1K73H

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k73H00
4C4WC 1W41A 5GIOC 3PLAC 2LBWA 3WXMB 2WALA 1QVGF 3N4ZA 3I56F 1GO1A 2QEXF 3CC4F 5EO3A 3SIUA 2JNBA 5GIPC 1NMUB 2QA4F 3OBWA 1VQKF 2KTUA 3CCLF 3J80M 1YJWF 1VQ6F 2QI2A 3VI6A 1M90H 5IT9M 3CCQF 2KG4A 3LWVC 1Q7YH 3OW2F 1T0KB 3CMEF 3LWOC 3NVIB 3GYQA 1NJIH 1VQ8F 2CZWA 1Q86H 1JJ2F 3G4SF 3IR9A 5FJ4C 2VGMA 2VGNA 3CCJF 1YIJF 3HJWC 5G4UC 1CK2A 1ZWZA 2I6DA 3V7QA 1W40A 3VMFB 1H7MA 4X3LA 3CPQA 3J7AR 1N8RH 1Q81H 2OZBA 3NMUC 2AIFA 3CCVF 5GINC 3J81M 3CCMF 1S72F 2OHWA 1KQSF 3LFOA 3V7EA 1VQOF 3FFMA 1RLGA 1X7OA 2OTJF 3CXCF 3HAXD 2LBXA 1GO0A 1M1KH 3E20B 2BO1A 1KD1H 3N4YA 2OTLF 1XBIA 1W2BF 1VQLF 5FLXM 1DT9A 3OBYA 2KTVA 4X3MA 1CN7A 1K9MH 3CPWF 3MCAB 1PXWA 3G71F 4TZZA 3CMAF 5GANK 1Q82H 3RA6A 2ALEA 3NK7A 3RA5A 1W42A 3CC2F 1X52A 1VQMF 1W3EX 3PAFA 1E7KA 3AGKA 1QVFF 5A2QM 1IPAA 3NK6A 1VQPF 1VQ5F 1YJNF 3ON1A 3O85A 1K73H 1VQ7F 4LCKA 3CCEF 3CD6F 1KC8H 1VQ4F 1SDSA 1VQNF 3LWPC 4BW0B 2FC3A 3JAMM 3LWRC 3CG6A 1YI2F 3LWQC 5G4VC 5GAPK 1K8AH 3NVKE 3CCUF 1YJ9F 4NUTA 3G6EF 1RA4A 1VQ9F 3E1YA 1YITF 3CCRF 3CCSF 3CC7F 1YHQF 5DCVA 5EWRA 3JCMM 1X7PA 2HVYD 3SIVA 4BY9D 1GZ0A 3I55F
chains in the Genus database with same CATH superfamily
2GLZA 2LBWA 5HXZA 2WALA 1TVKA 3I56F 1GO1A 3SIUA 1W581 3RYHA 2Z1UA 1X25A 3HKBB 5AVMA 2BTOA 4XCQA 1FFXA 4C81A 3J80M 3D00A 1YJWF 5EZYB 3F0EA 4ZK7A 5JQGB 2YYEA 3FD5A 3VI6A 1W5EA 3CCQF 3JAKA 2KG4A 3LWVC 5ITZA 5KMGA 5MN6A 4O4HB 5FJ4C 2VGMA 3VOBA 2IG8A 3CCJF 5G4UC 2HS0A 3WGKA 3TD3A 5LP6B 1N8RH 5IJ0A 2HRUA 4U39A 2Z1FA 2W8BC 1Q8RA 2N48A 4G4WA 1FFXB 1S72F 2OHWA 1Z5WA 3C8LA 5KX5B 3BYQA 5IJ9B 1UFYA 4I50A 3VYSC 3DDNA 4ZI7B 5CA1A 1M1KH 3HKCA 3E22A 4I50B 1KD1H 2HP0A 4R40B 3EORA 4YJ3A 1XBIA 4BT5A 4RQOA 2UYJA 4C82A 1VQLF 3VYUC 5FLXM 1DT9A 5HXUA 3RYFB 5LA6B 2EWCA 2Q1YA 1KNKA 1CN7A 2UYKA 2UYNB 4WBNA 3FD6A 4NWOB 1H48A 5FNVB 1FSZA 5J2TA 2LCAA 1ODEA 3HKDA 1W55A 4X20A 5JH7A 3S03A 4BVTA 5LYJA 1JFFB 4TV9B 4ZOLA 1W42A 3T80A 1X52A 1VQMF 4YJ3B 2UYPA 3JAKB 3TD4A 1E7KA 4FFBB 3IEWA 1IV2A 2QTPA 4IHJB 5JCOA 4ZI7A 1YJNF 3ON1A 3ZP7A 3FBAA 5JVDA 4LCKA 3K0TA 5EB0A 3CD6F 1VQ4F 4I4TB 1VQNF 2BTUA 3MBMA 3LWPC 2FC3A 3RYIA 1OFUA 2P6YA 5MN5A 3CG6A 5CA0A 3I7TA 4F6RB 2ZF8A 4HNAB 5GAPK 3LYBA 2CHSA 3F6MA 3G6EF 3P10A 4O2AB 4O4LB 3CC7F 5EWRA 2HP3A 3JCMM 1X7PA 5EZYA 5JQGA 3N2GA 1U3LA 2FGYA 3KJKA 4O2BB 3UT5B 3TD5A 4C4WC 3HKBA 3RYHB 3PLAC 3C9SA 3JAWA 2DYYA 3WJPA 3N4ZA 5EYPB 3MDOA 1QVGF 4X1KB 1W57A 2RHHA 5IJ9A 3OBWA 2HS4A 4C8GA 2PMPA 2KTUA 3ESJA 1OAPA 4YJ2A 3HTNA 5LXTA 1DBFA 3V3TA 2PHNA 3OW2F 1T0KB 3CMEF 2CZWA 3G4SF 4ZHQA 3JAWB 3HJWC 2L26A 3KE1A 5HY4A 5B8FA 1W40A 3VMFB 1QD9A 2VXYA 2RHJA 5IYZA 5MN4A 4IIJB 1RQ7A 4X1IA 1RLUA 3KIZA 5EYPA 1VQOF 3QUWA 3FFMA 1RLGA 4ZHVA 1U43A 1YQNA 3IEQA 2RHOA 3CB2A 3CXCF 4LNUA 3HAXD 1GO0A 5C8YB 3IKFA 4B45A 5C8YA 3KHNA 4WBNB 4I4TA 2KTVA 4X3MA 4KWEA 5LOVB 2RHLA 3WJQA 3JALA 3Q8HA 3MCAB 1PXWA 4HNAA 4NQ3A 4BVRA 3D54A 2H6LA 3FPIA 1W5AA 4EB6A 1Q82H 3RA6A 3CYPB 4BT7A 3HKCB 2UZHA 4DRXA 5CA1B 5HY1A 1W3EX 3AGKA 4DRXB 4ZHWA 4ZHQB 4TV9A 2LBTA 1IPAA 3NK6A 4O2BA 3O85A 3JARB 2MQEA 3JATB 2CWJA 2G9IA 4EI9A 1KC8H 2CHTA 4O4HA 5LA6A 3JAMM 4I55A 5BMVB 4X1YA 3CYQA 4EI7A 1K8AH 4NUTA 2Q1XA 2Z1EA 3E1YA 3CCSF 4E6EA 1CLIA 3UT5A 3ZO8A 5JVDB 2ZAUA 3C9UA 4TV8B 3JASA 4IHJA 2VAMA 3C9TA 5J2UA 1W41A 3WJRA 1TUBA 5GIOC 2DT4A 3WXMB 1UI9A 2QEXF 3HKDB 1JFFA 2HX0A 3CC4F 5EO3A 5CA0B 3N2KB 5CB4A 5EIBC 1NMUB 2QA4F 2AIZP 1GX1A 5FNVA 1VQKF 2R6R1 3F0DA 2AMTA 5EAZA 2QI2A 3JVHA 3V4DA 3LMEA 1W5BA 4B46A 3LWOC 3MCQA 1SA0B 3RYCA 4ERHA 3IR9A 4FFBA 3RE3A 3E22B 1QAHA 3WGMA 2VGNA 5EIBD 1YIJF 5HY2A 4EB6B 1JY8A 3S02A 2I6DA 5HY0A 3S0HA 1H7MA 4X3LA 3CPQA 2OZBA 1Q81H 5LYJB 2HRYA 3WPWA 3K12A 2ZODA 5LOVA 3CCMF 5IJ0B 1KQSF 4G4VA 1W59A 5LP6A 3V7EA 1X7OA 5CB4B 2OTJF 4BT6A 4O4JA 4B62A 3S06A 4EI8A 3N4YA 2NMUA 2OTLF 3I3FA 5J2UB 3JATA 3P0ZA 1W2BF 1JN1A 5ITZB 5KMGB 1ONIA 3QTYA 2VAPA 2GVIA 1RQ2A 3RYFA 3HKEA 1J7HA 3G71F 2CVLA 3OONA 1Z5VA 3CMAF 1VK3A 3GTZA 4ZHYB 1VQVA 3K14A 2ALEA 2GZLA 3NK7A 4C8EA 3RA5A 1FNJA 3WPXA 3WGNA 4ZOLB 3ZOPA 3VCZA 1VQPF 1VQ5F 5LXTB 4G4YA 1QU9A 3CCEF 3QHDA 5GONA 2UYNA 4PWTA 5HP8A 2CSLA 3JARA 3VO8A 4X1KA 3ERNA 3VYTC 5LP6C 1IV1A 5G4VC 1H47A 1VQ9F 1YITF 3CCRF 3B6NA 4U3JB 3F0GA 3P4EA 2HVYD 5HP7A 3IMPA 3E20B 2I6RA 4TUYA 2CW4A 2HS3A 3RYIB 3N2KA 1U40A 4I55B 5BMVA 4TUYB 3WGJA 1XV2A 2Z1TA 1IV4A 2JNBA 1PF5A 2RB9A 3S0WA 5GIPC 4G4ZA 4LNUB 1VH8A 2ZOVA 4O4IB 3CCLF 4IIJA 1VQ6F 2KGWA 2H8CA 4BT4A 3C9RA 1M90H 5IT9M 1Q7YH 1T0AA 1IV3A 2V9YA 3S0YA 3NVIB 3GYQA 1NJIH 2R751 4B5CA 1VQ8F 2OTMA 1Q86H 1JJ2F 3D01A 1TVKB 3M4SA 4BT3A 1SA0A 3RYCB 5J2TB 1CK2A 1ZWZA 3F0FA 3V7QA 3J7AR 5GONB 3VOAA 3NMUC 1XRGA 2AIFA 5HWEA 3CCVF 4BVQA 3J81M 5GINC 3K2XA 2B33A 2VAWA 3LFOA 4BT2A 2LBXA 2HP0B 2BO1A 2YXZA 2HQSC 5EB1B 1TUBB 1W5FA 4U3JA 1COMA 3LDTA 3N2GB 3JASB 3OBYA 4DXDA 4TV8A 2K1SA 2ZVYA 5IYZB 1K9MH 3CPWF 3DC2A 4TZZA 3JALB 3M1XA 1FNKA 5GANK 4RHAA 2H8EA 4X20B 5JH7B 3CC2F 1JD1A 4F6RA 4X1YB 3PAFA 4C8IA 3HWUA 1KNJA 3WGLA 1QVFF 1VHAA 1U3PA 5A2QM 4YJ2B 5JCOC 1K73H 1VQ7F 2IQQA 2BTQB 2IAFA 3IKEA 3U0OA 2Z01A 4G88A 4M8IA 4X1IB 1NQ3A 1SDSA 1XHOA 2ZVZA 3M84A 4O4IA 3LWRC 4BW0B 5KX5A 1YI2F 3ELCA 3MQWA 3LWQC 3HKEB 3NVKE 3ZP4A 3CCUF 1YJ9F 1YGYA 4G4XA 4BVSA 1RA4A 4O4JB 3KJJA 2F9ZC 1YHQF 3VIUA 5DCVA 1SZQA 4O2AA 3VTIC 3SIVA 3R0PA 4O4LA 4BY9D 3GHZA 1GZ0A 3I55F 3L7QA 1R1MA
chains in the Genus database with same CATH topology
4C4WC 1W41A 5GIOC 2GLZA 3PLAC 2LBWA 5HXZA 3WXMB 2WALA 1QVGF 3N4ZA 3I56F 1GO1A 2QEXF 3CC4F 5EO3A 3SIUA 2JNBA 5GIPC 1NMUB 2QA4F 3OBWA 1VQKF 4XCQA 2KTUA 3CCLF 3J80M 3D00A 1YJWF 1VQ6F 2QI2A 3V3TA 3VI6A 1M90H 5IT9M 3CCQF 2KG4A 3LWVC 1Q7YH 3OW2F 1T0KB 3CMEF 3LWOC 3NVIB 3GYQA 1NJIH 1VQ8F 2CZWA 1Q86H 1JJ2F 3G4SF 3IR9A 5FJ4C 2VGMA 2VGNA 3CCJF 1YIJF 5HY2A 3HJWC 5G4UC 1CK2A 1ZWZA 2I6DA 5HY4A 1W40A 3V7QA 1H7MA 4X3LA 3CPQA 3VMFB 5HY0A 3J7AR 1N8RH 1Q81H 2OZBA 3NMUC 2AIFA 5HWEA 3CCVF 4BVQA 3J81M 5GINC 3CCMF 1S72F 2OHWA 1KQSF 3LFOA 3V7EA 1VQOF 3FFMA 1RLGA 1X7OA 2OTJF 3CXCF 3HAXD 2LBXA 1GO0A 1M1KH 2BO1A 1KD1H 4EI8A 3N4YA 2OTLF 1XBIA 1W2BF 1VQLF 5HXUA 5FLXM 1DT9A 3OBYA 2KTVA 4X3MA 1CN7A 1K9MH 3CPWF 3MCAB 1PXWA 4NQ3A 4BVRA 3G71F 4TZZA 3CMAF 3I55F 5GANK 1Q82H 3RA6A 4BVTA 2ALEA 3NK7A 3RA5A 1W42A 3CC2F 1X52A 1VQMF 5HY1A 1W3EX 3PAFA 1E7KA 3AGKA 1QVFF 5A2QM 1IPAA 3NK6A 1VQPF 1VQ5F 1YJNF 3ON1A 3O85A 1K73H 1VQ7F 4LCKA 3CCEF 3CD6F 4EI9A 1KC8H 1VQ4F 1SDSA 1VQNF 3LWPC 4BW0B 2FC3A 3JAMM 3LWRC 3CG6A 1YI2F 3LWQC 4EI7A 5G4VC 5GAPK 1K8AH 3CCUF 1YJ9F 3NVKE 4NUTA 4BVSA 3G6EF 1RA4A 1VQ9F 3E1YA 1YITF 3CCRF 2F9ZC 3CCSF 3CC7F 1YHQF 5DCVA 5EWRA 3JCMM 1X7PA 2HVYD 3SIVA 4BY9D 2FGYA 1GZ0A 3E20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4W C;  1W41 A;  5GIO C;  3PLA C;  2LBW A;  3WXM B;  2WAL A;  1QVG F;  3N4Z A;  3I56 F;  1GO1 A;  2QEX F;  3CC4 F;  5EO3 A;  3SIU A;  2JNB A;  5GIP C;  1NMU B;  2QA4 F;  3OBW A;  1VQK F;  2KTU A;  3CCL F;  3J80 M;  1YJW F;  1VQ6 F;  2QI2 A;  3VI6 A;  1M90 H;  5IT9 M;  3CCQ F;  2KG4 A;  3LWV C;  1Q7Y H;  3OW2 F;  1T0K B;  3CME F;  3LWO C;  3NVI B;  3GYQ A;  1NJI H;  1VQ8 F;  2CZW A;  1Q86 H;  1JJ2 F;  3G4S F;  3IR9 A;  5FJ4 C;  2VGM A;  2VGN A;  3CCJ F;  1YIJ F;  3HJW C;  5G4U C;  1CK2 A;  1ZWZ A;  2I6D A;  3V7Q A;  1W40 A;  3VMF B;  1H7M A;  4X3L A;  3CPQ A;  3J7A R;  1N8R H;  1Q81 H;  2OZB A;  3NMU C;  2AIF A;  3CCV F;  5GIN C;  3J81 M;  3CCM F;  1S72 F;  2OHW A;  1KQS F;  3LFO A;  3V7E A;  1VQO F;  3FFM A;  1RLG A;  1X7O A;  2OTJ F;  3CXC F;  3HAX D;  2LBX A;  1GO0 A;  1M1K H;  3E20 B;  2BO1 A;  1KD1 H;  3N4Y A;  2OTL F;  1XBI A;  1W2B F;  1VQL F;  5FLX M;  1DT9 A;  3OBY A;  2KTV A;  4X3M A;  1CN7 A;  1K9M H;  3CPW F;  3MCA B;  1PXW A;  3G71 F;  4TZZ A;  3CMA F;  5GAN K;  1Q82 H;  3RA6 A;  2ALE A;  3NK7 A;  3RA5 A;  1W42 A;  3CC2 F;  1X52 A;  1VQM F;  1W3E X;  3PAF A;  1E7K A;  3AGK A;  1QVF F;  5A2Q M;  1IPA A;  3NK6 A;  1VQP F;  1VQ5 F;  1YJN F;  3ON1 A;  3O85 A;  1K73 H;  1VQ7 F;  4LCK A;  3CCE F;  3CD6 F;  1KC8 H;  1VQ4 F;  1SDS A;  1VQN F;  3LWP C;  4BW0 B;  2FC3 A;  3JAM M;  3LWR C;  3CG6 A;  1YI2 F;  3LWQ C;  5G4V C;  5GAP K;  1K8A H;  3NVK E;  3CCU F;  1YJ9 F;  4NUT A;  3G6E F;  1RA4 A;  1VQ9 F;  3E1Y A;  1YIT F;  3CCR F;  3CCS F;  3CC7 F;  1YHQ F;  5DCV A;  5EWR A;  3JCM M;  1X7P A;  2HVY D;  3SIV A;  4BY9 D;  1GZ0 A;  3I55 F; 
#chains in the Genus database with same CATH topology
 2GLZ A;  2LBW A;  5HXZ A;  2WAL A;  1TVK A;  3I56 F;  1GO1 A;  3SIU A;  1W58 1;  3RYH A;  2Z1U A;  1X25 A;  3HKB B;  5AVM A;  2BTO A;  4XCQ A;  1FFX A;  4C81 A;  3J80 M;  3D00 A;  1YJW F;  5EZY B;  3F0E A;  4ZK7 A;  5JQG B;  2YYE A;  3FD5 A;  3VI6 A;  1W5E A;  3CCQ F;  3JAK A;  2KG4 A;  3LWV C;  5ITZ A;  5KMG A;  5MN6 A;  4O4H B;  5FJ4 C;  2VGM A;  3VOB A;  2IG8 A;  3CCJ F;  5G4U C;  2HS0 A;  3WGK A;  3TD3 A;  5LP6 B;  1N8R H;  5IJ0 A;  2HRU A;  4U39 A;  2Z1F A;  2W8B C;  1Q8R A;  2N48 A;  4G4W A;  1FFX B;  1S72 F;  2OHW A;  1Z5W A;  3C8L A;  5KX5 B;  3BYQ A;  5IJ9 B;  1UFY A;  4I50 A;  3VYS C;  3DDN A;  4ZI7 B;  5CA1 A;  1M1K H;  3HKC A;  3E22 A;  4I50 B;  1KD1 H;  2HP0 A;  4R40 B;  3EOR A;  4YJ3 A;  1XBI A;  4BT5 A;  4RQO A;  2UYJ A;  4C82 A;  1VQL F;  3VYU C;  5FLX M;  1DT9 A;  5HXU A;  3RYF B;  5LA6 B;  2EWC A;  2Q1Y A;  1KNK A;  1CN7 A;  2UYK A;  2UYN B;  4WBN A;  3FD6 A;  4NWO B;  1H48 A;  5FNV B;  1FSZ A;  5J2T A;  2LCA A;  1ODE A;  3HKD A;  1W55 A;  4X20 A;  5JH7 A;  3S03 A;  4BVT A;  5LYJ A;  1JFF B;  4TV9 B;  4ZOL A;  1W42 A;  3T80 A;  1X52 A;  1VQM F;  4YJ3 B;  2UYP A;  3JAK B;  3TD4 A;  1E7K A;  4FFB B;  3IEW A;  1IV2 A;  2QTP A;  4IHJ B;  5JCO A;  4ZI7 A;  1YJN F;  3ON1 A;  3ZP7 A;  3FBA A;  5JVD A;  4LCK A;  3K0T A;  5EB0 A;  3CD6 F;  1VQ4 F;  4I4T B;  1VQN F;  2BTU A;  3MBM A;  3LWP C;  2FC3 A;  3RYI A;  1OFU A;  2P6Y A;  5MN5 A;  3CG6 A;  5CA0 A;  3I7T A;  4F6R B;  2ZF8 A;  4HNA B;  5GAP K;  3LYB A;  2CHS A;  3F6M A;  3G6E F;  3P10 A;  4O2A B;  4O4L B;  3CC7 F;  5EWR A;  2HP3 A;  3JCM M;  1X7P A;  5EZY A;  5JQG A;  3N2G A;  1U3L A;  2FGY A;  3KJK A;  4O2B B;  3UT5 B;  3TD5 A;  4C4W C;  3HKB A;  3RYH B;  3PLA C;  3C9S A;  3JAW A;  2DYY A;  3WJP A;  3N4Z A;  5EYP B;  3MDO A;  1QVG F;  4X1K B;  1W57 A;  2RHH A;  5IJ9 A;  3OBW A;  2HS4 A;  4C8G A;  2PMP A;  2KTU A;  3ESJ A;  1OAP A;  4YJ2 A;  3HTN A;  5LXT A;  1DBF A;  3V3T A;  2PHN A;  3OW2 F;  1T0K B;  3CME F;  2CZW A;  3G4S F;  4ZHQ A;  3JAW B;  3HJW C;  2L26 A;  3KE1 A;  5HY4 A;  5B8F A;  1W40 A;  3VMF B;  1QD9 A;  2VXY A;  2RHJ A;  5IYZ A;  5MN4 A;  4IIJ B;  1RQ7 A;  4X1I A;  1RLU A;  3KIZ A;  5EYP A;  1VQO F;  3QUW A;  3FFM A;  1RLG A;  4ZHV A;  1U43 A;  1YQN A;  3IEQ A;  2RHO A;  3CB2 A;  3CXC F;  4LNU A;  3HAX D;  1GO0 A;  5C8Y B;  3IKF A;  4B45 A;  5C8Y A;  3KHN A;  4WBN B;  4I4T A;  2KTV A;  4X3M A;  4KWE A;  5LOV B;  2RHL A;  3WJQ A;  3JAL A;  3Q8H A;  3MCA B;  1PXW A;  4HNA A;  4NQ3 A;  4BVR A;  3D54 A;  2H6L A;  3FPI A;  1W5A A;  4EB6 A;  1Q82 H;  3RA6 A;  3CYP B;  4BT7 A;  3HKC B;  2UZH A;  4DRX A;  5CA1 B;  5HY1 A;  1W3E X;  3AGK A;  4DRX B;  4ZHW A;  4ZHQ B;  4TV9 A;  2LBT A;  1IPA A;  3NK6 A;  4O2B A;  3O85 A;  3JAR B;  2MQE A;  3JAT B;  2CWJ A;  2G9I A;  4EI9 A;  1KC8 H;  2CHT A;  4O4H A;  5LA6 A;  3JAM M;  4I55 A;  5BMV B;  4X1Y A;  3CYQ A;  4EI7 A;  1K8A H;  4NUT A;  2Q1X A;  2Z1E A;  3E1Y A;  3CCS F;  4E6E A;  1CLI A;  3UT5 A;  3ZO8 A;  5JVD B;  2ZAU A;  3C9U A;  4TV8 B;  3JAS A;  4IHJ A;  2VAM A;  3C9T A;  5J2U A;  1W41 A;  3WJR A;  1TUB A;  5GIO C;  2DT4 A;  3WXM B;  1UI9 A;  2QEX F;  3HKD B;  1JFF A;  2HX0 A;  3CC4 F;  5EO3 A;  5CA0 B;  3N2K B;  5CB4 A;  5EIB C;  1NMU B;  2QA4 F;  2AIZ P;  1GX1 A;  5FNV A;  1VQK F;  2R6R 1;  3F0D A;  2AMT A;  5EAZ A;  2QI2 A;  3JVH A;  3V4D A;  3LME A;  1W5B A;  4B46 A;  3LWO C;  3MCQ A;  1SA0 B;  3RYC A;  4ERH A;  3IR9 A;  4FFB A;  3RE3 A;  3E22 B;  1QAH A;  3WGM A;  2VGN A;  5EIB D;  1YIJ F;  5HY2 A;  4EB6 B;  1JY8 A;  3S02 A;  2I6D A;  5HY0 A;  3S0H A;  1H7M A;  4X3L A;  3CPQ A;  2OZB A;  1Q81 H;  5LYJ B;  2HRY A;  3WPW A;  3K12 A;  2ZOD A;  5LOV A;  3CCM F;  5IJ0 B;  1KQS F;  4G4V A;  1W59 A;  5LP6 A;  3V7E A;  1X7O A;  5CB4 B;  2OTJ F;  4BT6 A;  4O4J A;  4B62 A;  3S06 A;  4EI8 A;  3N4Y A;  2NMU A;  2OTL F;  3I3F A;  5J2U B;  3JAT A;  3P0Z A;  1W2B F;  1JN1 A;  5ITZ B;  5KMG B;  1ONI A;  3QTY A;  2VAP A;  2GVI A;  1RQ2 A;  3RYF A;  3HKE A;  1J7H A;  3G71 F;  2CVL A;  3OON A;  1Z5V A;  3CMA F;  1VK3 A;  3GTZ A;  4ZHY B;  1VQV A;  3K14 A;  2ALE A;  2GZL A;  3NK7 A;  4C8E A;  3RA5 A;  1FNJ A;  3WPX A;  3WGN A;  4ZOL B;  3ZOP A;  3VCZ A;  1VQP F;  1VQ5 F;  5LXT B;  4G4Y A;  1QU9 A;  3CCE F;  3QHD A;  5GON A;  2UYN A;  4PWT A;  5HP8 A;  2CSL A;  3JAR A;  3VO8 A;  4X1K A;  3ERN A;  3VYT C;  5LP6 C;  1IV1 A;  5G4V C;  1H47 A;  1VQ9 F;  1YIT F;  3CCR F;  3B6N A;  4U3J B;  3F0G A;  3P4E A;  2HVY D;  5HP7 A;  3IMP A;  3E20 B;  2I6R A;  4TUY A;  2CW4 A;  2HS3 A;  3RYI B;  3N2K A;  1U40 A;  4I55 B;  5BMV A;  4TUY B;  3WGJ A;  1XV2 A;  2Z1T A;  1IV4 A;  2JNB A;  1PF5 A;  2RB9 A;  3S0W A;  5GIP C;  4G4Z A;  4LNU B;  1VH8 A;  2ZOV A;  4O4I B;  3CCL F;  4IIJ A;  1VQ6 F;  2KGW A;  2H8C A;  4BT4 A;  3C9R A;  1M90 H;  5IT9 M;  1Q7Y H;  1T0A A;  1IV3 A;  2V9Y A;  3S0Y A;  3NVI B;  3GYQ A;  1NJI H;  2R75 1;  4B5C A;  1VQ8 F;  2OTM A;  1Q86 H;  1JJ2 F;  3D01 A;  1TVK B;  3M4S A;  4BT3 A;  1SA0 A;  3RYC B;  5J2T B;  1CK2 A;  1ZWZ A;  3F0F A;  3V7Q A;  3J7A R;  5GON B;  3VOA A;  3NMU C;  1XRG A;  2AIF A;  5HWE A;  3CCV F;  4BVQ A;  3J81 M;  5GIN C;  3K2X A;  2B33 A;  2VAW A;  3LFO A;  4BT2 A;  2LBX A;  2HP0 B;  2BO1 A;  2YXZ A;  2HQS C;  5EB1 B;  1TUB B;  1W5F A;  4U3J A;  1COM A;  3LDT A;  3N2G B;  3JAS B;  3OBY A;  4DXD A;  4TV8 A;  2K1S A;  2ZVY A;  5IYZ B;  1K9M H;  3CPW F;  3DC2 A;  4TZZ A;  3JAL B;  3M1X A;  1FNK A;  5GAN K;  4RHA A;  2H8E A;  4X20 B;  5JH7 B;  3CC2 F;  1JD1 A;  4F6R A;  4X1Y B;  3PAF A;  4C8I A;  3HWU A;  1KNJ A;  3WGL A;  1QVF F;  1VHA A;  1U3P A;  5A2Q M;  4YJ2 B;  5JCO C;  1K73 H;  1VQ7 F;  2IQQ A;  2BTQ B;  2IAF A;  3IKE A;  3U0O A;  2Z01 A;  4G88 A;  4M8I A;  4X1I B;  1NQ3 A;  1SDS A;  1XHO A;  2ZVZ A;  3M84 A;  4O4I A;  3LWR C;  4BW0 B;  5KX5 A;  1YI2 F;  3ELC A;  3MQW A;  3LWQ C;  3HKE B;  3NVK E;  3ZP4 A;  3CCU F;  1YJ9 F;  1YGY A;  4G4X A;  4BVS A;  1RA4 A;  4O4J B;  3KJJ A;  2F9Z C;  1YHQ F;  3VIU A;  5DCV A;  1SZQ A;  4O2A A;  3VTI C;  3SIV A;  3R0P A;  4O4L A;  4BY9 D;  3GHZ A;  1GZ0 A;  3I55 F;  3L7Q A;  1R1M A; 
#chains in the Genus database with same CATH homology
 4C4W C;  1W41 A;  5GIO C;  2GLZ A;  3PLA C;  2LBW A;  5HXZ A;  3WXM B;  2WAL A;  1QVG F;  3N4Z A;  3I56 F;  1GO1 A;  2QEX F;  3CC4 F;  5EO3 A;  3SIU A;  2JNB A;  5GIP C;  1NMU B;  2QA4 F;  3OBW A;  1VQK F;  4XCQ A;  2KTU A;  3CCL F;  3J80 M;  3D00 A;  1YJW F;  1VQ6 F;  2QI2 A;  3V3T A;  3VI6 A;  1M90 H;  5IT9 M;  3CCQ F;  2KG4 A;  3LWV C;  1Q7Y H;  3OW2 F;  1T0K B;  3CME F;  3LWO C;  3NVI B;  3GYQ A;  1NJI H;  1VQ8 F;  2CZW A;  1Q86 H;  1JJ2 F;  3G4S F;  3IR9 A;  5FJ4 C;  2VGM A;  2VGN A;  3CCJ F;  1YIJ F;  5HY2 A;  3HJW C;  5G4U C;  1CK2 A;  1ZWZ A;  2I6D A;  5HY4 A;  1W40 A;  3V7Q A;  1H7M A;  4X3L A;  3CPQ A;  3VMF B;  5HY0 A;  3J7A R;  1N8R H;  1Q81 H;  2OZB A;  3NMU C;  2AIF A;  5HWE A;  3CCV F;  4BVQ A;  3J81 M;  5GIN C;  3CCM F;  1S72 F;  2OHW A;  1KQS F;  3LFO A;  3V7E A;  1VQO F;  3FFM A;  1RLG A;  1X7O A;  2OTJ F;  3CXC F;  3HAX D;  2LBX A;  1GO0 A;  1M1K H;  2BO1 A;  1KD1 H;  4EI8 A;  3N4Y A;  2OTL F;  1XBI A;  1W2B F;  1VQL F;  5HXU A;  5FLX M;  1DT9 A;  3OBY A;  2KTV A;  4X3M A;  1CN7 A;  1K9M H;  3CPW F;  3MCA B;  1PXW A;  4NQ3 A;  4BVR A;  3G71 F;  4TZZ A;  3CMA F;  3I55 F;  5GAN K;  1Q82 H;  3RA6 A;  4BVT A;  2ALE A;  3NK7 A;  3RA5 A;  1W42 A;  3CC2 F;  1X52 A;  1VQM F;  5HY1 A;  1W3E X;  3PAF A;  1E7K A;  3AGK A;  1QVF F;  5A2Q M;  1IPA A;  3NK6 A;  1VQP F;  1VQ5 F;  1YJN F;  3ON1 A;  3O85 A;  1K73 H;  1VQ7 F;  4LCK A;  3CCE F;  3CD6 F;  4EI9 A;  1KC8 H;  1VQ4 F;  1SDS A;  1VQN F;  3LWP C;  4BW0 B;  2FC3 A;  3JAM M;  3LWR C;  3CG6 A;  1YI2 F;  3LWQ C;  4EI7 A;  5G4V C;  5GAP K;  1K8A H;  3CCU F;  1YJ9 F;  3NVK E;  4NUT A;  4BVS A;  3G6E F;  1RA4 A;  1VQ9 F;  3E1Y A;  1YIT F;  3CCR F;  2F9Z C;  3CCS F;  3CC7 F;  1YHQ F;  5DCV A;  5EWR A;  3JCM M;  1X7P A;  2HVY D;  3SIV A;  4BY9 D;  2FGY A;  1GZ0 A;  3E20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...