1K73H

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1k73H00
3VI6A 2VGMA 1YJWF 5GANK 1RA4A 3N4ZA 4X3MA 1VQMF 1VQOF 4BW0B 1VQ4F 1Q82H 1CK2A 1GO1A 2OHWA 4NUTA 2QA4F 1K9MH 3CC2F 3SIVA 4LCKA 4X3LA 2QEXF 1DT9A 5DCVA 3NVIB 2OTLF 3J80M 3JAMM 3CCRF 5A2QM 1M90H 2KG4A 1VQNF 3CMAF 2KTVA 2I6DA 3G6EF 3PAFA 1NMUB 1KD1H 1S72F 3PLAC 1CN7A 5FLXM 3CCQF 5G4UC 3VMFB 3J7AR 5FJ4C 1RLGA 1T0KB 3IR9A 2LBWA 3CG6A 5EWRA 1K8AH 3LWVC 2JNBA 3LWRC 3CCVF 3E1YA 1YJ9F 3LWQC 3JCMM 3G71F 3CCUF 3CCMF 3LWPC 3I55F 2WALA 1IPAA 1Q7YH 2VGNA 1NJIH 1W2BF 4C4WC 3AGKA 5GINC 3CD6F 3CPWF 1X52A 3HJWC 1X7PA 1ZWZA 1H7MA 1XBIA 2AIFA 3OBWA 3CCJF 1QVGF 5EO3A 5G4VC 3HAXD 3SIUA 3NVKE 3OW2F 2KTUA 1KC8H 1PXWA 3CMEF 3OBYA 1SDSA 3CCEF 5GIPC 5GAPK 3CC7F 3LFOA 1JJ2F 3V7QA 2CZWA 3CCLF 3E20B 1YITF 1Q86H 3NMUC 1GZ0A 1YI2F 1Q81H 1VQPF 3NK7A 3O85A 1YHQF 3LWOC 1W40A 1E7KA 4BY9D 3I56F 3WXMB 1KQSF 3MCAB 2BO1A 1VQ5F 1VQKF 1QVFF 3RA6A 3GYQA 1K73H 1VQ7F 4TZZA 3ON1A 1W42A 1X7OA 1YJNF 3CC4F 3CXCF 3N4YA 1VQ9F 3V7EA 2OZBA 1YIJF 1VQ6F 1W3EX 1VQ8F 2FC3A 1N8RH 1VQLF 1M1KH 3CCSF 3FFMA 2OTJF 5GIOC 3NK6A 2ALEA 5IT9M 1W41A 1GO0A 3G4SF 2LBXA 2QI2A 3CPQA 2HVYD 3J81M 3RA5A
chains in the Genus database with same CATH superfamily
4LNUB 5CA0B 1YGYA 3HKDB 4WBNA 2NMUA 1QD9A 2Z01A 3QHDA 4F6RB 2H8CA 5LOVB 1Q82H 3BYQA 3JALA 2QA4F 2L26A 3VYUC 3ZO8A 2QEXF 2OTLF 3S02A 3HKBB 3CCRF 4BT7A 5JQGB 5CB4A 3WGKA 4ZI7B 1FNKA 2OTMA 3DDNA 1H47A 4BVRA 3C9SA 4U39A 5KMGA 3F0DA 4BVQA 5JCOA 3QUWA 1CN7A 3HTNA 1U43A 3F0EA 5IYZA 1FFXA 4WBNB 3HKEB 3GHZA 3LMEA 5B8FA 3LYBA 3G71F 3CCMF 3JALB 4NWOB 2B33A 1FSZA 3JAWB 2VGNA 4TV9A 3TD3A 5GINC 4O2BB 4EI9A 5CB4B 1H7MA 3CCJF 3OBWA 4BT3A 2BTOA 3UT5A 4U3JB 2ZF8A 2GZLA 2IAFA 3HAXD 4BT2A 3SIUA 3T80A 2KTUA 3M1XA 3EORA 4X1IA 1PXWA 2DYYA 4ZHYB 3C9RA 2AMTA 3N2KB 5IYZB 3CCEF 5EAZA 2ZOVA 3CC7F 1JD1A 3VOBA 1JJ2F 4ZHQB 4G4WA 3E20B 2CSLA 3CCLF 1Q86H 1YI2F 1Q81H 3Q8HA 3NK7A 2F9ZC 4DXDA 4IIJA 1YHQF 3ZOPA 3VYTC 4TV8B 4BY9D 2G9IA 2BTUA 1YQNA 3IKEA 3FD5A 3MCAB 1VHAA 3U0OA 1VQ5F 3TD4A 3ON1A 5GONB 1X7OA 2HP0A 1CLIA 3M4SA 3N4YA 3V7EA 2OZBA 1YIJF 3MDOA 4EB6B 1VQ8F 5AVMA 2RHHA 3FFMA 2HS3A 3VOAA 1TUBB 3NK6A 2CWJA 3RYHA 5EIBD 3KE1A 4O4JA 2LBXA 1DBFA 4LNUA 5LXTB 3CPQA 4R40B 3HKDA 1XBIA 4IIJB 1W581 4BVSA 4ZOLB 4F6RA 2YYEA 4X3MA 5C8YA 1VQMF 4I4TA 1U3LA 5LOVA 4IHJB 2GLZA 3HWUA 3VYSC 3C9UA 3FPIA 3K2XA 4BW0B 1CK2A 1RQ7A 2OHWA 1VQ4F 1R1MA 1K9MH 3CC2F 2RHLA 4X3LA 5HXZA 3OONA 3WGLA 5DCVA 3WJRA 3N2GA 4RQOA 4ZI7A 1IV1A 2GVIA 5A2QM 3MCQA 2KG4A 1T0AA 1VQNF 3DC2A 2HS0A 3RYHB 2KGWA 2Q1XA 3PAFA 1KD1H 2H6LA 3ZP4A 3E22B 3HKEA 3CCQF 3KIZA 3J7AR 5FJ4C 1T0KB 3IR9A 1K8AH 3JASA 5C8YB 3LWVC 4I4TB 3JARB 3LWRC 3WJQA 3CCVF 3E1YA 5LP6C 3C9TA 4ERHA 3LWPC 3JAWA 2UYPA 3RYFB 3WJPA 3P10A 1Q7YH 4O2BA 3N2GB 1XV2A 1VQVA 3KJJA 4M8IA 3AGKA 2ZVYA 4O4LA 3CD6F 1GX1A 1W5FA 3F6MA 3HJWC 4O4IB 4G4XA 4U3JA 4BT6A 4O2AB 1QVGF 3IEWA 3N2KA 1XHOA 1W5AA 4TUYB 3ESJA 5IJ9A 4ZK7A 4ZHQA 4G4YA 2VXYA 5MN4A 4X1YA 3JASB 5HXUA 2CZWA 1YITF 3O85A 3LDTA 2RHJA 4TV8A 3RE3A 3LWOC 1RQ2A 3F0GA 1W40A 1QAHA 2CW4A 3WXMB 4O4LB 1QVFF 3S0WA 3GYQA 1K73H 4YJ3A 5GONA 4X20B 5EZYA 5FNVA 5HY0A 2BTQB 1KNJA 4EB6A 1W55A 2HQSC 4C82A 3F0FA 3WGJA 4FFBA 1TUBA 4DRXA 3D54A 5IJ9B 1M1KH 5JCOC 1VQLF 4E6EA 4X1YB 2VAPA 3ERNA 3TD5A 1KNKA 5LXTA 4B62A 4C8GA 1GO0A 1COMA 4ZOLA 2RHOA 3J81M 3RA5A 2CVLA 3VI6A 3FBAA 4G4ZA 1RA4A 4IHJA 1VK3A 1W5EA 1Z5WA 4G88A 4YJ3B 4XCQA 5EZYB 1GO1A 2Q1YA 4BT4A 5FNVB 3M84A 3SIVA 3GTZA 3RYCA 2QTPA 1DT9A 4B5CA 3WPWA 3NVIB 3J80M 3JAMM 2CHTA 4HNAA 1M90H 3JAKB 4FFBB 2AIZP 4DRXB 4O4HA 4G4VA 2I6RA 2YXZA 3G6EF 3VIUA 5LA6B 1NMUB 5JH7B 3E22A 2UYNA 1S72F 3KJKA 1JY8A 2UZHA 1ODEA 3CB2A 3I3FA 5ITZB 5KX5A 2UYKA 3VMFB 2ZVZA 3JARA 2LBWA 5EWRA 2V9YA 3CYQA 1X25A 3D01A 3JATA 3RYFA 3LWQC 2HRYA 3CCUF 4EI8A 1JFFA 3JVHA 3RYCB 3WGNA 2UYJA 5HP8A 2Z1FA 4C4WC 2HP3A 3VCZA 3CYPB 4HNAB 1IV2A 4O4IA 1J7HA 5IJ0A 4O4HB 1X52A 4O2AA 1X7PA 1ZWZA 3CPWF 5LYJB 3S03A 2AIFA 3S0YA 5EYPB 1RLUA 3IKFA 2LCAA 3QTYA 5EO3A 5G4VC 2UYNB 3NVKE 3ZP7A 4TUYA 3OW2F 3VTIC 2PHNA 1QU9A 5KX5B 5J2UB 5MN6A 5HWEA 5HY4A 3V3TA 3V7QA 1SA0A 1GZ0A 1VQPF 2ZODA 3JATB 3KHNA 4B45A 1JFFB 1SZQA 1XRGA 4C81A 5BMVA 4YJ2B 3K0TA 5LP6B 1U3PA 2BO1A 2W8BC 1TVKB 4X20A 5JVDB 5IJ0B 5J2TB 3RA6A 3RYIA 3D00A 1W57A 3CC4F 3CXCF 1VQ9F 4I50B 1VQ6F 4EI7A 1W3EX 2FC3A 3IEQA 4B46A 3C8LA 3B6NA 3CCSF 1JN1A 2OTJF 5GIOC 2ALEA 1SA0B 1W41A 2R6R1 3G4SF 4X1KB 1H48A 4I55A 1W5BA 5BMVB 2VGMA 1YJWF 5GANK 3N4ZA 2HX0A 1ONIA 2EWCA 1VQOF 3RYIB 2N48A 4NUTA 2K1SA 2HRUA 4LCKA 3JAKA 4ZHVA 1IV4A 2FGYA 4NQ3A 2Z1TA 3VO8A 2Z1EA 2ZAUA 5EB1B 5HY1A 3CMAF 1W59A 2KTVA 5LA6A 2I6DA 5JH7A 3ELCA 1U40A 3PLAC 5ITZA 5KMGB 4BT5A 5FLXM 4I55B 3P0ZA 1VQKF 4C8EA 5G4UC 1RLGA 3CG6A 2VAMA 1FFXB 2JNBA 1VH8A 3R0PA 5HY2A 1YJ9F 3JCMM 2P6YA 1IV3A 3MQWA 4PWTA 3I55F 1OAPA 2WALA 1IPAA 3IMPA 3P4EA 4C8IA 1NJIH 1W2BF 3V4DA 5LYJA 4TV9B 2CHSA 1FNJA 5EYPA 1PF5A 5EB0A 2IG8A 2RB9A 3S06A 3UT5B 4ZHWA 1UI9A 3WPXA 1KC8H 5J2UA 3CMEF 3OBYA 4X1IB 4BVTA 1SDSA 5MN5A 5GIPC 5GAPK 5CA1A 3LFOA 3HKCA 3NMUC 1OFUA 4KWEA 2MQEA 4YJ2A 2HS4A 2H8EA 5CA0A 2IQQA 1E7KA 3FD6A 3I56F 5LP6A 3S0HA 5JVDA 5J2TA 1TVKA 1UFYA 5HP7A 1KQSF 3MBMA 3I7TA 1VQ7F 2DT4A 4TZZA 1W42A 1YJNF 2Z1UA 4I50A 1NQ3A 2R751 5EIBC 2HP0B 3HKBA 4RHAA 1Z5VA 3K14A 1Q8RA 2VAWA 5JQGA 1N8RH 5CA1B 3HKCB 3L7QA 4X1KA 5IT9M 3WGMA 2QI2A 2HVYD 2PMPA 3K12A 2LBTA 4O4JB
chains in the Genus database with same CATH topology
4BVSA 3VI6A 2VGMA 1YJWF 5GANK 1RA4A 3N4ZA 4X3MA 1VQMF 2GLZA 1VQOF 4XCQA 4BW0B 1VQ4F 1Q82H 1CK2A 1GO1A 2OHWA 4NUTA 2QA4F 1K9MH 3CC2F 3SIVA 4LCKA 4X3LA 5HXZA 2QEXF 1DT9A 5DCVA 3NVIB 2FGYA 3J80M 2OTLF 3JAMM 4NQ3A 3CCRF 5A2QM 1M90H 2KG4A 5HY1A 1VQNF 3CMAF 2KTVA 2I6DA 4BVRA 3G6EF 3PAFA 1NMUB 4BVQA 1KD1H 1S72F 3PLAC 1CN7A 5FLXM 3CCQF 5G4UC 3VMFB 3J7AR 5FJ4C 1RLGA 1T0KB 3IR9A 2LBWA 3CG6A 5EWRA 1K8AH 3LWVC 2JNBA 3LWRC 3CCVF 5HY2A 3E1YA 1YJ9F 3LWQC 3JCMM 3G71F 3CCUF 3CCMF 3LWPC 4EI8A 3I55F 2WALA 1IPAA 1Q7YH 2VGNA 1NJIH 1W2BF 4C4WC 3AGKA 5GINC 3CD6F 4EI9A 3CPWF 1X52A 3HJWC 1X7PA 1ZWZA 1H7MA 1XBIA 2AIFA 3OBWA 3CCJF 1QVGF 5EO3A 5G4VC 3HAXD 3SIUA 3NVKE 3OW2F 2KTUA 1KC8H 1PXWA 3CMEF 3OBYA 4BVTA 1SDSA 3CCEF 5GIPC 5HWEA 5GAPK 5HY4A 3V3TA 3CC7F 3LFOA 5HXUA 1JJ2F 3V7QA 2CZWA 3CCLF 3E20B 1YITF 1Q86H 3NMUC 1GZ0A 1YI2F 1Q81H 1VQPF 3NK7A 2F9ZC 3O85A 1YHQF 3LWOC 1W40A 1E7KA 4BY9D 3I56F 3WXMB 1KQSF 3MCAB 2BO1A 1VQ5F 1VQKF 1QVFF 3RA6A 3GYQA 1K73H 1VQ7F 3D00A 4TZZA 5HY0A 3ON1A 1W42A 1X7OA 1YJNF 3CC4F 3CXCF 3N4YA 1VQ9F 3V7EA 2OZBA 1YIJF 1VQ6F 4EI7A 1W3EX 1VQ8F 2FC3A 1N8RH 1VQLF 1M1KH 3CCSF 3FFMA 2OTJF 5GIOC 3NK6A 2ALEA 5IT9M 1W41A 1GO0A 3G4SF 2LBXA 2QI2A 3CPQA 2HVYD 3J81M 3RA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  2VGM A;  1YJW F;  5GAN K;  1RA4 A;  3N4Z A;  4X3M A;  1VQM F;  1VQO F;  4BW0 B;  1VQ4 F;  1Q82 H;  1CK2 A;  1GO1 A;  2OHW A;  4NUT A;  2QA4 F;  1K9M H;  3CC2 F;  3SIV A;  4LCK A;  4X3L A;  2QEX F;  1DT9 A;  5DCV A;  3NVI B;  2OTL F;  3J80 M;  3JAM M;  3CCR F;  5A2Q M;  1M90 H;  2KG4 A;  1VQN F;  3CMA F;  2KTV A;  2I6D A;  3G6E F;  3PAF A;  1NMU B;  1KD1 H;  1S72 F;  3PLA C;  1CN7 A;  5FLX M;  3CCQ F;  5G4U C;  3VMF B;  3J7A R;  5FJ4 C;  1RLG A;  1T0K B;  3IR9 A;  2LBW A;  3CG6 A;  5EWR A;  1K8A H;  3LWV C;  2JNB A;  3LWR C;  3CCV F;  3E1Y A;  1YJ9 F;  3LWQ C;  3JCM M;  3G71 F;  3CCU F;  3CCM F;  3LWP C;  3I55 F;  2WAL A;  1IPA A;  1Q7Y H;  2VGN A;  1NJI H;  1W2B F;  4C4W C;  3AGK A;  5GIN C;  3CD6 F;  3CPW F;  1X52 A;  3HJW C;  1X7P A;  1ZWZ A;  1H7M A;  1XBI A;  2AIF A;  3OBW A;  3CCJ F;  1QVG F;  5EO3 A;  5G4V C;  3HAX D;  3SIU A;  3NVK E;  3OW2 F;  2KTU A;  1KC8 H;  1PXW A;  3CME F;  3OBY A;  1SDS A;  3CCE F;  5GIP C;  5GAP K;  3CC7 F;  3LFO A;  1JJ2 F;  3V7Q A;  2CZW A;  3CCL F;  3E20 B;  1YIT F;  1Q86 H;  3NMU C;  1GZ0 A;  1YI2 F;  1Q81 H;  1VQP F;  3NK7 A;  3O85 A;  1YHQ F;  3LWO C;  1W40 A;  1E7K A;  4BY9 D;  3I56 F;  3WXM B;  1KQS F;  3MCA B;  2BO1 A;  1VQ5 F;  1VQK F;  1QVF F;  3RA6 A;  3GYQ A;  1K73 H;  1VQ7 F;  4TZZ A;  3ON1 A;  1W42 A;  1X7O A;  1YJN F;  3CC4 F;  3CXC F;  3N4Y A;  1VQ9 F;  3V7E A;  2OZB A;  1YIJ F;  1VQ6 F;  1W3E X;  1VQ8 F;  2FC3 A;  1N8R H;  1VQL F;  1M1K H;  3CCS F;  3FFM A;  2OTJ F;  5GIO C;  3NK6 A;  2ALE A;  5IT9 M;  1W41 A;  1GO0 A;  3G4S F;  2LBX A;  2QI2 A;  3CPQ A;  2HVY D;  3J81 M;  3RA5 A; 
#chains in the Genus database with same CATH topology
 4LNU B;  5CA0 B;  1YGY A;  3HKD B;  4WBN A;  2NMU A;  1QD9 A;  2Z01 A;  3QHD A;  4F6R B;  2H8C A;  5LOV B;  1Q82 H;  3BYQ A;  3JAL A;  2QA4 F;  2L26 A;  3VYU C;  3ZO8 A;  2QEX F;  2OTL F;  3S02 A;  3HKB B;  3CCR F;  4BT7 A;  5JQG B;  5CB4 A;  3WGK A;  4ZI7 B;  1FNK A;  2OTM A;  3DDN A;  1H47 A;  4BVR A;  3C9S A;  4U39 A;  5KMG A;  3F0D A;  4BVQ A;  5JCO A;  3QUW A;  1CN7 A;  3HTN A;  1U43 A;  3F0E A;  5IYZ A;  1FFX A;  4WBN B;  3HKE B;  3GHZ A;  3LME A;  5B8F A;  3LYB A;  3G71 F;  3CCM F;  3JAL B;  4NWO B;  2B33 A;  1FSZ A;  3JAW B;  2VGN A;  4TV9 A;  3TD3 A;  5GIN C;  4O2B B;  4EI9 A;  5CB4 B;  1H7M A;  3CCJ F;  3OBW A;  4BT3 A;  2BTO A;  3UT5 A;  4U3J B;  2ZF8 A;  2GZL A;  2IAF A;  3HAX D;  4BT2 A;  3SIU A;  3T80 A;  2KTU A;  3M1X A;  3EOR A;  4X1I A;  1PXW A;  2DYY A;  4ZHY B;  3C9R A;  2AMT A;  3N2K B;  5IYZ B;  3CCE F;  5EAZ A;  2ZOV A;  3CC7 F;  1JD1 A;  3VOB A;  1JJ2 F;  4ZHQ B;  4G4W A;  3E20 B;  2CSL A;  3CCL F;  1Q86 H;  1YI2 F;  1Q81 H;  3Q8H A;  3NK7 A;  2F9Z C;  4DXD A;  4IIJ A;  1YHQ F;  3ZOP A;  3VYT C;  4TV8 B;  4BY9 D;  2G9I A;  2BTU A;  1YQN A;  3IKE A;  3FD5 A;  3MCA B;  1VHA A;  3U0O A;  1VQ5 F;  3TD4 A;  3ON1 A;  5GON B;  1X7O A;  2HP0 A;  1CLI A;  3M4S A;  3N4Y A;  3V7E A;  2OZB A;  1YIJ F;  3MDO A;  4EB6 B;  1VQ8 F;  5AVM A;  2RHH A;  3FFM A;  2HS3 A;  3VOA A;  1TUB B;  3NK6 A;  2CWJ A;  3RYH A;  5EIB D;  3KE1 A;  4O4J A;  2LBX A;  1DBF A;  4LNU A;  5LXT B;  3CPQ A;  4R40 B;  3HKD A;  1XBI A;  4IIJ B;  1W58 1;  4BVS A;  4ZOL B;  4F6R A;  2YYE A;  4X3M A;  5C8Y A;  1VQM F;  4I4T A;  1U3L A;  5LOV A;  4IHJ B;  2GLZ A;  3HWU A;  3VYS C;  3C9U A;  3FPI A;  3K2X A;  4BW0 B;  1CK2 A;  1RQ7 A;  2OHW A;  1VQ4 F;  1R1M A;  1K9M H;  3CC2 F;  2RHL A;  4X3L A;  5HXZ A;  3OON A;  3WGL A;  5DCV A;  3WJR A;  3N2G A;  4RQO A;  4ZI7 A;  1IV1 A;  2GVI A;  5A2Q M;  3MCQ A;  2KG4 A;  1T0A A;  1VQN F;  3DC2 A;  2HS0 A;  3RYH B;  2KGW A;  2Q1X A;  3PAF A;  1KD1 H;  2H6L A;  3ZP4 A;  3E22 B;  3HKE A;  3CCQ F;  3KIZ A;  3J7A R;  5FJ4 C;  1T0K B;  3IR9 A;  1K8A H;  3JAS A;  5C8Y B;  3LWV C;  4I4T B;  3JAR B;  3LWR C;  3WJQ A;  3CCV F;  3E1Y A;  5LP6 C;  3C9T A;  4ERH A;  3LWP C;  3JAW A;  2UYP A;  3RYF B;  3WJP A;  3P10 A;  1Q7Y H;  4O2B A;  3N2G B;  1XV2 A;  1VQV A;  3KJJ A;  4M8I A;  3AGK A;  2ZVY A;  4O4L A;  3CD6 F;  1GX1 A;  1W5F A;  3F6M A;  3HJW C;  4O4I B;  4G4X A;  4U3J A;  4BT6 A;  4O2A B;  1QVG F;  3IEW A;  3N2K A;  1XHO A;  1W5A A;  4TUY B;  3ESJ A;  5IJ9 A;  4ZK7 A;  4ZHQ A;  4G4Y A;  2VXY A;  5MN4 A;  4X1Y A;  3JAS B;  5HXU A;  2CZW A;  1YIT F;  3O85 A;  3LDT A;  2RHJ A;  4TV8 A;  3RE3 A;  3LWO C;  1RQ2 A;  3F0G A;  1W40 A;  1QAH A;  2CW4 A;  3WXM B;  4O4L B;  1QVF F;  3S0W A;  3GYQ A;  1K73 H;  4YJ3 A;  5GON A;  4X20 B;  5EZY A;  5FNV A;  5HY0 A;  2BTQ B;  1KNJ A;  4EB6 A;  1W55 A;  2HQS C;  4C82 A;  3F0F A;  3WGJ A;  4FFB A;  1TUB A;  4DRX A;  3D54 A;  5IJ9 B;  1M1K H;  5JCO C;  1VQL F;  4E6E A;  4X1Y B;  2VAP A;  3ERN A;  3TD5 A;  1KNK A;  5LXT A;  4B62 A;  4C8G A;  1GO0 A;  1COM A;  4ZOL A;  2RHO A;  3J81 M;  3RA5 A;  2CVL A;  3VI6 A;  3FBA A;  4G4Z A;  1RA4 A;  4IHJ A;  1VK3 A;  1W5E A;  1Z5W A;  4G88 A;  4YJ3 B;  4XCQ A;  5EZY B;  1GO1 A;  2Q1Y A;  4BT4 A;  5FNV B;  3M84 A;  3SIV A;  3GTZ A;  3RYC A;  2QTP A;  1DT9 A;  4B5C A;  3WPW A;  3NVI B;  3J80 M;  3JAM M;  2CHT A;  4HNA A;  1M90 H;  3JAK B;  4FFB B;  2AIZ P;  4DRX B;  4O4H A;  4G4V A;  2I6R A;  2YXZ A;  3G6E F;  3VIU A;  5LA6 B;  1NMU B;  5JH7 B;  3E22 A;  2UYN A;  1S72 F;  3KJK A;  1JY8 A;  2UZH A;  1ODE A;  3CB2 A;  3I3F A;  5ITZ B;  5KX5 A;  2UYK A;  3VMF B;  2ZVZ A;  3JAR A;  2LBW A;  5EWR A;  2V9Y A;  3CYQ A;  1X25 A;  3D01 A;  3JAT A;  3RYF A;  3LWQ C;  2HRY A;  3CCU F;  4EI8 A;  1JFF A;  3JVH A;  3RYC B;  3WGN A;  2UYJ A;  5HP8 A;  2Z1F A;  4C4W C;  2HP3 A;  3VCZ A;  3CYP B;  4HNA B;  1IV2 A;  4O4I A;  1J7H A;  5IJ0 A;  4O4H B;  1X52 A;  4O2A A;  1X7P A;  1ZWZ A;  3CPW F;  5LYJ B;  3S03 A;  2AIF A;  3S0Y A;  5EYP B;  1RLU A;  3IKF A;  2LCA A;  3QTY A;  5EO3 A;  5G4V C;  2UYN B;  3NVK E;  3ZP7 A;  4TUY A;  3OW2 F;  3VTI C;  2PHN A;  1QU9 A;  5KX5 B;  5J2U B;  5MN6 A;  5HWE A;  5HY4 A;  3V3T A;  3V7Q A;  1SA0 A;  1GZ0 A;  1VQP F;  2ZOD A;  3JAT B;  3KHN A;  4B45 A;  1JFF B;  1SZQ A;  1XRG A;  4C81 A;  5BMV A;  4YJ2 B;  3K0T A;  5LP6 B;  1U3P A;  2BO1 A;  2W8B C;  1TVK B;  4X20 A;  5JVD B;  5IJ0 B;  5J2T B;  3RA6 A;  3RYI A;  3D00 A;  1W57 A;  3CC4 F;  3CXC F;  1VQ9 F;  4I50 B;  1VQ6 F;  4EI7 A;  1W3E X;  2FC3 A;  3IEQ A;  4B46 A;  3C8L A;  3B6N A;  3CCS F;  1JN1 A;  2OTJ F;  5GIO C;  2ALE A;  1SA0 B;  1W41 A;  2R6R 1;  3G4S F;  4X1K B;  1H48 A;  4I55 A;  1W5B A;  5BMV B;  2VGM A;  1YJW F;  5GAN K;  3N4Z A;  2HX0 A;  1ONI A;  2EWC A;  1VQO F;  3RYI B;  2N48 A;  4NUT A;  2K1S A;  2HRU A;  4LCK A;  3JAK A;  4ZHV A;  1IV4 A;  2FGY A;  4NQ3 A;  2Z1T A;  3VO8 A;  2Z1E A;  2ZAU A;  5EB1 B;  5HY1 A;  3CMA F;  1W59 A;  2KTV A;  5LA6 A;  2I6D A;  5JH7 A;  3ELC A;  1U40 A;  3PLA C;  5ITZ A;  5KMG B;  4BT5 A;  5FLX M;  4I55 B;  3P0Z A;  1VQK F;  4C8E A;  5G4U C;  1RLG A;  3CG6 A;  2VAM A;  1FFX B;  2JNB A;  1VH8 A;  3R0P A;  5HY2 A;  1YJ9 F;  3JCM M;  2P6Y A;  1IV3 A;  3MQW A;  4PWT A;  3I55 F;  1OAP A;  2WAL A;  1IPA A;  3IMP A;  3P4E A;  4C8I A;  1NJI H;  1W2B F;  3V4D A;  5LYJ A;  4TV9 B;  2CHS A;  1FNJ A;  5EYP A;  1PF5 A;  5EB0 A;  2IG8 A;  2RB9 A;  3S06 A;  3UT5 B;  4ZHW A;  1UI9 A;  3WPX A;  1KC8 H;  5J2U A;  3CME F;  3OBY A;  4X1I B;  4BVT A;  1SDS A;  5MN5 A;  5GIP C;  5GAP K;  5CA1 A;  3LFO A;  3HKC A;  3NMU C;  1OFU A;  4KWE A;  2MQE A;  4YJ2 A;  2HS4 A;  2H8E A;  5CA0 A;  2IQQ A;  1E7K A;  3FD6 A;  3I56 F;  5LP6 A;  3S0H A;  5JVD A;  5J2T A;  1TVK A;  1UFY A;  5HP7 A;  1KQS F;  3MBM A;  3I7T A;  1VQ7 F;  2DT4 A;  4TZZ A;  1W42 A;  1YJN F;  2Z1U A;  4I50 A;  1NQ3 A;  2R75 1;  5EIB C;  2HP0 B;  3HKB A;  4RHA A;  1Z5V A;  3K14 A;  1Q8R A;  2VAW A;  5JQG A;  1N8R H;  5CA1 B;  3HKC B;  3L7Q A;  4X1K A;  5IT9 M;  3WGM A;  2QI2 A;  2HVY D;  2PMP A;  3K12 A;  2LBT A;  4O4J B; 
#chains in the Genus database with same CATH homology
 4BVS A;  3VI6 A;  2VGM A;  1YJW F;  5GAN K;  1RA4 A;  3N4Z A;  4X3M A;  1VQM F;  2GLZ A;  1VQO F;  4XCQ A;  4BW0 B;  1VQ4 F;  1Q82 H;  1CK2 A;  1GO1 A;  2OHW A;  4NUT A;  2QA4 F;  1K9M H;  3CC2 F;  3SIV A;  4LCK A;  4X3L A;  5HXZ A;  2QEX F;  1DT9 A;  5DCV A;  3NVI B;  2FGY A;  3J80 M;  2OTL F;  3JAM M;  4NQ3 A;  3CCR F;  5A2Q M;  1M90 H;  2KG4 A;  5HY1 A;  1VQN F;  3CMA F;  2KTV A;  2I6D A;  4BVR A;  3G6E F;  3PAF A;  1NMU B;  4BVQ A;  1KD1 H;  1S72 F;  3PLA C;  1CN7 A;  5FLX M;  3CCQ F;  5G4U C;  3VMF B;  3J7A R;  5FJ4 C;  1RLG A;  1T0K B;  3IR9 A;  2LBW A;  3CG6 A;  5EWR A;  1K8A H;  3LWV C;  2JNB A;  3LWR C;  3CCV F;  5HY2 A;  3E1Y A;  1YJ9 F;  3LWQ C;  3JCM M;  3G71 F;  3CCU F;  3CCM F;  3LWP C;  4EI8 A;  3I55 F;  2WAL A;  1IPA A;  1Q7Y H;  2VGN A;  1NJI H;  1W2B F;  4C4W C;  3AGK A;  5GIN C;  3CD6 F;  4EI9 A;  3CPW F;  1X52 A;  3HJW C;  1X7P A;  1ZWZ A;  1H7M A;  1XBI A;  2AIF A;  3OBW A;  3CCJ F;  1QVG F;  5EO3 A;  5G4V C;  3HAX D;  3SIU A;  3NVK E;  3OW2 F;  2KTU A;  1KC8 H;  1PXW A;  3CME F;  3OBY A;  4BVT A;  1SDS A;  3CCE F;  5GIP C;  5HWE A;  5GAP K;  5HY4 A;  3V3T A;  3CC7 F;  3LFO A;  5HXU A;  1JJ2 F;  3V7Q A;  2CZW A;  3CCL F;  3E20 B;  1YIT F;  1Q86 H;  3NMU C;  1GZ0 A;  1YI2 F;  1Q81 H;  1VQP F;  3NK7 A;  2F9Z C;  3O85 A;  1YHQ F;  3LWO C;  1W40 A;  1E7K A;  4BY9 D;  3I56 F;  3WXM B;  1KQS F;  3MCA B;  2BO1 A;  1VQ5 F;  1VQK F;  1QVF F;  3RA6 A;  3GYQ A;  1K73 H;  1VQ7 F;  3D00 A;  4TZZ A;  5HY0 A;  3ON1 A;  1W42 A;  1X7O A;  1YJN F;  3CC4 F;  3CXC F;  3N4Y A;  1VQ9 F;  3V7E A;  2OZB A;  1YIJ F;  1VQ6 F;  4EI7 A;  1W3E X;  1VQ8 F;  2FC3 A;  1N8R H;  1VQL F;  1M1K H;  3CCS F;  3FFM A;  2OTJ F;  5GIO C;  3NK6 A;  2ALE A;  5IT9 M;  1W41 A;  1GO0 A;  3G4S F;  2LBX A;  2QI2 A;  3CPQ A;  2HVY D;  3J81 M;  3RA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...