3CD6F

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cd6F00
2KG4A 3CCQF 1X7PA 3CCRF 3WXMB 3V7QA 1E7KA 4LCKA 1VQ6F 3HJWC 3PLAC 1Q82H 5IT9M 1RA4A 1SDSA 3N4YA 1KC8H 1YHQF 1XBIA 1ZWZA 1QVGF 3I55F 3CPWF 2FC3A 3V7EA 1K9MH 1H7MA 3E1YA 1VQ5F 3IR9A 3OBYA 1Q7YH 2KTUA 3CMAF 4X3LA 3LWQC 2OTLF 3VI6A 1KD1H 3G4SF 3CG6A 1DT9A 1W40A 3MCAB 1W42A 3J80M 5GIPC 1YJ9F 3CC2F 2I6DA 1YIJF 3AGKA 3CCSF 5GAPK 3LWPC 3CPQA 1GO0A 5GIOC 3NK6A 1GO1A 1VQ9F 2QI2A 1NJIH 1RLGA 2QA4F 2VGMA 3CCLF 1YITF 2OZBA 3LFOA 3JAMM 1N8RH 1K8AH 3O85A 1VQLF 3CCUF 1YJNF 1YI2F 5EWRA 1IPAA 5G4VC 2ALEA 1VQPF 1Q81H 3RA6A 5DCVA 1W41A 1VQMF 1CN7A 2WALA 3N4ZA 1NMUB 2VGNA 3JCMM 3HAXD 2QEXF 3CXCF 3NVKE 5G4UC 3OBWA 1M90H 3J81M 1M1KH 3NMUC 3CCJF 2KTVA 5FLXM 5FJ4C 3SIUA 2BO1A 3CC7F 3G71F 4NUTA 1X52A 3CC4F 3CD6F 1KQSF 4X3MA 4BW0B 3OW2F 4BY9D 4C4WC 1CK2A 3CMEF 1Q86H 3PAFA 1YJWF 5EO3A 3I56F 2HVYD 3G6EF 1JJ2F 1W3EX 1VQKF 3CCVF 2AIFA 3CCMF 1VQOF 5A2QM 5GANK 3CCEF 2CZWA 3FFMA 1X7OA 3ON1A 3J7AR 3NVIB 5GINC 1VQNF 2JNBA 2OTJF 2LBWA 1VQ8F 2OHWA 3RA5A 3LWRC 3NK7A 1GZ0A 1T0KB 3E20B 3SIVA 1K73H 1VQ7F 3LWVC 1S72F 1W2BF 4TZZA 3GYQA 1PXWA 2LBXA 1VQ4F 3LWOC 3VMFB 1QVFF
chains in the Genus database with same CATH superfamily
2VAPA 4TV9B 3C9RA 3CCRF 1E7KA 2VXYA 4EB6B 3HJWC 2HP0B 3VIUA 2RHLA 3C9UA 5MN5A 2HS4A 4E6EA 2V9YA 1YHQF 4BT4A 1H47A 5JQGA 3RYCA 3I55F 3U0OA 3E1YA 1VQ5F 1Q7YH 3CMAF 2VAMA 5LOVA 3RYIB 2OTLF 3VI6A 3P10A 5HXUA 3RYHA 3RE3A 4F6RA 4ZHQB 3EORA 3S0WA 1DT9A 3JASA 5FNVA 1W40A 5LP6B 5HWEA 1FSZA 1W42A 1FFXA 3C8LA 4G4ZA 2OTMA 3VYTC 4IIJB 3CC2F 3KJJA 2I6DA 1H48A 3KJKA 3HKCB 4YJ3B 3ZOPA 5EYPB 5IJ9B 3OONA 4O2BB 3VCZA 4BVQA 3JAWA 4ZI7B 1RLGA 2VGMA 5IJ0B 4O4LB 5EZYA 3IMPA 4WBNB 1T0AA 2YXZA 3WJPA 1YJNF 1YI2F 3M4SA 1VK3A 3HKDA 1SA0A 2ALEA 3ZP7A 3RA6A 1JD1A 3ELCA 4DXDA 4TV8A 3D54A 2QEXF 5G4UC 2YYEA 3QHDA 4TV9A 2HS3A 2GZLA 5FLXM 3F0DA 1W5AA 1OAPA 3MQWA 5MN4A 3MCQA 5MN6A 2R6R1 3CC4F 3TD3A 4C81A 2IG8A 4X3MA 3BYQA 4BVSA 3OW2F 1Q86H 3PAFA 2GLZA 3IEQA 5EO3A 3I56F 3F0FA 3G6EF 1W3EX 3RYIA 1RLUA 4X1KA 4ZHQA 5EB0A 5LP6A 5GANK 1X25A 5B8FA 5HP7A 2R751 3F0GA 3FFMA 4IIJA 3I7TA 3J7AR 5GINC 2UYPA 1TVKA 3RYHB 4F6RB 2CHTA 4YJ2A 3JASB 5FNVB 5EYPA 3KHNA 2IQQA 1FFXB 4DRXA 1R1MA 4EI7A 3GYQA 2HRYA 3LDTA 4O2BA 2LBXA 3VOBA 4ZI7A 4ZHVA 1QVFF 2KG4A 4ZOLB 3WJRA 3V7QA 4WBNA 1J7HA 3V4DA 4B46A 2RHJA 3PLAC 1IV4A 3S0HA 1RA4A 3P0ZA 2HS0A 2Z1EA 1XBIA 5CA1B 3D01A 2EWCA 3CPWF 3WGJA 5EZYB 1W5BA 3OBYA 1NQ3A 3WGKA 4X3LA 3C9TA 5JCOC 1KD1H 4BT3A 3HKDB 1SA0B 3CG6A 4IHJB 2NMUA 2BTUA 4LNUA 4X1YB 1W581 3WGNA 3S03A 4U3JB 3AGKA 3HKEA 1UFYA 3LWPC 1YGYA 1GO0A 3NK6A 3F6MA 4X20A 3VTIC 3JVHA 3N2GB 4I50B 1YITF 2OZBA 3LFOA 3JAMM 1N8RH 3HTNA 4BT7A 2Q1YA 4X1KB 3O85A 1VQLF 4NWOB 2ZOVA 4O4JA 1IPAA 2RHOA 5ITZB 1VQMF 3N4ZA 1NMUB 2VGNA 3IEWA 3HAXD 3CXCF 1TVKB 4ZOLA 4YJ2B 5HY0A 1M90H 3J81M 3NMUC 3FD6A 3CCJF 4C8IA 2N48A 1FNJA 4DRXB 3VO8A 5LXTB 2L26A 1PF5A 2I6RA 2KGWA 4ZHWA 5CA1A 4BW0B 2P6YA 4O4IA 3L7QA 5BMVB 1VQKF 3CCVF 2ZF8A 4IHJA 2Z1FA 3ESJA 4EI9A 4X1YA 2DYYA 3K12A 1X7OA 3ON1A 2JNBA 1VHAA 3RA5A 4U3JA 4EI8A 2HQSC 1K73H 4LNUB 4RQOA 3LWVC 3DC2A 1S72F 2H6LA 2HX0A 2CWJA 4TZZA 5KX5B 3S06A 3N2GA 4I50A 3UT5B 3VMFB 4ERHA 1YJ9F 3V7EA 4G4YA 3CCQF 1X7PA 3D00A 3ZO8A 3RYFA 3HKEB 3FBAA 4FFBB 5JH7B 2Z1TA 4LCKA 5CB4A 5EIBD 1DBFA 4X20B 1UI9A 5ITZA 1IV3A 2QTPA 5GONA 1U3PA 1QVGF 2FC3A 2HRUA 2CHSA 1JY8A 4G88A 1ODEA 3LWQC 4O4JB 2UYNB 1SZQA 3G4SF 4ZHYB 4O4HA 1W57A 5LXTA 1JN1A 3J80M 1IV2A 3MDOA 5GIPC 5HXZA 2ZVZA 3I3FA 2H8CA 4BT2A 2BTQB 5BMVA 1YIJF 2PMPA 3ZP4A 3TD5A 3K2XA 1OFUA 4XCQA 4B45A 5GAPK 3WJQA 2LBTA 5GIOC 1VH8A 2Q1XA 2QI2A 4U39A 2H8EA 3CCLF 4O4IB 3VYUC 3KE1A 1QU9A 3VOAA 1K8AH 1XHOA 5HY4A 1Z5WA 3M1XA 3C9SA 3VYSC 3K14A 1JFFB 1Q81H 5DCVA 5KX5A 1U43A 1COMA 1W41A 1U3LA 4BVTA 1FNKA 1VQVA 3UT5A 1KNJA 4BT5A 1RQ7A 4BVRA 5JCOA 3JAKB 3GTZA 2LCAA 4FFBA 5JH7A 3CC7F 3HWUA 4M8IA 2UZHA 1KQSF 5LYJB 3RYFB 4C4WC 1CK2A 2AIZP 1Z5VA 4KWEA 1ONIA 3JATA 1YJWF 2MQEA 2HVYD 5CB4B 3ERNA 1GX1A 4X1IB 2AIFA 2UYNA 3P4EA 3E22B 2ZODA 3IKFA 5GONB 5A2QM 2DT4A 1U40A 5C8YA 4O2AB 3CCEF 2UYJA 5HY1A 2OTJF 4C82A 1VQ8F 4TUYA 2BTOA 4O4HB 3QUWA 3SIVA 3DDNA 5EAZA 5J2TB 1CLIA 1W2BF 3IKEA 3N2KB 1VQ4F 4BT6A 3LWOC 3B6NA 1TUBB 5KMGB 3FD5A 3WXMB 4R40B 1YQNA 5LA6B 1VQ6F 5IT9M 1Q82H 1JFFA 3LMEA 3WGMA 1SDSA 2CVLA 3N4YA 3HKBA 1KC8H 1XRGA 1ZWZA 3F0EA 3CB2A 3MBMA 4I4TA 2F9ZC 1H7MA 5HP8A 5JVDA 3IR9A 3WPWA 1K9MH 3T80A 2KTUA 3JAKA 5IYZB 4HNAB 5AVMA 3TD4A 3MCAB 2W8BC 2GVIA 3JARB 3V3TA 1W5FA 1QD9A 2FGYA 5HY2A 5LYJA 3CYQA 2UYKA 3Q8HA 2K1SA 3QTYA 5J2UB 3CCSF 4X1IA 4C8GA 2VAWA 3JALB 3CPQA 3E22A 4EB6A 1GO1A 1VQ9F 2AMTA 3S0YA 2HP0A 5LP6C 1W59A 5CA0B 1NJIH 4I55B 2HP3A 4O2AA 2QA4F 1IV1A 3JATB 1XV2A 4PWTA 3CCUF 3LYBA 4G4VA 4G4WA 4G4XA 5EWRA 5J2TA 5G4VC 5C8YB 1VQPF 1CN7A 3N2KA 1Q8RA 2PHNA 2WALA 2CW4A 2ZAUA 5JQGB 3JCMM 3RYCB 3NVKE 1TUBA 2RHHA 3OBWA 5KMGA 3KIZA 4TUYB 3S02A 3R0PA 1M1KH 3CYPB 3K0TA 2KTVA 2B33A 5LA6A 5LOVB 3SIUA 5FJ4C 3WPXA 2IAFA 3HKCA 4RHAA 2BO1A 4YJ3A 3G71F 4NUTA 1X52A 4B62A 3FPIA 3CD6F 5IJ9A 3WGLA 4BY9D 2Z1UA 3M84A 3CMEF 5IJ0A 2CSLA 2RB9A 4O4LA 1JJ2F 5IYZA 4B5CA 4HNAA 3CCMF 1VQOF 3HKBB 1QAHA 3JARA 3JAWB 1KNKA 4I4TB 5JVDB 2CZWA 4NQ3A 3NVIB 1VQNF 1W55A 3GHZA 2LBWA 2Z01A 2ZVYA 2OHWA 3LWRC 3NK7A 5J2UA 1GZ0A 1T0KB 3E20B 4ZK7A 3JALA 1RQ2A 1VQ7F 4C8EA 5EB1B 1PXWA 5CA0A 1W5EA 2G9IA 4I55A 4TV8B 5EIBC
chains in the Genus database with same CATH topology
2KG4A 3CCQF 1X7PA 3D00A 3CCRF 3WXMB 3V7QA 1E7KA 4LCKA 1VQ6F 3HJWC 3PLAC 1Q82H 5IT9M 1RA4A 1SDSA 3N4YA 1KC8H 1YHQF 1XBIA 1ZWZA 1QVGF 3I55F 3CPWF 2FC3A 3V7EA 1K9MH 2F9ZC 1H7MA 3E1YA 1VQ5F 3IR9A 3OBYA 1Q7YH 2KTUA 3CMAF 4X3LA 3LWQC 2OTLF 3VI6A 1KD1H 5HXUA 3G4SF 3CG6A 1DT9A 1W40A 5HWEA 3MCAB 1W42A 3J80M 5GIPC 3V3TA 5HXZA 1YJ9F 2FGYA 5HY2A 3CC2F 2I6DA 1YIJF 3AGKA 3CCSF 4XCQA 5GAPK 3LWPC 3CPQA 1GO0A 3NK6A 5GIOC 1GO1A 1VQ9F 2QI2A 4BVQA 1NJIH 1RLGA 2QA4F 2VGMA 3CCLF 1YITF 2OZBA 3LFOA 3JAMM 1N8RH 1K8AH 5HY4A 3O85A 1VQLF 3CCUF 1YJNF 1YI2F 5EWRA 1IPAA 5G4VC 2ALEA 1VQPF 1Q81H 3RA6A 5DCVA 1W41A 1VQMF 1CN7A 2WALA 3N4ZA 1NMUB 2VGNA 3JCMM 4BVTA 3HAXD 2QEXF 3CXCF 3NVKE 5G4UC 3OBWA 4BVRA 5HY0A 1M90H 3J81M 1M1KH 3NMUC 3CCJF 2KTVA 5FLXM 5FJ4C 3SIUA 2BO1A 3CC7F 3G71F 4NUTA 1X52A 3CC4F 3CD6F 1KQSF 4X3MA 4BW0B 4BVSA 3OW2F 4BY9D 4C4WC 1CK2A 3CMEF 1Q86H 3PAFA 2GLZA 5EO3A 3I56F 1YJWF 2HVYD 3G6EF 1JJ2F 1W3EX 1VQKF 3CCVF 2AIFA 3CCMF 1VQOF 5A2QM 5GANK 4EI9A 3CCEF 2CZWA 3FFMA 4NQ3A 5HY1A 1X7OA 3ON1A 3J7AR 3NVIB 5GINC 1VQNF 2JNBA 2OTJF 2LBWA 1VQ8F 2OHWA 3RA5A 3LWRC 3NK7A 4EI8A 1GZ0A 1T0KB 3E20B 3SIVA 1K73H 1VQ7F 3LWVC 4EI7A 1S72F 1W2BF 4TZZA 3GYQA 1PXWA 2LBXA 1VQ4F 3LWOC 3VMFB 1QVFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  3CCQ F;  1X7P A;  3CCR F;  3WXM B;  3V7Q A;  1E7K A;  4LCK A;  1VQ6 F;  3HJW C;  3PLA C;  1Q82 H;  5IT9 M;  1RA4 A;  1SDS A;  3N4Y A;  1KC8 H;  1YHQ F;  1XBI A;  1ZWZ A;  1QVG F;  3I55 F;  3CPW F;  2FC3 A;  3V7E A;  1K9M H;  1H7M A;  3E1Y A;  1VQ5 F;  3IR9 A;  3OBY A;  1Q7Y H;  2KTU A;  3CMA F;  4X3L A;  3LWQ C;  2OTL F;  3VI6 A;  1KD1 H;  3G4S F;  3CG6 A;  1DT9 A;  1W40 A;  3MCA B;  1W42 A;  3J80 M;  5GIP C;  1YJ9 F;  3CC2 F;  2I6D A;  1YIJ F;  3AGK A;  3CCS F;  5GAP K;  3LWP C;  3CPQ A;  1GO0 A;  5GIO C;  3NK6 A;  1GO1 A;  1VQ9 F;  2QI2 A;  1NJI H;  1RLG A;  2QA4 F;  2VGM A;  3CCL F;  1YIT F;  2OZB A;  3LFO A;  3JAM M;  1N8R H;  1K8A H;  3O85 A;  1VQL F;  3CCU F;  1YJN F;  1YI2 F;  5EWR A;  1IPA A;  5G4V C;  2ALE A;  1VQP F;  1Q81 H;  3RA6 A;  5DCV A;  1W41 A;  1VQM F;  1CN7 A;  2WAL A;  3N4Z A;  1NMU B;  2VGN A;  3JCM M;  3HAX D;  2QEX F;  3CXC F;  3NVK E;  5G4U C;  3OBW A;  1M90 H;  3J81 M;  1M1K H;  3NMU C;  3CCJ F;  2KTV A;  5FLX M;  5FJ4 C;  3SIU A;  2BO1 A;  3CC7 F;  3G71 F;  4NUT A;  1X52 A;  3CC4 F;  3CD6 F;  1KQS F;  4X3M A;  4BW0 B;  3OW2 F;  4BY9 D;  4C4W C;  1CK2 A;  3CME F;  1Q86 H;  3PAF A;  1YJW F;  5EO3 A;  3I56 F;  2HVY D;  3G6E F;  1JJ2 F;  1W3E X;  1VQK F;  3CCV F;  2AIF A;  3CCM F;  1VQO F;  5A2Q M;  5GAN K;  3CCE F;  2CZW A;  3FFM A;  1X7O A;  3ON1 A;  3J7A R;  3NVI B;  5GIN C;  1VQN F;  2JNB A;  2OTJ F;  2LBW A;  1VQ8 F;  2OHW A;  3RA5 A;  3LWR C;  3NK7 A;  1GZ0 A;  1T0K B;  3E20 B;  3SIV A;  1K73 H;  1VQ7 F;  3LWV C;  1S72 F;  1W2B F;  4TZZ A;  3GYQ A;  1PXW A;  2LBX A;  1VQ4 F;  3LWO C;  3VMF B;  1QVF F; 
#chains in the Genus database with same CATH topology
 2VAP A;  4TV9 B;  3C9R A;  3CCR F;  1E7K A;  2VXY A;  4EB6 B;  3HJW C;  2HP0 B;  3VIU A;  2RHL A;  3C9U A;  5MN5 A;  2HS4 A;  4E6E A;  2V9Y A;  1YHQ F;  4BT4 A;  1H47 A;  5JQG A;  3RYC A;  3I55 F;  3U0O A;  3E1Y A;  1VQ5 F;  1Q7Y H;  3CMA F;  2VAM A;  5LOV A;  3RYI B;  2OTL F;  3VI6 A;  3P10 A;  5HXU A;  3RYH A;  3RE3 A;  4F6R A;  4ZHQ B;  3EOR A;  3S0W A;  1DT9 A;  3JAS A;  5FNV A;  1W40 A;  5LP6 B;  5HWE A;  1FSZ A;  1W42 A;  1FFX A;  3C8L A;  4G4Z A;  2OTM A;  3VYT C;  4IIJ B;  3CC2 F;  3KJJ A;  2I6D A;  1H48 A;  3KJK A;  3HKC B;  4YJ3 B;  3ZOP A;  5EYP B;  5IJ9 B;  3OON A;  4O2B B;  3VCZ A;  4BVQ A;  3JAW A;  4ZI7 B;  1RLG A;  2VGM A;  5IJ0 B;  4O4L B;  5EZY A;  3IMP A;  4WBN B;  1T0A A;  2YXZ A;  3WJP A;  1YJN F;  1YI2 F;  3M4S A;  1VK3 A;  3HKD A;  1SA0 A;  2ALE A;  3ZP7 A;  3RA6 A;  1JD1 A;  3ELC A;  4DXD A;  4TV8 A;  3D54 A;  2QEX F;  5G4U C;  2YYE A;  3QHD A;  4TV9 A;  2HS3 A;  2GZL A;  5FLX M;  3F0D A;  1W5A A;  1OAP A;  3MQW A;  5MN4 A;  3MCQ A;  5MN6 A;  2R6R 1;  3CC4 F;  3TD3 A;  4C81 A;  2IG8 A;  4X3M A;  3BYQ A;  4BVS A;  3OW2 F;  1Q86 H;  3PAF A;  2GLZ A;  3IEQ A;  5EO3 A;  3I56 F;  3F0F A;  3G6E F;  1W3E X;  3RYI A;  1RLU A;  4X1K A;  4ZHQ A;  5EB0 A;  5LP6 A;  5GAN K;  1X25 A;  5B8F A;  5HP7 A;  2R75 1;  3F0G A;  3FFM A;  4IIJ A;  3I7T A;  3J7A R;  5GIN C;  2UYP A;  1TVK A;  3RYH B;  4F6R B;  2CHT A;  4YJ2 A;  3JAS B;  5FNV B;  5EYP A;  3KHN A;  2IQQ A;  1FFX B;  4DRX A;  1R1M A;  4EI7 A;  3GYQ A;  2HRY A;  3LDT A;  4O2B A;  2LBX A;  3VOB A;  4ZI7 A;  4ZHV A;  1QVF F;  2KG4 A;  4ZOL B;  3WJR A;  3V7Q A;  4WBN A;  1J7H A;  3V4D A;  4B46 A;  2RHJ A;  3PLA C;  1IV4 A;  3S0H A;  1RA4 A;  3P0Z A;  2HS0 A;  2Z1E A;  1XBI A;  5CA1 B;  3D01 A;  2EWC A;  3CPW F;  3WGJ A;  5EZY B;  1W5B A;  3OBY A;  1NQ3 A;  3WGK A;  4X3L A;  3C9T A;  5JCO C;  1KD1 H;  4BT3 A;  3HKD B;  1SA0 B;  3CG6 A;  4IHJ B;  2NMU A;  2BTU A;  4LNU A;  4X1Y B;  1W58 1;  3WGN A;  3S03 A;  4U3J B;  3AGK A;  3HKE A;  1UFY A;  3LWP C;  1YGY A;  1GO0 A;  3NK6 A;  3F6M A;  4X20 A;  3VTI C;  3JVH A;  3N2G B;  4I50 B;  1YIT F;  2OZB A;  3LFO A;  3JAM M;  1N8R H;  3HTN A;  4BT7 A;  2Q1Y A;  4X1K B;  3O85 A;  1VQL F;  4NWO B;  2ZOV A;  4O4J A;  1IPA A;  2RHO A;  5ITZ B;  1VQM F;  3N4Z A;  1NMU B;  2VGN A;  3IEW A;  3HAX D;  3CXC F;  1TVK B;  4ZOL A;  4YJ2 B;  5HY0 A;  1M90 H;  3J81 M;  3NMU C;  3FD6 A;  3CCJ F;  4C8I A;  2N48 A;  1FNJ A;  4DRX B;  3VO8 A;  5LXT B;  2L26 A;  1PF5 A;  2I6R A;  2KGW A;  4ZHW A;  5CA1 A;  4BW0 B;  2P6Y A;  4O4I A;  3L7Q A;  5BMV B;  1VQK F;  3CCV F;  2ZF8 A;  4IHJ A;  2Z1F A;  3ESJ A;  4EI9 A;  4X1Y A;  2DYY A;  3K12 A;  1X7O A;  3ON1 A;  2JNB A;  1VHA A;  3RA5 A;  4U3J A;  4EI8 A;  2HQS C;  1K73 H;  4LNU B;  4RQO A;  3LWV C;  3DC2 A;  1S72 F;  2H6L A;  2HX0 A;  2CWJ A;  4TZZ A;  5KX5 B;  3S06 A;  3N2G A;  4I50 A;  3UT5 B;  3VMF B;  4ERH A;  1YJ9 F;  3V7E A;  4G4Y A;  3CCQ F;  1X7P A;  3D00 A;  3ZO8 A;  3RYF A;  3HKE B;  3FBA A;  4FFB B;  5JH7 B;  2Z1T A;  4LCK A;  5CB4 A;  5EIB D;  1DBF A;  4X20 B;  1UI9 A;  5ITZ A;  1IV3 A;  2QTP A;  5GON A;  1U3P A;  1QVG F;  2FC3 A;  2HRU A;  2CHS A;  1JY8 A;  4G88 A;  1ODE A;  3LWQ C;  4O4J B;  2UYN B;  1SZQ A;  3G4S F;  4ZHY B;  4O4H A;  1W57 A;  5LXT A;  1JN1 A;  3J80 M;  1IV2 A;  3MDO A;  5GIP C;  5HXZ A;  2ZVZ A;  3I3F A;  2H8C A;  4BT2 A;  2BTQ B;  5BMV A;  1YIJ F;  2PMP A;  3ZP4 A;  3TD5 A;  3K2X A;  1OFU A;  4XCQ A;  4B45 A;  5GAP K;  3WJQ A;  2LBT A;  5GIO C;  1VH8 A;  2Q1X A;  2QI2 A;  4U39 A;  2H8E A;  3CCL F;  4O4I B;  3VYU C;  3KE1 A;  1QU9 A;  3VOA A;  1K8A H;  1XHO A;  5HY4 A;  1Z5W A;  3M1X A;  3C9S A;  3VYS C;  3K14 A;  1JFF B;  1Q81 H;  5DCV A;  5KX5 A;  1U43 A;  1COM A;  1W41 A;  1U3L A;  4BVT A;  1FNK A;  1VQV A;  3UT5 A;  1KNJ A;  4BT5 A;  1RQ7 A;  4BVR A;  5JCO A;  3JAK B;  3GTZ A;  2LCA A;  4FFB A;  5JH7 A;  3CC7 F;  3HWU A;  4M8I A;  2UZH A;  1KQS F;  5LYJ B;  3RYF B;  4C4W C;  1CK2 A;  2AIZ P;  1Z5V A;  4KWE A;  1ONI A;  3JAT A;  1YJW F;  2MQE A;  2HVY D;  5CB4 B;  3ERN A;  1GX1 A;  4X1I B;  2AIF A;  2UYN A;  3P4E A;  3E22 B;  2ZOD A;  3IKF A;  5GON B;  5A2Q M;  2DT4 A;  1U40 A;  5C8Y A;  4O2A B;  3CCE F;  2UYJ A;  5HY1 A;  2OTJ F;  4C82 A;  1VQ8 F;  4TUY A;  2BTO A;  4O4H B;  3QUW A;  3SIV A;  3DDN A;  5EAZ A;  5J2T B;  1CLI A;  1W2B F;  3IKE A;  3N2K B;  1VQ4 F;  4BT6 A;  3LWO C;  3B6N A;  1TUB B;  5KMG B;  3FD5 A;  3WXM B;  4R40 B;  1YQN A;  5LA6 B;  1VQ6 F;  5IT9 M;  1Q82 H;  1JFF A;  3LME A;  3WGM A;  1SDS A;  2CVL A;  3N4Y A;  3HKB A;  1KC8 H;  1XRG A;  1ZWZ A;  3F0E A;  3CB2 A;  3MBM A;  4I4T A;  2F9Z C;  1H7M A;  5HP8 A;  5JVD A;  3IR9 A;  3WPW A;  1K9M H;  3T80 A;  2KTU A;  3JAK A;  5IYZ B;  4HNA B;  5AVM A;  3TD4 A;  3MCA B;  2W8B C;  2GVI A;  3JAR B;  3V3T A;  1W5F A;  1QD9 A;  2FGY A;  5HY2 A;  5LYJ A;  3CYQ A;  2UYK A;  3Q8H A;  2K1S A;  3QTY A;  5J2U B;  3CCS F;  4X1I A;  4C8G A;  2VAW A;  3JAL B;  3CPQ A;  3E22 A;  4EB6 A;  1GO1 A;  1VQ9 F;  2AMT A;  3S0Y A;  2HP0 A;  5LP6 C;  1W59 A;  5CA0 B;  1NJI H;  4I55 B;  2HP3 A;  4O2A A;  2QA4 F;  1IV1 A;  3JAT B;  1XV2 A;  4PWT A;  3CCU F;  3LYB A;  4G4V A;  4G4W A;  4G4X A;  5EWR A;  5J2T A;  5G4V C;  5C8Y B;  1VQP F;  1CN7 A;  3N2K A;  1Q8R A;  2PHN A;  2WAL A;  2CW4 A;  2ZAU A;  5JQG B;  3JCM M;  3RYC B;  3NVK E;  1TUB A;  2RHH A;  3OBW A;  5KMG A;  3KIZ A;  4TUY B;  3S02 A;  3R0P A;  1M1K H;  3CYP B;  3K0T A;  2KTV A;  2B33 A;  5LA6 A;  5LOV B;  3SIU A;  5FJ4 C;  3WPX A;  2IAF A;  3HKC A;  4RHA A;  2BO1 A;  4YJ3 A;  3G71 F;  4NUT A;  1X52 A;  4B62 A;  3FPI A;  3CD6 F;  5IJ9 A;  3WGL A;  4BY9 D;  2Z1U A;  3M84 A;  3CME F;  5IJ0 A;  2CSL A;  2RB9 A;  4O4L A;  1JJ2 F;  5IYZ A;  4B5C A;  4HNA A;  3CCM F;  1VQO F;  3HKB B;  1QAH A;  3JAR A;  3JAW B;  1KNK A;  4I4T B;  5JVD B;  2CZW A;  4NQ3 A;  3NVI B;  1VQN F;  1W55 A;  3GHZ A;  2LBW A;  2Z01 A;  2ZVY A;  2OHW A;  3LWR C;  3NK7 A;  5J2U A;  1GZ0 A;  1T0K B;  3E20 B;  4ZK7 A;  3JAL A;  1RQ2 A;  1VQ7 F;  4C8E A;  5EB1 B;  1PXW A;  5CA0 A;  1W5E A;  2G9I A;  4I55 A;  4TV8 B;  5EIB C; 
#chains in the Genus database with same CATH homology
 2KG4 A;  3CCQ F;  1X7P A;  3D00 A;  3CCR F;  3WXM B;  3V7Q A;  1E7K A;  4LCK A;  1VQ6 F;  3HJW C;  3PLA C;  1Q82 H;  5IT9 M;  1RA4 A;  1SDS A;  3N4Y A;  1KC8 H;  1YHQ F;  1XBI A;  1ZWZ A;  1QVG F;  3I55 F;  3CPW F;  2FC3 A;  3V7E A;  1K9M H;  2F9Z C;  1H7M A;  3E1Y A;  1VQ5 F;  3IR9 A;  3OBY A;  1Q7Y H;  2KTU A;  3CMA F;  4X3L A;  3LWQ C;  2OTL F;  3VI6 A;  1KD1 H;  5HXU A;  3G4S F;  3CG6 A;  1DT9 A;  1W40 A;  5HWE A;  3MCA B;  1W42 A;  3J80 M;  5GIP C;  3V3T A;  5HXZ A;  1YJ9 F;  2FGY A;  5HY2 A;  3CC2 F;  2I6D A;  1YIJ F;  3AGK A;  3CCS F;  4XCQ A;  5GAP K;  3LWP C;  3CPQ A;  1GO0 A;  3NK6 A;  5GIO C;  1GO1 A;  1VQ9 F;  2QI2 A;  4BVQ A;  1NJI H;  1RLG A;  2QA4 F;  2VGM A;  3CCL F;  1YIT F;  2OZB A;  3LFO A;  3JAM M;  1N8R H;  1K8A H;  5HY4 A;  3O85 A;  1VQL F;  3CCU F;  1YJN F;  1YI2 F;  5EWR A;  1IPA A;  5G4V C;  2ALE A;  1VQP F;  1Q81 H;  3RA6 A;  5DCV A;  1W41 A;  1VQM F;  1CN7 A;  2WAL A;  3N4Z A;  1NMU B;  2VGN A;  3JCM M;  4BVT A;  3HAX D;  2QEX F;  3CXC F;  3NVK E;  5G4U C;  3OBW A;  4BVR A;  5HY0 A;  1M90 H;  3J81 M;  1M1K H;  3NMU C;  3CCJ F;  2KTV A;  5FLX M;  5FJ4 C;  3SIU A;  2BO1 A;  3CC7 F;  3G71 F;  4NUT A;  1X52 A;  3CC4 F;  3CD6 F;  1KQS F;  4X3M A;  4BW0 B;  4BVS A;  3OW2 F;  4BY9 D;  4C4W C;  1CK2 A;  3CME F;  1Q86 H;  3PAF A;  2GLZ A;  5EO3 A;  3I56 F;  1YJW F;  2HVY D;  3G6E F;  1JJ2 F;  1W3E X;  1VQK F;  3CCV F;  2AIF A;  3CCM F;  1VQO F;  5A2Q M;  5GAN K;  4EI9 A;  3CCE F;  2CZW A;  3FFM A;  4NQ3 A;  5HY1 A;  1X7O A;  3ON1 A;  3J7A R;  3NVI B;  5GIN C;  1VQN F;  2JNB A;  2OTJ F;  2LBW A;  1VQ8 F;  2OHW A;  3RA5 A;  3LWR C;  3NK7 A;  4EI8 A;  1GZ0 A;  1T0K B;  3E20 B;  3SIV A;  1K73 H;  1VQ7 F;  3LWV C;  4EI7 A;  1S72 F;  1W2B F;  4TZZ A;  3GYQ A;  1PXW A;  2LBX A;  1VQ4 F;  3LWO C;  3VMF B;  1QVF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...