1K73H

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k73H00
1DT9A 1IPAA 1W40A 3OBYA 3JCMM 3CCLF 3CC7F 3GYQA 3NVKE 2AIFA 3OBWA 1Q7YH 3CC4F 4TZZA 3CD6F 2FC3A 2QEXF 1M90H 5G4UC 3PAFA 2JNBA 1K9MH 1NMUB 1QVFF 3SIVA 3CMAF 5A2QM 1K73H 1VQNF 3CXCF 5EWRA 1YI2F 3HJWC 3J80M 1NJIH 1CN7A 1VQPF 1W42A 3AGKA 2BO1A 2KTUA 1VQ8F 3CCMF 3CCRF 3CCEF 1Q82H 3NVIB 1GO1A 3FFMA 1VQ6F 3LWRC 1YJWF 2ALEA 1K8AH 1X7OA 1KQSF 2LBXA 3IR9A 3E20B 2I6DA 2KTVA 1YJ9F 3SIUA 1X52A 3CPQA 4LCKA 3LFOA 1YHQF 2OHWA 2WALA 5EO3A 3LWOC 3O85A 5IT9M 2VGMA 3CPWF 1GO0A 3LWVC 5GIOC 4NUTA 2CZWA 5GANK 3CCQF 3CCSF 1PXWA 3I56F 2VGNA 3LWQC 5DCVA 3ON1A 3CCUF 2OTLF 3G4SF 3E1YA 3OW2F 1KD1H 1ZWZA 3VI6A 3NK7A 3G6EF 1S72F 5FJ4C 1H7MA 1VQLF 3I55F 1W3EX 3RA5A 3WXMB 3HAXD 1YIJF 1SDSA 5GIPC 3CMEF 1Q81H 3N4ZA 1VQOF 1W2BF 2QI2A 5G4VC 1QVGF 1KC8H 1VQ9F 3J7AR 2KG4A 3V7QA 1YITF 4BY9D 1E7KA 4C4WC 1VQMF 3J81M 5FLXM 1VQ7F 3N4YA 1GZ0A 1YJNF 1RLGA 3PLAC 3NK6A 3V7EA 4X3LA 3G71F 4BW0B 1RA4A 1XBIA 3CG6A 3NMUC 3MCAB 1T0KB 4X3MA 5GINC 1M1KH 3LWPC 3JAMM 1N8RH 1VQ4F 3RA6A 1VQKF 3CCJF 5GAPK 1W41A 2LBWA 2OZBA 1CK2A 3VMFB 1Q86H 2QA4F 3CCVF 3CC2F 2HVYD 1JJ2F 2OTJF 1X7PA 1VQ5F
chains in the Genus database with same CATH superfamily
3JATB 3P0ZA 3S0YA 4G4YA 5HY0A 5LA6B 3WJRA 1FSZA 1FFXB 2VAPA 3K2XA 2V9YA 3CYPB 3OBWA 3CC4F 4TZZA 3CD6F 3ZOPA 1M90H 3JASB 2AMTA 3S03A 2YYEA 3LDTA 1K9MH 1NMUB 2L26A 3D00A 3SIVA 5MN4A 3BYQA 2DT4A 2VAWA 3CXCF 1DBFA 3JAKB 2H8EA 2IG8A 4X1KA 5LYJA 1VQPF 2CHSA 2GVIA 3I7TA 4BVTA 3FBAA 1Q82H 1CLIA 4O4HB 3IEQA 3LWRC 1YJWF 2ALEA 2HS3A 1K8AH 1U3LA 3B6NA 2I6DA 5JH7B 2KTVA 4FFBB 2RHHA 4IIJB 5LP6B 5C8YA 2I6RA 3LFOA 1YHQF 2ZVYA 5EIBD 2OHWA 4G4VA 3S06A 1W5AA 3O85A 5IT9M 5IJ0A 3CPWF 3DC2A 5CA0A 4I55B 1ONIA 3LWVC 2CW4A 4NUTA 1W5BA 4BT5A 4ZHQA 3CCSF 1OFUA 1RLUA 5LXTB 5GONA 5DCVA 5B8FA 2GZLA 4WBNB 3OW2F 1KD1H 1ZWZA 1IV2A 1H47A 1S72F 3R0PA 3CB2A 5J2UB 5AVMA 5GIPC 2UYNB 4BT6A 5KX5A 4O2AA 3N4ZA 2G9IA 2BTQB 1VQOF 1QVGF 3JATA 4BVSA 5LA6A 3V7QA 1FFXA 1YITF 3RYIB 5LP6C 1Z5WA 2ZODA 3LYBA 2RB9A 3MBMA 4ZHYB 3JASA 3V4DA 3HKCB 3V7EA 3HKEB 3FPIA 3FD5A 1VH8A 3HKDB 5JCOC 5KMGB 5J2TB 2RHOA 1T0KB 4X3MA 5EIBC 3JAKA 2ZF8A 1VQ4F 4B5CA 1VQVA 3Q8HA 1W41A 4O4HA 3VMFB 3WPWA 1SA0B 3MQWA 4KWEA 1RQ7A 2HVYD 5JH7A 4FFBA 3C9TA 4IIJA 5LP6A 3QUWA 1TVKB 3OBYA 1QAHA 3RYCB 4TUYB 4I55A 5MN5A 5JCOA 3HTNA 4ZHVA 3PAFA 5LXTA 2B33A 4X1YB 1QVFF 3CMAF 4WBNA 5JVDB 4E6EA 4LNUB 1K73H 3KE1A 3VO8A 3QHDA 3IMPA 3J80M 1NJIH 4NQ3A 2R751 5J2UA 1W42A 5EB0A 2UYNA 3P10A 2KTUA 1VQ8F 3CCMF 3CCEF 1GO1A 1VQ6F 1KNJA 1FNJA 3S02A 4G4ZA 4O2BB 3RYIA 5HXUA 3ZP4A 1JY8A 2KGWA 3FD6A 4NWOB 3VCZA 3L7QA 1GO0A 3HKCA 1YGYA 4O4IB 3HKEA 3HKDA 3EORA 4C8GA 2Z1TA 5GIOC 5KMGA 5J2TA 2Q1YA 3LWQC 3VYSC 3C9UA 3JALB 2Z1FA 2CHTA 2HRYA 3G4SF 3G6EF 4ZOLB 1SA0A 3TD3A 3ZO8A 5HP7A 4DRXB 3F0FA 1VQLF 3HAXD 3KIZA 1U40A 2Z01A 4YJ2B 3VYTC 3UT5B 1W2BF 2QI2A 5G4VC 1KC8H 1TVKA 4XCQA 4B62A 1VQ9F 5IYZB 4BY9D 2Z1UA 4C4WC 3RYCA 2CSLA 4TUYA 1XHOA 2DYYA 3DDNA 3K14A 1JD1A 2MQEA 1KNKA 3E22B 4X1YA 1VK3A 2CWJA 3CG6A 3JARB 5JVDA 5HY4A 4LNUA 3GHZA 2UYPA 2EWCA 2IAFA 4HNAB 5GINC 3KJJA 1M1KH 3LWPC 2AIZP 1VQKF 3CCJF 3VIUA 5GAPK 4M8IA 1CK2A 3WPXA 3I3FA 3HWUA 2OTJF 1QU9A 1X7PA 1Q8RA 1VQ5F 4C81A 1DT9A 5HY2A 1T0AA 3ERNA 2HP0B 1RQ2A 4U39A 4O4LB 3CC7F 2N48A 2HP3A 3NVKE 2LBTA 1Z5VA 4ZK7A 1W5FA 1Q7YH 1JFFB 4O4IA 2NMUA 4G4XA 2FC3A 4ERHA 2QEXF 3WGJA 3VOBA 1XRGA 5G4UC 2JNBA 1FNKA 3C9RA 4B46A 2H8CA 3JALA 3P4EA 3ELCA 5A2QM 1IV4A 3RYFB 3TD4A 4ZOLA 5EWRA 5HXZA 3WJQA 4DRXA 3HJWC 1PF5A 4BT3A 3ESJA 4YJ2A 3AGKA 1U3PA 3TD5A 3UT5A 3HKBB 3VOAA 3CCRF 3GTZA 4O4JB 3VTIC 1X7OA 4BVQA 4PWTA 5IYZA 4R40B 3U0OA 1X52A 3CPQA 4X20B 3F0DA 2WALA 3N2KB 5EO3A 2RHLA 3S0WA 4I4TB 3OONA 2Q1XA 2VAMA 3E22A 3MCQA 4EI9A 5FNVB 3JARA 1QD9A 2UYKA 4ZHWA 2HX0A 2PMPA 2OTMA 5GANK 3CCQF 4HNAA 2VGNA 5EB1B 3T80A 3ON1A 2PHNA 3C8LA 4DXDA 3CCUF 2OTLF 1NQ3A 3E1YA 3VI6A 1H7MA 3I55F 1W3EX 4TV9B 1YIJF 2VXYA 1TUBB 2HS0A 4I50B 4RHAA 1Q81H 2HP0A 5HP8A 3V3TA 1R1MA 3S0HA 4O4LA 2IQQA 1XV2A 1VQMF 3WGKA 1JFFA 3J81M 2ZOVA 2LCAA 3N4YA 3WGMA 2QTPA 4RQOA 5EYPB 3JAWB 1GZ0A 4YJ3B 1IV1A 2BTOA 1YJNF 1RLGA 3PLAC 4X3LA 2CVLA 3LMEA 4BW0B 5EZYB 1RA4A 1XBIA 3NMUC 5JQGB 1ODEA 3CYQA 5CB4B 3RYFA 3KJKA 4X1IB 2ZVZA 5MN6A 1W581 3JAMM 3VYUC 1N8RH 1U43A 5LOVB 3HKBA 1W55A 2RHJA 2OZBA 4TV8B 4O4JA 4EB6B 1Q86H 1X25A 5BMVB 2K1SA 4ZI7B 3M4SA 4X20A 1IPAA 4IHJB 3MDOA 3F6MA 3N2KA 3RYHB 1W40A 5HY1A 3JCMM 3CCLF 4I4TA 3GYQA 1OAPA 4F6RB 2AIFA 1VHAA 3WJPA 5FNVA 3IEWA 5IJ9B 5ITZB 2BTUA 3K0TA 3M84A 1J7HA 4BT7A 2UZHA 3KHNA 3IKFA 2F9ZC 2ZAUA 2H6LA 3N2GB 1VQNF 4C8IA 1YI2F 4O2BA 4TV9A 1CN7A 1TUBA 5CA1B 2UYJA 4I50A 3K12A 5EAZA 2BO1A 3F0GA 2R6R1 3NVIB 3FFMA 1KQSF 2LBXA 4G4WA 3IR9A 3E20B 1GX1A 4U3JB 1YJ9F 3SIUA 2P6YA 4G88A 4LCKA 4BVRA 1W59A 4EI7A 5EYPA 3LWOC 3JAWA 2VGMA 1H48A 2HRUA 3M1XA 4YJ3A 5EZYA 3D54A 5JQGA 5CB4A 2CZWA 3RE3A 4X1IA 1PXWA 2W8BC 3I56F 1SZQA 5LOVA 3C9SA 2HS4A 1W5EA 3NK7A 4TV8A 4EB6A 5FJ4C 1W57A 3RA5A 3WXMB 5BMVA 4X1KB 5LYJB 1SDSA 3CMEF 4ZI7A 1UFYA 2YXZA 4IHJA 2HQSC 3RYHA 3J7AR 2KG4A 3JVHA 4BT2A 1E7KA 3D01A 4F6RA 5C8YB 3WGLA 5FLXM 1VQ7F 1IV3A 5IJ9A 5IJ0B 2FGYA 5ITZA 4B45A 3NK6A 1UI9A 3G71F 3IKEA 5CA0B 3MCAB 3N2GA 5HWEA 4ZHQB 3WGNA 1YQNA 3QTYA 4EI8A 5CA1A 5GONB 3RA6A 3ZP7A 3F0EA 1JN1A 2LBWA 1COMA 2Z1EA 2GLZA 2QA4F 3CCVF 4BT4A 3CC2F 4C8EA 1JJ2F 4U3JA 4C82A 5KX5B 4O2AB
chains in the Genus database with same CATH topology
1DT9A 5HY2A 1IPAA 5HY0A 1W40A 3OBYA 5HY1A 3JCMM 3CCLF 3CC7F 3GYQA 3NVKE 2AIFA 3OBWA 1Q7YH 3CC4F 4TZZA 3CD6F 2FC3A 2QEXF 1M90H 5G4UC 3PAFA 2JNBA 1K9MH 1NMUB 1QVFF 3D00A 3SIVA 3CMAF 5A2QM 2F9ZC 1K73H 1VQNF 3CXCF 5HXZA 5EWRA 1YI2F 3HJWC 3J80M 1NJIH 4NQ3A 1CN7A 1VQPF 1W42A 3AGKA 2BO1A 4BVTA 2KTUA 1VQ8F 3CCMF 3CCRF 3CCEF 1Q82H 3NVIB 1GO1A 3FFMA 1VQ6F 3LWRC 1YJWF 2ALEA 1K8AH 1X7OA 1KQSF 2LBXA 3IR9A 3E20B 2I6DA 4BVQA 2KTVA 1YJ9F 3SIUA 1X52A 5HXUA 3CPQA 4LCKA 4BVRA 3LFOA 1YHQF 2OHWA 2WALA 5EO3A 4EI7A 3LWOC 3O85A 5IT9M 2VGMA 3CPWF 1GO0A 4EI9A 3LWVC 5GIOC 4NUTA 2CZWA 5GANK 3CCQF 3CCSF 1PXWA 3I56F 2VGNA 3LWQC 5DCVA 3ON1A 3CCUF 2OTLF 3G4SF 3E1YA 3OW2F 1KD1H 1ZWZA 3VI6A 3NK7A 3G6EF 1S72F 5FJ4C 1H7MA 1VQLF 3I55F 1W3EX 3RA5A 3WXMB 3HAXD 1YIJF 1SDSA 5GIPC 3CMEF 1Q81H 3N4ZA 1VQOF 1W2BF 2QI2A 5G4VC 1QVGF 3V3TA 4BVSA 1KC8H 4XCQA 1VQ9F 3J7AR 2KG4A 3V7QA 1YITF 4BY9D 1E7KA 4C4WC 1VQMF 3J81M 5FLXM 1VQ7F 3N4YA 1GZ0A 2FGYA 1YJNF 1RLGA 3PLAC 3NK6A 3V7EA 4X3LA 3G71F 4BW0B 1RA4A 1XBIA 3CG6A 3NMUC 3MCAB 5HY4A 1T0KB 4X3MA 5HWEA 5GINC 1M1KH 3LWPC 4EI8A 3JAMM 1N8RH 1VQ4F 3RA6A 1VQKF 3CCJF 5GAPK 1W41A 2LBWA 2OZBA 1CK2A 3VMFB 1Q86H 2GLZA 2QA4F 3CCVF 3CC2F 2HVYD 1JJ2F 2OTJF 1X7PA 1VQ5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT9 A;  1IPA A;  1W40 A;  3OBY A;  3JCM M;  3CCL F;  3CC7 F;  3GYQ A;  3NVK E;  2AIF A;  3OBW A;  1Q7Y H;  3CC4 F;  4TZZ A;  3CD6 F;  2FC3 A;  2QEX F;  1M90 H;  5G4U C;  3PAF A;  2JNB A;  1K9M H;  1NMU B;  1QVF F;  3SIV A;  3CMA F;  5A2Q M;  1K73 H;  1VQN F;  3CXC F;  5EWR A;  1YI2 F;  3HJW C;  3J80 M;  1NJI H;  1CN7 A;  1VQP F;  1W42 A;  3AGK A;  2BO1 A;  2KTU A;  1VQ8 F;  3CCM F;  3CCR F;  3CCE F;  1Q82 H;  3NVI B;  1GO1 A;  3FFM A;  1VQ6 F;  3LWR C;  1YJW F;  2ALE A;  1K8A H;  1X7O A;  1KQS F;  2LBX A;  3IR9 A;  3E20 B;  2I6D A;  2KTV A;  1YJ9 F;  3SIU A;  1X52 A;  3CPQ A;  4LCK A;  3LFO A;  1YHQ F;  2OHW A;  2WAL A;  5EO3 A;  3LWO C;  3O85 A;  5IT9 M;  2VGM A;  3CPW F;  1GO0 A;  3LWV C;  5GIO C;  4NUT A;  2CZW A;  5GAN K;  3CCQ F;  3CCS F;  1PXW A;  3I56 F;  2VGN A;  3LWQ C;  5DCV A;  3ON1 A;  3CCU F;  2OTL F;  3G4S F;  3E1Y A;  3OW2 F;  1KD1 H;  1ZWZ A;  3VI6 A;  3NK7 A;  3G6E F;  1S72 F;  5FJ4 C;  1H7M A;  1VQL F;  3I55 F;  1W3E X;  3RA5 A;  3WXM B;  3HAX D;  1YIJ F;  1SDS A;  5GIP C;  3CME F;  1Q81 H;  3N4Z A;  1VQO F;  1W2B F;  2QI2 A;  5G4V C;  1QVG F;  1KC8 H;  1VQ9 F;  3J7A R;  2KG4 A;  3V7Q A;  1YIT F;  4BY9 D;  1E7K A;  4C4W C;  1VQM F;  3J81 M;  5FLX M;  1VQ7 F;  3N4Y A;  1GZ0 A;  1YJN F;  1RLG A;  3PLA C;  3NK6 A;  3V7E A;  4X3L A;  3G71 F;  4BW0 B;  1RA4 A;  1XBI A;  3CG6 A;  3NMU C;  3MCA B;  1T0K B;  4X3M A;  5GIN C;  1M1K H;  3LWP C;  3JAM M;  1N8R H;  1VQ4 F;  3RA6 A;  1VQK F;  3CCJ F;  5GAP K;  1W41 A;  2LBW A;  2OZB A;  1CK2 A;  3VMF B;  1Q86 H;  2QA4 F;  3CCV F;  3CC2 F;  2HVY D;  1JJ2 F;  2OTJ F;  1X7P A;  1VQ5 F; 
#chains in the Genus database with same CATH topology
 3JAT B;  3P0Z A;  3S0Y A;  4G4Y A;  5HY0 A;  5LA6 B;  3WJR A;  1FSZ A;  1FFX B;  2VAP A;  3K2X A;  2V9Y A;  3CYP B;  3OBW A;  3CC4 F;  4TZZ A;  3CD6 F;  3ZOP A;  1M90 H;  3JAS B;  2AMT A;  3S03 A;  2YYE A;  3LDT A;  1K9M H;  1NMU B;  2L26 A;  3D00 A;  3SIV A;  5MN4 A;  3BYQ A;  2DT4 A;  2VAW A;  3CXC F;  1DBF A;  3JAK B;  2H8E A;  2IG8 A;  4X1K A;  5LYJ A;  1VQP F;  2CHS A;  2GVI A;  3I7T A;  4BVT A;  3FBA A;  1Q82 H;  1CLI A;  4O4H B;  3IEQ A;  3LWR C;  1YJW F;  2ALE A;  2HS3 A;  1K8A H;  1U3L A;  3B6N A;  2I6D A;  5JH7 B;  2KTV A;  4FFB B;  2RHH A;  4IIJ B;  5LP6 B;  5C8Y A;  2I6R A;  3LFO A;  1YHQ F;  2ZVY A;  5EIB D;  2OHW A;  4G4V A;  3S06 A;  1W5A A;  3O85 A;  5IT9 M;  5IJ0 A;  3CPW F;  3DC2 A;  5CA0 A;  4I55 B;  1ONI A;  3LWV C;  2CW4 A;  4NUT A;  1W5B A;  4BT5 A;  4ZHQ A;  3CCS F;  1OFU A;  1RLU A;  5LXT B;  5GON A;  5DCV A;  5B8F A;  2GZL A;  4WBN B;  3OW2 F;  1KD1 H;  1ZWZ A;  1IV2 A;  1H47 A;  1S72 F;  3R0P A;  3CB2 A;  5J2U B;  5AVM A;  5GIP C;  2UYN B;  4BT6 A;  5KX5 A;  4O2A A;  3N4Z A;  2G9I A;  2BTQ B;  1VQO F;  1QVG F;  3JAT A;  4BVS A;  5LA6 A;  3V7Q A;  1FFX A;  1YIT F;  3RYI B;  5LP6 C;  1Z5W A;  2ZOD A;  3LYB A;  2RB9 A;  3MBM A;  4ZHY B;  3JAS A;  3V4D A;  3HKC B;  3V7E A;  3HKE B;  3FPI A;  3FD5 A;  1VH8 A;  3HKD B;  5JCO C;  5KMG B;  5J2T B;  2RHO A;  1T0K B;  4X3M A;  5EIB C;  3JAK A;  2ZF8 A;  1VQ4 F;  4B5C A;  1VQV A;  3Q8H A;  1W41 A;  4O4H A;  3VMF B;  3WPW A;  1SA0 B;  3MQW A;  4KWE A;  1RQ7 A;  2HVY D;  5JH7 A;  4FFB A;  3C9T A;  4IIJ A;  5LP6 A;  3QUW A;  1TVK B;  3OBY A;  1QAH A;  3RYC B;  4TUY B;  4I55 A;  5MN5 A;  5JCO A;  3HTN A;  4ZHV A;  3PAF A;  5LXT A;  2B33 A;  4X1Y B;  1QVF F;  3CMA F;  4WBN A;  5JVD B;  4E6E A;  4LNU B;  1K73 H;  3KE1 A;  3VO8 A;  3QHD A;  3IMP A;  3J80 M;  1NJI H;  4NQ3 A;  2R75 1;  5J2U A;  1W42 A;  5EB0 A;  2UYN A;  3P10 A;  2KTU A;  1VQ8 F;  3CCM F;  3CCE F;  1GO1 A;  1VQ6 F;  1KNJ A;  1FNJ A;  3S02 A;  4G4Z A;  4O2B B;  3RYI A;  5HXU A;  3ZP4 A;  1JY8 A;  2KGW A;  3FD6 A;  4NWO B;  3VCZ A;  3L7Q A;  1GO0 A;  3HKC A;  1YGY A;  4O4I B;  3HKE A;  3HKD A;  3EOR A;  4C8G A;  2Z1T A;  5GIO C;  5KMG A;  5J2T A;  2Q1Y A;  3LWQ C;  3VYS C;  3C9U A;  3JAL B;  2Z1F A;  2CHT A;  2HRY A;  3G4S F;  3G6E F;  4ZOL B;  1SA0 A;  3TD3 A;  3ZO8 A;  5HP7 A;  4DRX B;  3F0F A;  1VQL F;  3HAX D;  3KIZ A;  1U40 A;  2Z01 A;  4YJ2 B;  3VYT C;  3UT5 B;  1W2B F;  2QI2 A;  5G4V C;  1KC8 H;  1TVK A;  4XCQ A;  4B62 A;  1VQ9 F;  5IYZ B;  4BY9 D;  2Z1U A;  4C4W C;  3RYC A;  2CSL A;  4TUY A;  1XHO A;  2DYY A;  3DDN A;  3K14 A;  1JD1 A;  2MQE A;  1KNK A;  3E22 B;  4X1Y A;  1VK3 A;  2CWJ A;  3CG6 A;  3JAR B;  5JVD A;  5HY4 A;  4LNU A;  3GHZ A;  2UYP A;  2EWC A;  2IAF A;  4HNA B;  5GIN C;  3KJJ A;  1M1K H;  3LWP C;  2AIZ P;  1VQK F;  3CCJ F;  3VIU A;  5GAP K;  4M8I A;  1CK2 A;  3WPX A;  3I3F A;  3HWU A;  2OTJ F;  1QU9 A;  1X7P A;  1Q8R A;  1VQ5 F;  4C81 A;  1DT9 A;  5HY2 A;  1T0A A;  3ERN A;  2HP0 B;  1RQ2 A;  4U39 A;  4O4L B;  3CC7 F;  2N48 A;  2HP3 A;  3NVK E;  2LBT A;  1Z5V A;  4ZK7 A;  1W5F A;  1Q7Y H;  1JFF B;  4O4I A;  2NMU A;  4G4X A;  2FC3 A;  4ERH A;  2QEX F;  3WGJ A;  3VOB A;  1XRG A;  5G4U C;  2JNB A;  1FNK A;  3C9R A;  4B46 A;  2H8C A;  3JAL A;  3P4E A;  3ELC A;  5A2Q M;  1IV4 A;  3RYF B;  3TD4 A;  4ZOL A;  5EWR A;  5HXZ A;  3WJQ A;  4DRX A;  3HJW C;  1PF5 A;  4BT3 A;  3ESJ A;  4YJ2 A;  3AGK A;  1U3P A;  3TD5 A;  3UT5 A;  3HKB B;  3VOA A;  3CCR F;  3GTZ A;  4O4J B;  3VTI C;  1X7O A;  4BVQ A;  4PWT A;  5IYZ A;  4R40 B;  3U0O A;  1X52 A;  3CPQ A;  4X20 B;  3F0D A;  2WAL A;  3N2K B;  5EO3 A;  2RHL A;  3S0W A;  4I4T B;  3OON A;  2Q1X A;  2VAM A;  3E22 A;  3MCQ A;  4EI9 A;  5FNV B;  3JAR A;  1QD9 A;  2UYK A;  4ZHW A;  2HX0 A;  2PMP A;  2OTM A;  5GAN K;  3CCQ F;  4HNA A;  2VGN A;  5EB1 B;  3T80 A;  3ON1 A;  2PHN A;  3C8L A;  4DXD A;  3CCU F;  2OTL F;  1NQ3 A;  3E1Y A;  3VI6 A;  1H7M A;  3I55 F;  1W3E X;  4TV9 B;  1YIJ F;  2VXY A;  1TUB B;  2HS0 A;  4I50 B;  4RHA A;  1Q81 H;  2HP0 A;  5HP8 A;  3V3T A;  1R1M A;  3S0H A;  4O4L A;  2IQQ A;  1XV2 A;  1VQM F;  3WGK A;  1JFF A;  3J81 M;  2ZOV A;  2LCA A;  3N4Y A;  3WGM A;  2QTP A;  4RQO A;  5EYP B;  3JAW B;  1GZ0 A;  4YJ3 B;  1IV1 A;  2BTO A;  1YJN F;  1RLG A;  3PLA C;  4X3L A;  2CVL A;  3LME A;  4BW0 B;  5EZY B;  1RA4 A;  1XBI A;  3NMU C;  5JQG B;  1ODE A;  3CYQ A;  5CB4 B;  3RYF A;  3KJK A;  4X1I B;  2ZVZ A;  5MN6 A;  1W58 1;  3JAM M;  3VYU C;  1N8R H;  1U43 A;  5LOV B;  3HKB A;  1W55 A;  2RHJ A;  2OZB A;  4TV8 B;  4O4J A;  4EB6 B;  1Q86 H;  1X25 A;  5BMV B;  2K1S A;  4ZI7 B;  3M4S A;  4X20 A;  1IPA A;  4IHJ B;  3MDO A;  3F6M A;  3N2K A;  3RYH B;  1W40 A;  5HY1 A;  3JCM M;  3CCL F;  4I4T A;  3GYQ A;  1OAP A;  4F6R B;  2AIF A;  1VHA A;  3WJP A;  5FNV A;  3IEW A;  5IJ9 B;  5ITZ B;  2BTU A;  3K0T A;  3M84 A;  1J7H A;  4BT7 A;  2UZH A;  3KHN A;  3IKF A;  2F9Z C;  2ZAU A;  2H6L A;  3N2G B;  1VQN F;  4C8I A;  1YI2 F;  4O2B A;  4TV9 A;  1CN7 A;  1TUB A;  5CA1 B;  2UYJ A;  4I50 A;  3K12 A;  5EAZ A;  2BO1 A;  3F0G A;  2R6R 1;  3NVI B;  3FFM A;  1KQS F;  2LBX A;  4G4W A;  3IR9 A;  3E20 B;  1GX1 A;  4U3J B;  1YJ9 F;  3SIU A;  2P6Y A;  4G88 A;  4LCK A;  4BVR A;  1W59 A;  4EI7 A;  5EYP A;  3LWO C;  3JAW A;  2VGM A;  1H48 A;  2HRU A;  3M1X A;  4YJ3 A;  5EZY A;  3D54 A;  5JQG A;  5CB4 A;  2CZW A;  3RE3 A;  4X1I A;  1PXW A;  2W8B C;  3I56 F;  1SZQ A;  5LOV A;  3C9S A;  2HS4 A;  1W5E A;  3NK7 A;  4TV8 A;  4EB6 A;  5FJ4 C;  1W57 A;  3RA5 A;  3WXM B;  5BMV A;  4X1K B;  5LYJ B;  1SDS A;  3CME F;  4ZI7 A;  1UFY A;  2YXZ A;  4IHJ A;  2HQS C;  3RYH A;  3J7A R;  2KG4 A;  3JVH A;  4BT2 A;  1E7K A;  3D01 A;  4F6R A;  5C8Y B;  3WGL A;  5FLX M;  1VQ7 F;  1IV3 A;  5IJ9 A;  5IJ0 B;  2FGY A;  5ITZ A;  4B45 A;  3NK6 A;  1UI9 A;  3G71 F;  3IKE A;  5CA0 B;  3MCA B;  3N2G A;  5HWE A;  4ZHQ B;  3WGN A;  1YQN A;  3QTY A;  4EI8 A;  5CA1 A;  5GON B;  3RA6 A;  3ZP7 A;  3F0E A;  1JN1 A;  2LBW A;  1COM A;  2Z1E A;  2GLZ A;  2QA4 F;  3CCV F;  4BT4 A;  3CC2 F;  4C8E A;  1JJ2 F;  4U3J A;  4C82 A;  5KX5 B;  4O2A B; 
#chains in the Genus database with same CATH homology
 1DT9 A;  5HY2 A;  1IPA A;  5HY0 A;  1W40 A;  3OBY A;  5HY1 A;  3JCM M;  3CCL F;  3CC7 F;  3GYQ A;  3NVK E;  2AIF A;  3OBW A;  1Q7Y H;  3CC4 F;  4TZZ A;  3CD6 F;  2FC3 A;  2QEX F;  1M90 H;  5G4U C;  3PAF A;  2JNB A;  1K9M H;  1NMU B;  1QVF F;  3D00 A;  3SIV A;  3CMA F;  5A2Q M;  2F9Z C;  1K73 H;  1VQN F;  3CXC F;  5HXZ A;  5EWR A;  1YI2 F;  3HJW C;  3J80 M;  1NJI H;  4NQ3 A;  1CN7 A;  1VQP F;  1W42 A;  3AGK A;  2BO1 A;  4BVT A;  2KTU A;  1VQ8 F;  3CCM F;  3CCR F;  3CCE F;  1Q82 H;  3NVI B;  1GO1 A;  3FFM A;  1VQ6 F;  3LWR C;  1YJW F;  2ALE A;  1K8A H;  1X7O A;  1KQS F;  2LBX A;  3IR9 A;  3E20 B;  2I6D A;  4BVQ A;  2KTV A;  1YJ9 F;  3SIU A;  1X52 A;  5HXU A;  3CPQ A;  4LCK A;  4BVR A;  3LFO A;  1YHQ F;  2OHW A;  2WAL A;  5EO3 A;  4EI7 A;  3LWO C;  3O85 A;  5IT9 M;  2VGM A;  3CPW F;  1GO0 A;  4EI9 A;  3LWV C;  5GIO C;  4NUT A;  2CZW A;  5GAN K;  3CCQ F;  3CCS F;  1PXW A;  3I56 F;  2VGN A;  3LWQ C;  5DCV A;  3ON1 A;  3CCU F;  2OTL F;  3G4S F;  3E1Y A;  3OW2 F;  1KD1 H;  1ZWZ A;  3VI6 A;  3NK7 A;  3G6E F;  1S72 F;  5FJ4 C;  1H7M A;  1VQL F;  3I55 F;  1W3E X;  3RA5 A;  3WXM B;  3HAX D;  1YIJ F;  1SDS A;  5GIP C;  3CME F;  1Q81 H;  3N4Z A;  1VQO F;  1W2B F;  2QI2 A;  5G4V C;  1QVG F;  3V3T A;  4BVS A;  1KC8 H;  4XCQ A;  1VQ9 F;  3J7A R;  2KG4 A;  3V7Q A;  1YIT F;  4BY9 D;  1E7K A;  4C4W C;  1VQM F;  3J81 M;  5FLX M;  1VQ7 F;  3N4Y A;  1GZ0 A;  2FGY A;  1YJN F;  1RLG A;  3PLA C;  3NK6 A;  3V7E A;  4X3L A;  3G71 F;  4BW0 B;  1RA4 A;  1XBI A;  3CG6 A;  3NMU C;  3MCA B;  5HY4 A;  1T0K B;  4X3M A;  5HWE A;  5GIN C;  1M1K H;  3LWP C;  4EI8 A;  3JAM M;  1N8R H;  1VQ4 F;  3RA6 A;  1VQK F;  3CCJ F;  5GAP K;  1W41 A;  2LBW A;  2OZB A;  1CK2 A;  3VMF B;  1Q86 H;  2GLZ A;  2QA4 F;  3CCV F;  3CC2 F;  2HVY D;  1JJ2 F;  2OTJ F;  1X7P A;  1VQ5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...