQ6F 3EORA 4XCQA 1NQ3A 2Q1XA 2LCAA 1GX1A 2DYYA 3CG6A 1H7MA 4ZHYB 3LWQC 5A2QM 5JH7B 3I55F 5LA6A 4BT7A 3FBAA 3N2KA 3OBYA 5GAPK 3HKCA 3CCLF 3HAXD 5JH7A 4C81A 5HP7A 3FPIA 3VO8A 1CLIA 3V4DA 2VXYA 2HS3A 2UZHA 4U39A 1NJIH 3O85A 5IYZA 2V9YA 3PAFA 5GONB 1W41A 5JQGA 3CPQA 1YQNA 3CMEF 4X20A 1TVKA 3FD6A 1VQ7F 5J2TA 4BY9D 3C9SA 1X52A 3NVKE 3N2KB 5HY0A 1QU9A 3VYUC 3C9TA 3DC2A 1UFYA 4R40B 3E1YA 3ESJA 5C8YA
chains in the Genus database with same CATH topology
5IT9M 3CPWF 3SIUA 3E20B 2QEXF 3RA5A 1DT9A 5G4UC 2FGYA 3HJWC 5HY2A 2I6DA 1SDSA 1QVFF 3FFMA 4TZZA 1YI2F 2OZBA 5FJ4C 2AIFA 1X7PA 4EI7A 3I56F 5DCVA 1XBIA 4BVRA 4BVTA 2KTUA 1VQNF 1RA4A 1YHQF 4BVSA 3CCQF 3N4YA 2OTLF 3J81M 1K9MH 1X7OA 2BO1A 3CCUF 5GIOC 3CXCF 1Q82H 3LWRC 3OW2F 4X3LA 5HWEA 1JJ2F 1KQSF 3PLAC 3CCVF 4X3MA 3N4ZA 1VQMF 2FC3A 1KD1H 3CD6F 1YITF 2OTJF 3CCEF 1E7KA 1CK2A 2HVYD 1S72F 1VQLF 4BVQA 3JAMM 5HXZA 1QVGF 3VMFB 3CCRF 1W40A 1PXWA 1GZ0A 4EI9A 3MCAB 3D00A 1VQKF 3NK6A 1M90H 5GIPC 3CCJF 1ZWZA 3CCMF 3NMUC 5G4VC 3V7QA 2KTVA 1VQ5F 1N8RH 1GO0A 3JCMM 1GO1A 5HY4A 5GANK 4C4WC 2VGMA 5GINC 3LFOA 1M1KH 4NQ3A 2VGNA 2WALA 5HY1A 1K73H 3J80M 5EO3A 2KG4A 3SIVA 3G6EF 2OHWA 3WXMB 3GYQA 2LBXA 1VQ6F 1T0KB 4XCQA 3IR9A 3J7AR 3CG6A 2QA4F 1H7MA 1CN7A 3LWQC 3VI6A 5A2QM 1K8AH 3G4SF 4NUTA 3I55F 3LWPC 1YIJF 3CCSF 3OBYA 5GAPK 3CCLF 3V7EA 1RLGA 3HAXD 3CC2F 1VQ8F 1YJWF 1NMUB 2CZWA 5HXUA 3NK7A 1Q86H 1YJ9F 3ON1A 1VQ4F 2F9ZC 1NJIH 4BW0B 3O85A 1W2BF 1Q81H 3PAFA 2JNBA 1VQ9F 1W42A 3G71F 3NVIB 1W41A 1VQOF 3RA6A 4LCKA 3CPQA 2QI2A 3CMEF 1IPAA 5FLXM 3CC4F 1VQPF 1VQ7F 3AGKA 2ALEA 4BY9D 2GLZA 3LWVC 3CMAF 3CC7F 1W3EX 1X52A 1YJNF 3NVKE 3V3TA 2LBWA 5HY0A 1Q7YH 5EWRA 1KC8H 4EI8A 3E1YA 3OBWA 3LWOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  3CPW F;  3SIU A;  3E20 B;  2QEX F;  3RA5 A;  1DT9 A;  5G4U C;  3HJW C;  2I6D A;  1SDS A;  1QVF F;  3FFM A;  4TZZ A;  1YI2 F;  2OZB A;  5FJ4 C;  2AIF A;  1X7P A;  3I56 F;  5DCV A;  1XBI A;  2KTU A;  1VQN F;  1RA4 A;  1YHQ F;  3CCQ F;  3N4Y A;  2OTL F;  3J81 M;  1K9M H;  1X7O A;  2BO1 A;  3CCU F;  5GIO C;  3CXC F;  1Q82 H;  3LWR C;  3OW2 F;  4X3L A;  1JJ2 F;  1KQS F;  3PLA C;  3CCV F;  4X3M A;  3N4Z A;  1VQM F;  2FC3 A;  1KD1 H;  3CD6 F;  1YIT F;  2OTJ F;  3CCE F;  1E7K A;  1CK2 A;  2HVY D;  1S72 F;  1VQL F;  3JAM M;  1QVG F;  3VMF B;  3CCR F;  1W40 A;  1PXW A;  1GZ0 A;  3MCA B;  1VQK F;  3NK6 A;  1M90 H;  5GIP C;  3CCJ F;  1ZWZ A;  3CCM F;  3NMU C;  5G4V C;  3V7Q A;  2KTV A;  1VQ5 F;  1N8R H;  1GO0 A;  3JCM M;  1GO1 A;  5GAN K;  4C4W C;  2VGM A;  5GIN C;  3LFO A;  1M1K H;  2VGN A;  2WAL A;  1K73 H;  3J80 M;  5EO3 A;  2KG4 A;  3SIV A;  3G6E F;  2OHW A;  3WXM B;  3GYQ A;  2LBX A;  1VQ6 F;  1T0K B;  3IR9 A;  3J7A R;  3CG6 A;  2QA4 F;  1H7M A;  1CN7 A;  3LWQ C;  3VI6 A;  5A2Q M;  1K8A H;  3G4S F;  4NUT A;  3I55 F;  3LWP C;  1YIJ F;  3CCS F;  3OBY A;  5GAP K;  3CCL F;  3V7E A;  1RLG A;  3HAX D;  3CC2 F;  1VQ8 F;  1YJW F;  1NMU B;  2CZW A;  3NK7 A;  1YJ9 F;  3ON1 A;  1VQ4 F;  1NJI H;  4BW0 B;  3O85 A;  1W2B F;  1Q81 H;  3PAF A;  2JNB A;  1VQ9 F;  1W42 A;  3G71 F;  3NVI B;  1W41 A;  1VQO F;  3RA6 A;  4LCK A;  3CPQ A;  2QI2 A;  3CME F;  1IPA A;  5FLX M;  3CC4 F;  1VQP F;  1VQ7 F;  3AGK A;  2ALE A;  4BY9 D;  3LWV C;  3CMA F;  3CC7 F;  1W3E X;  1X52 A;  1YJN F;  3NVK E;  2LBW A;  1Q7Y H;  5EWR A;  1KC8 H;  1Q86 H;  3E1Y A;  3OBW A;  3LWO C; 
#chains in the Genus database with same CATH topology
 3WJQ A;  1COM A;  5IT9 M;  2KGW A;  2UYP A;  1U40 A;  3JAT B;  3WGN A;  3RA5 A;  2G9I A;  2W8B C;  1DT9 A;  2B33 A;  4X1K B;  1QVF F;  3JAW B;  4O4I A;  1RQ7 A;  3JAL B;  1IV1 A;  4C8G A;  4TZZ A;  4B62 A;  1YI2 F;  1U3P A;  4FFB B;  2OZB A;  4BVT A;  5LOV B;  1J7H A;  1RA4 A;  5IYZ B;  3CCQ F;  1DBF A;  2OTL F;  3S03 A;  1K9M H;  4ZHQ A;  2R6R 1;  4O4H A;  1Q82 H;  3LWR C;  3VYS C;  4X3L A;  3HKB B;  3PLA C;  4BT6 A;  3T80 A;  3CCV F;  4X3M A;  1KD1 H;  1VQM F;  2FC3 A;  3JAL A;  2OTJ F;  2ZF8 A;  2CHS A;  3WGL A;  3WGK A;  3CYP B;  4ZOL A;  5CA1 B;  1GZ0 A;  3D00 A;  2HQS C;  3K14 A;  4I50 A;  4ZI7 A;  4TV9 B;  3S06 A;  2UYN A;  1VHA A;  3S0H A;  3NMU C;  1VQ5 F;  4ERH A;  1GO0 A;  4YJ3 B;  1PF5 A;  3U0O A;  2BTU A;  4BT4 A;  2ZOD A;  3C8L A;  4O2A B;  1Z5V A;  3UT5 A;  4I55 B;  3RYF A;  4O4L B;  2VGN A;  4NQ3 A;  4F6R A;  2CHT A;  3UT5 B;  4DRX B;  5JQG B;  3J80 M;  3SIV A;  4G4X A;  4C82 A;  3HTN A;  1IV4 A;  3E22 A;  4B46 A;  4O2B A;  1VH8 A;  2EWC A;  2UYJ A;  3J7A R;  3ZP7 A;  1CN7 A;  2UYN B;  4ZI7 B;  3VI6 A;  5EAZ A;  4HNA A;  3TD3 A;  1K8A H;  3ZP4 A;  2ZAU A;  3B6N A;  1YIJ F;  3HKD A;  3GTZ A;  5LP6 C;  2Z1F A;  1OFU A;  2ZOV A;  1FFX A;  3ZOP A;  1RLG A;  4LNU A;  3M1X A;  2CZW A;  2GZL A;  4TV8 A;  1YJ9 F;  3ON1 A;  4DXD A;  1Q81 H;  5CA0 B;  3ELC A;  3E22 B;  1R1M A;  3KE1 A;  2L26 A;  5EYP A;  3RA6 A;  5LYJ B;  2H8E A;  4F6R B;  1W5A A;  3IKE A;  2H8C A;  3CC4 F;  3GHZ A;  1VQP F;  3JAK B;  2ALE A;  3K2X A;  2CSL A;  1VQV A;  3JAW A;  4O4I B;  1KC8 H;  1U43 A;  5MN5 A;  3LME A;  3HKE A;  5LXT B;  1FNJ A;  3D54 A;  3VOA A;  3LWO C;  5KMG A;  3E20 B;  3HKE B;  2RHJ A;  5LXT A;  2QEX F;  4X1I A;  2FGY A;  1SDS A;  2HS4 A;  3P0Z A;  4G4V A;  3F0G A;  3S0W A;  5JVD B;  2IAF A;  1QAH A;  5J2U A;  5DCV A;  4M8I A;  3CYQ A;  4BVR A;  1SA0 B;  3KJJ A;  5MN6 A;  2Z01 A;  1W58 1;  1FSZ A;  4BVS A;  5CA0 A;  3I7T A;  3RE3 A;  3LDT A;  3QHD A;  3RYH A;  1W57 A;  2YYE A;  3OON A;  4G88 A;  4DRX A;  3OW2 F;  1JJ2 F;  2HRY A;  2PHN A;  5LYJ A;  5JVD A;  2N48 A;  1TUB A;  3HKC B;  3RYC B;  1H47 A;  3NK6 A;  3MBM A;  5ITZ A;  5GIP C;  3M84 A;  3S0Y A;  3WPW A;  3V7Q A;  4PWT A;  4LNU B;  5EZY B;  4X1Y A;  2MQE A;  5HY4 A;  5GAN K;  3F6M A;  3MQW A;  3L7Q A;  1U3L A;  3BYQ A;  2WAL A;  5EIB D;  1IV2 A;  4I4T A;  4BT2 A;  2I6R A;  5EO3 A;  4ZHQ B;  3G6E F;  2OHW A;  3WXM B;  3WJR A;  2GVI A;  1T0K B;  3IR9 A;  2QTP A;  1YGY A;  5ITZ B;  2QA4 F;  3RYC A;  5KX5 B;  3VYT C;  3G4S F;  5CA1 A;  3WGJ A;  1QD9 A;  3LWP C;  3CCS F;  1XRG A;  3V7E A;  3N2G A;  4X1Y B;  3FD5 A;  1VQ8 F;  1YJW F;  1NMU B;  5HP8 A;  1W5B A;  3NK7 A;  4HNA B;  2F9Z C;  5FNV A;  3VOB A;  4BW0 B;  1W2B F;  5EB1 B;  2HX0 A;  5FNV B;  5IJ0 B;  1W42 A;  3G71 F;  3NVI B;  1SA0 A;  2R75 1;  2QI2 A;  1IPA A;  3K0T A;  4IIJ B;  1W55 A;  3C9U A;  3F0F A;  4BT5 A;  1JN1 A;  2YXZ A;  2P6Y A;  3AGK A;  4G4Y A;  3RYH B;  2GLZ A;  3CC7 F;  4IHJ A;  3V3T A;  1FNK A;  2Z1E A;  5EWR A;  4B45 A;  4ZHW A;  4EI8 A;  3KIZ A;  3IKF A;  5J2U B;  3LYB A;  5JCO A;  1Z5W A;  1XV2 A;  4C8I A;  3ERN A;  3MDO A;  2Z1T A;  4E6E A;  1KNJ A;  2I6D A;  1ODE A;  3WJP A;  4IIJ A;  3I3F A;  3RYF B;  2AIF A;  3P4E A;  4B5C A;  2H6L A;  2KTU A;  5AVM A;  2LBT A;  3VCZ A;  1YHQ F;  4YJ3 A;  2UYK A;  4G4W A;  3J81 M;  4X1I B;  1H48 A;  3CCU F;  3CXC F;  3Q8H A;  3JAK A;  4RHA A;  2Q1Y A;  4X20 B;  4O4J B;  3N4Z A;  3CD6 F;  3CCE F;  2AMT A;  1Q8R A;  3JAS B;  3RYI B;  1CK2 A;  1E7K A;  1S72 F;  3JAM M;  5HXZ A;  4KWE A;  3VMF B;  3CCR F;  5KMG B;  1W40 A;  1JFF A;  1SZQ A;  4EI9 A;  1VQK F;  1W5E A;  3WPX A;  3VIU A;  5G4V C;  2KTV A;  1OAP A;  3P10 A;  4YJ2 B;  2VAP A;  3F0E A;  1RLU A;  5GIN C;  3LFO A;  4FFB A;  3HKB A;  5HY1 A;  1K73 H;  4NWO B;  2KG4 A;  1W59 A;  3F0D A;  2DT4 A;  5EZY A;  4WBN A;  1ONI A;  3KHN A;  2RHO A;  2LBX A;  4ZHV A;  4EB6 B;  3DDN A;  4I50 B;  4ZOL B;  4NUT A;  3HWU A;  4G4Z A;  4O2A A;  1FFX B;  1TUB B;  1JY8 A;  3QUW A;  3CC2 F;  2RB9 A;  4TUY A;  4O4L A;  3JAT A;  5HXU A;  5B8F A;  4O4H B;  5LP6 B;  3M4S A;  3KJK A;  5EYP B;  2K1S A;  1IV3 A;  4O2B B;  1VQ4 F;  3IEW A;  2Z1U A;  2JNB A;  1VQ9 F;  2IG8 A;  1VQO F;  4TV8 B;  4I4T B;  1JD1 A;  4LCK A;  3WGM A;  5FLX M;  3IEQ A;  4I55 A;  5CB4 B;  2ZVZ A;  5IJ9 A;  5BMV A;  3MCQ A;  3TD4 A;  5MN4 A;  3LWV C;  2PMP A;  3CMA F;  1W3E X;  1YJN F;  5EIB C;  2LBW A;  5GON A;  1Q7Y H;  2CWJ A;  4YJ2 A;  5LA6 B;  5LOV A;  2NMU A;  4ZK7 A;  1Q86 H;  3OBW A;  2HP0 A;  4C8E A;  3CPW F;  3TD5 A;  3SIU A;  1JFF B;  4RQO A;  3D01 A;  5G4U C;  3HJW C;  1XHO A;  5HY2 A;  3ZO8 A;  2HRU A;  4IHJ B;  5J2T B;  3FFM A;  3C9R A;  5BMV B;  5FJ4 C;  4O4J A;  1X7P A;  4EI7 A;  3I56 F;  1XBI A;  5CB4 A;  1UI9 A;  2IQQ A;  2VAW A;  1VQN F;  4X1K A;  2CW4 A;  3N4Y A;  2RHH A;  4WBN B;  2AIZ P;  5JCO C;  1X7O A;  3QTY A;  2BO1 A;  4TV9 A;  1W5F A;  5GIO C;  2HP0 B;  2CVL A;  5HWE A;  1KQS F;  1VK3 A;  5IJ9 B;  5EB0 A;  1YIT F;  2BTO A;  1X25 A;  2HVY D;  2OTM A;  3HKD B;  3K12 A;  3N2G B;  1VQL F;  4BVQ A;  1QVG F;  1TVK B;  1PXW A;  5C8Y B;  3JAR A;  3MCA B;  5KX5 A;  1M90 H;  3S02 A;  3IMP A;  2ZVY A;  3CCJ F;  3JAR B;  1ZWZ A;  3CCM F;  3R0P A;  4TUY B;  4EB6 A;  1N8R H;  2BTQ B;  3JCM M;  1GO1 A;  3JAS A;  2RHL A;  4U3J A;  3RYI A;  2HS0 A;  1KNK A;  4C4W C;  5LP6 A;  2VGM A;  3VTI C;  1T0A A;  3JVH A;  1M1K H;  2VAM A;  2HP3 A;  4U3J B;  1RQ2 A;  3CB2 A;  5IJ0 A;  4BT3 A;  3GYQ A;  1VQ6 F;  3EOR A;  4XCQ A;  1NQ3 A;  2Q1X A;  2LCA A;  1GX1 A;  2DYY A;  3CG6 A;  1H7M A;  4ZHY B;  3LWQ C;  5A2Q M;  5JH7 B;  3I55 F;  5LA6 A;  4BT7 A;  3FBA A;  3N2K A;  3OBY A;  5GAP K;  3HKC A;  3CCL F;  3HAX D;  5JH7 A;  4C81 A;  5HP7 A;  3FPI A;  3VO8 A;  1CLI A;  3V4D A;  2VXY A;  2HS3 A;  2UZH A;  4U39 A;  1NJI H;  3O85 A;  5IYZ A;  2V9Y A;  3PAF A;  5GON B;  1W41 A;  5JQG A;  3CPQ A;  1YQN A;  3CME F;  4X20 A;  1TVK A;  3FD6 A;  1VQ7 F;  5J2T A;  4BY9 D;  3C9S A;  1X52 A;  3NVK E;  3N2K B;  5HY0 A;  1QU9 A;  3VYU C;  3C9T A;  3DC2 A;  1UFY A;  4R40 B;  3E1Y A;  3ESJ A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 5IT9 M;  3CPW F;  3SIU A;  3E20 B;  2QEX F;  3RA5 A;  1DT9 A;  5G4U C;  2FGY A;  3HJW C;  5HY2 A;  2I6D A;  1SDS A;  1QVF F;  3FFM A;  4TZZ A;  1YI2 F;  2OZB A;  5FJ4 C;  2AIF A;  1X7P A;  4EI7 A;  3I56 F;  5DCV A;  1XBI A;  4BVR A;  4BVT A;  2KTU A;  1VQN F;  1RA4 A;  1YHQ F;  4BVS A;  3CCQ F;  3N4Y A;  2OTL F;  3J81 M;  1K9M H;  1X7O A;  2BO1 A;  3CCU F;  5GIO C;  3CXC F;  1Q82 H;  3LWR C;  3OW2 F;  4X3L A;  5HWE A;  1JJ2 F;  1KQS F;  3PLA C;  3CCV F;  4X3M A;  3N4Z A;  1VQM F;  2FC3 A;  1KD1 H;  3CD6 F;  1YIT F;  2OTJ F;  3CCE F;  1E7K A;  1CK2 A;  2HVY D;  1S72 F;  1VQL F;  4BVQ A;  3JAM M;  5HXZ A;  1QVG F;  3VMF B;  3CCR F;  1W40 A;  1PXW A;  1GZ0 A;  4EI9 A;  3MCA B;  3D00 A;  1VQK F;  3NK6 A;  1M90 H;  5GIP C;  3CCJ F;  1ZWZ A;  3CCM F;  3NMU C;  5G4V C;  3V7Q A;  2KTV A;  1VQ5 F;  1N8R H;  1GO0 A;  3JCM M;  1GO1 A;  5HY4 A;  5GAN K;  4C4W C;  2VGM A;  5GIN C;  3LFO A;  1M1K H;  4NQ3 A;  2VGN A;  2WAL A;  5HY1 A;  1K73 H;  3J80 M;  5EO3 A;  2KG4 A;  3SIV A;  3G6E F;  2OHW A;  3WXM B;  3GYQ A;  2LBX A;  1VQ6 F;  1T0K B;  4XCQ A;  3IR9 A;  3J7A R;  3CG6 A;  2QA4 F;  1H7M A;  1CN7 A;  3LWQ C;  3VI6 A;  5A2Q M;  1K8A H;  3G4S F;  4NUT A;  3I55 F;  3LWP C;  1YIJ F;  3CCS F;  3OBY A;  5GAP K;  3CCL F;  3V7E A;  1RLG A;  3HAX D;  3CC2 F;  1VQ8 F;  1YJW F;  1NMU B;  2CZW A;  5HXU A;  3NK7 A;  1Q86 H;  1YJ9 F;  3ON1 A;  1VQ4 F;  2F9Z C;  1NJI H;  4BW0 B;  3O85 A;  1W2B F;  1Q81 H;  3PAF A;  2JNB A;  1VQ9 F;  1W42 A;  3G71 F;  3NVI B;  1W41 A;  1VQO F;  3RA6 A;  4LCK A;  3CPQ A;  2QI2 A;  3CME F;  1IPA A;  5FLX M;  3CC4 F;  1VQP F;  1VQ7 F;  3AGK A;  2ALE A;  4BY9 D;  2GLZ A;  3LWV C;  3CMA F;  3CC7 F;  1W3E X;  1X52 A;  1YJN F;  3NVK E;  3V3T A;  2LBW A;  5HY0 A;  1Q7Y H;  5EWR A;  1KC8 H;  4EI8 A;  3E1Y A;  3OBW A;  3LWO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...