3CD6F

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cd6F00
1W3EX 3WXMB 3OBWA 3CPQA 4X3LA 3CCJF 2BO1A 3E1YA 1PXWA 3CCMF 1X52A 1H7MA 1JJ2F 5GIPC 4C4WC 1YHQF 2OTLF 2QEXF 3G71F 3PLAC 1VQ9F 1S72F 1RLGA 3CC7F 1QVGF 3HAXD 3RA5A 3JAMM 3NK7A 1VQ6F 1X7OA 3CCVF 2QA4F 1YIJF 3ON1A 3CCLF 3MCAB 1Q81H 1VQ5F 1Q86H 3RA6A 3NK6A 3CXCF 1RA4A 5A2QM 3LWVC 1XBIA 1X7PA 3CCEF 3FFMA 2OHWA 3J80M 2OZBA 2OTJF 5FLXM 3V7QA 3HJWC 2AIFA 5EWRA 1VQ7F 1YJ9F 2ALEA 3CC2F 3LFOA 1YI2F 1QVFF 4BW0B 2VGNA 1W40A 3CMAF 3SIUA 3LWRC 1KC8H 1YJNF 4NUTA 5DCVA 2VGMA 3CD6F 4X3MA 1VQMF 3NMUC 3J7AR 1KQSF 1K73H 1DT9A 3NVKE 1VQ8F 2HVYD 1VQKF 1NJIH 3I55F 3PAFA 5FJ4C 1GO1A 3O85A 3LWPC 2KG4A 1SDSA 1YJWF 1W42A 4LCKA 2I6DA 3IR9A 1K8AH 4TZZA 3LWQC 1VQOF 1CN7A 5G4VC 1N8RH 3SIVA 1VQLF 3VI6A 1Q7YH 2WALA 2FC3A 3CC4F 3OW2F 4BY9D 3CPWF 3I56F 3N4ZA 2KTUA 3CCRF 1VQ4F 3G6EF 1VQPF 1W2BF 3CCUF 3AGKA 1CK2A 3G4SF 3NVIB 3VMFB 1VQNF 1KD1H 3GYQA 3CG6A 2LBXA 3J81M 1K9MH 1ZWZA 5EO3A 1M90H 1IPAA 1NMUB 3OBYA 1W41A 1M1KH 3CCQF 5GAPK 5IT9M 3V7EA 3E20B 3CMEF 1T0KB 3CCSF 2KTVA 5GANK 5GINC 2LBWA 5G4UC 2CZWA 3LWOC 1Q82H 2JNBA 1YITF 1GZ0A 1GO0A 2QI2A 3N4YA 3JCMM 5GIOC 1E7KA
chains in the Genus database with same CATH superfamily
5KMGA 3JASA 5ITZB 3CPQA 5JQGB 2HX0A 1XRGA 5C8YA 1J7HA 3CCMF 1X52A 1JJ2F 2HP0B 4O2BB 4I4TB 3T80A 3VCZA 2OTLF 3FBAA 4LNUB 5BMVB 5IJ0A 3WPWA 5LYJA 4O4HA 3RYFB 1YQNA 3MBMA 3RA5A 3NK7A 2HRUA 2VAWA 3JATB 3WGJA 5J2TA 3ELCA 4YJ3B 1RQ2A 3CXCF 3CCEF 5FNVA 5CA1B 2OHWA 4RHAA 3V7QA 3K14A 3K2XA 4BT4A 2Z1FA 5MN5A 4X1YA 2W8BC 2VXYA 4FFBB 4I55A 2UYKA 3LFOA 3KE1A 4G4VA 3HKDB 4NWOB 3U0OA 2HS4A 1IV2A 3ZO8A 1KC8H 3OONA 1U43A 2IAFA 5MN4A 1COMA 1U3LA 3RYHA 1OAPA 2HVYD 3C9RA 3VYTC 5CA0B 1GO1A 1FNKA 2Q1XA 4ZI7A 4O4JA 3RYCB 3WPXA 3BYQA 3D01A 4E6EA 1VQOF 4BT7A 3WGNA 4O4IB 4BT3A 4YJ2A 3VI6A 4O4LA 2RB9A 3RYIA 1IV1A 5IJ9A 5HWEA 2Q1YA 1W2BF 1CK2A 1XHOA 3FD6A 4F6RB 2LBXA 2IG8A 3J81M 1K9MH 2V9YA 1IPAA 2BTQB 1T0AA 3FD5A 1M1KH 4M8IA 3CCQF 2KGWA 5GAPK 5IT9M 3V7EA 1TUBA 3E20B 2KTVA 5GANK 3K12A 1VH8A 2HS3A 5G4UC 3CYPB 5IYZB 1Q82H 4HNAB 4RQOA 4IHJA 1GZ0A 2ZOVA 3S02A 2PHNA 2VAPA 3RE3A 3OBWA 1DBFA 1W57A 4EI9A 4ZHQB 1H48A 4TV8B 2BO1A 3E1YA 2ZF8A 5HY0A 1W55A 5LA6A 3MQWA 1YHQF 2R751 1W5AA 1JFFB 2CHTA 5J2UA 3TD3A 2QEXF 4WBNA 2ZVZA 3ZP7A 3KHNA 5LP6B 2YYEA 5HP8A 1IV3A 3CC7F 3HAXD 1VQ6F 5MN6A 1X7OA 2QA4F 3ON1A 5LOVA 3MCAB 3F0GA 5HY1A 4U3JA 1VQ5F 2LCAA 2VAMA 3RA6A 2F9ZC 5KX5A 1RA4A 5A2QM 3LWVC 3VYUC 3IKFA 3S0YA 3C9UA 3J80M 1KNKA 2OTJF 2IQQA 3VYSC 5EZYB 5FLXM 2Z1TA 4X1KA 5LP6C 3D00A 3Q8HA 2BTOA 3VOAA 1RLUA 3V4DA 5JH7B 2UYPA 2AIFA 3JASB 5EWRA 3HWUA 1SA0B 1YJ9F 1VQ7F 1TVKA 3HKBA 4X1IB 5C8YB 3JALA 2HRYA 3ERNA 5CB4A 3CMAF 3SIUA 2RHLA 5IJ0B 1KNJA 5LXTA 3E22A 5LYJB 4O2BA 2UYJA 5JCOC 3J7AR 3JAWB 1K73H 3RYFA 1XV2A 1Q8RA 5J2TB 3F0FA 5FJ4C 4TUYA 3JATA 5FNVB 3C9SA 2ZAUA 2AIZP 3TD4A 3MCQA 5JVDB 4BT5A 1K8AH 3LWQC 3I3FA 4X1YB 1N8RH 3KIZA 3F6MA 5GONB 2WALA 2FC3A 4BY9D 3C8LA 4G4ZA 3EORA 2RHJA 4C8IA 4ZOLB 3CPWF 2CWJA 2GZLA 3HKCA 3MDOA 3I56F 3N4ZA 1VQ4F 3G6EF 1VQPF 3K0TA 2YXZA 3ZP4A 1KD1H 3DC2A 2H8EA 1W5EA 1SZQA 2P6YA 3IKEA 4G4XA 4ERHA 2RHHA 5EB1B 2L26A 2UYNB 5GINC 2LBWA 4ZI7B 4O4JB 1H47A 3D54A 4TV9B 5HY4A 2CW4A 3N2GB 3RYCA 1GO0A 2QI2A 4EB6A 3HKEA 1W3EX 3WXMB 4X3LA 1QU9A 3GHZA 4O4LB 5EAZA 5EIBD 1H7MA 1U40A 2CSLA 3L7QA 2OTMA 5IJ9B 4I50A 2RHOA 3PLAC 1RLGA 2QTPA 3JAMM 4O2AA 2ZVYA 4B5CA 1RQ7A 3CCLF 3P0ZA 5EYPA 1X25A 3CB2A 4F6RA 3NK6A 3FFMA 3WGLA 1ODEA 4KWEA 1TUBB 2OZBA 4X20A 4IIJB 2EWCA 2GVIA 3VO8A 1JN1A 3N2KB 4IHJB 1GX1A 3WJRA 3VTIC 1U3PA 2ALEA 4BVTA 1YI2F 5LA6B 1YGYA 2VGNA 4ZHQA 1NQ3A 4G4WA 3LWRC 2B33A 1YJNF 4NUTA 5DCVA 1QAHA 2G9IA 1VQMF 1FFXA 4BT6A 4DRXB 1W5FA 1W581 3S06A 1DT9A 4R40B 3NVKE 5LOVB 1QD9A 1JY8A 1Z5WA 3PAFA 3B6NA 3I55F 3JARA 2Z01A 3LWPC 3WGKA 5KMGB 4ZHVA 1YJWF 3JVHA 3JAKA 4BVSA 2I6DA 3IR9A 4XCQA 4NQ3A 4TZZA 4ZHYB 3UT5A 5EZYA 5ITZA 5G4VC 1Z5VA 4B62A 2R6R1 5AVMA 5JQGA 1Q7YH 3LYBA 3CC4F 3OW2F 1TVKB 2HP0A 3JALB 4I4TA 4O4HB 4U39A 2ZODA 4LNUA 2KTUA 1SA0A 5BMVA 5CB4B 2HP3A 4X1IA 3G4SF 3DDNA 3VMFB 4C82A 1VQNF 5LXTB 3E22B 3IEQA 4DXDA 4B45A 3C9TA 3F0EA 1ZWZA 4BT2A 1M90H 3P10A 1NMUB 3OBYA 4BVRA 3KJJA 3M84A 4YJ3A 1W41A 5HXZA 2H8CA 4C81A 3JAWA 5CA1A 1ONIA 4TUYB 3CCSF 3QHDA 3FPIA 2FGYA 3LMEA 4I55B 5B8FA 1FNJA 3LWOC 3WJPA 1YITF 2PMPA 4FFBA 2Z1UA 3N4YA 3P4EA 3CCVF 1E7KA 5JVDA 1IV4A 3CCJF 1PXWA 4G4YA 3HKDA 5GIPC 4C4WC 5GONA 2K1SA 3HKCB 3WGMA 4ZOLA 3G71F 1VQ9F 1S72F 3IMPA 3I7TA 4PWTA 3RYHB 4BVQA 1QVGF 1YIJF 1FSZA 1Q81H 1W5BA 1Q86H 4G88A 1XBIA 5CA0A 4EI7A 1X7PA 2CHSA 1W59A 1VK3A 2H6LA 3M1XA 4YJ2B 5HY2A 2DYYA 2UYNA 4O4IA 2DT4A 4EI8A 3HJWC 3V3TA 4EB6B 3HKEB 3RYIB 4TV9A 3CC2F 3N2GA 1QVFF 4BW0B 3WJQA 1W40A 2NMUA 4I50B 2VGMA 3CD6F 4X3MA 3ESJA 3NMUC 1UFYA 3VIUA 2HQSC 1KQSF 4O2AB 1VQ8F 5EYPB 3S03A 1VQKF 1OFUA 4B46A 1CLIA 3HTNA 2UZHA 1NJIH 1PF5A 3O85A 4X20B 2KG4A 2LBTA 1SDSA 5IYZA 4LCKA 1W42A 4HNAA 5HP7A 1CN7A 5HXUA 3SIVA 4IIJA 2I6RA 1VQLF 3M4SA 4TV8A 1VQVA 2CVLA 5J2UB 3N2KA 4WBNB 1JD1A 2MQEA 2Z1EA 1JFFA 4C8EA 3CCRF 5LP6A 3CCUF 3AGKA 2N48A 1VHAA 3NVIB 1R1MA 4U3JB 3VOBA 3GYQA 3CG6A 4ZK7A 3IEWA 3QUWA 3S0HA 5KX5B 5EO3A 1FFXB 3GTZA 4DRXA 3TD5A 3CYQA 4X1KB 1UI9A 3CMEF 1T0KB 5EIBC 5EB0A 2GLZA 3JARB 3QTYA 4C8GA 4ZHWA 2HS0A 3F0DA 2AMTA 5JCOA 3R0PA 3KJKA 3ZOPA 3LDTA 3JAKB 2JNBA 3S0WA 5JH7A 3HKBB 2CZWA 3JCMM 3UT5B 5GIOC 2BTUA
chains in the Genus database with same CATH topology
1W3EX 3WXMB 3OBWA 4EI9A 3CPQA 4X3LA 3CCJF 2BO1A 3E1YA 5HY0A 1PXWA 3CCMF 1X52A 1H7MA 1JJ2F 5GIPC 4C4WC 1YHQF 2OTLF 2QEXF 3G71F 3PLAC 1VQ9F 1S72F 1RLGA 4BVQA 3CC7F 1QVGF 3HAXD 3RA5A 3JAMM 3NK7A 1VQ6F 1X7OA 3CCVF 2QA4F 1YIJF 3ON1A 3CCLF 3MCAB 1Q81H 1VQ5F 5HY1A 1Q86H 3RA6A 2F9ZC 3NK6A 3CXCF 1RA4A 5A2QM 3LWVC 1XBIA 4EI7A 1X7PA 3CCEF 3FFMA 2OHWA 3J80M 2OZBA 2OTJF 5FLXM 3V7QA 3D00A 5HY2A 4EI8A 3HJWC 3V3TA 2AIFA 5EWRA 1VQ7F 1YJ9F 2ALEA 4BVTA 3CC2F 3LFOA 1YI2F 1QVFF 4BW0B 2VGNA 1W40A 3CMAF 3SIUA 3LWRC 1KC8H 1YJNF 4NUTA 5DCVA 2VGMA 3CD6F 4X3MA 1VQMF 3NMUC 3J7AR 1KQSF 1K73H 1DT9A 3NVKE 1VQ8F 2HVYD 1VQKF 1NJIH 3I55F 3PAFA 5FJ4C 1GO1A 3O85A 3LWPC 2KG4A 1SDSA 1YJWF 1W42A 4LCKA 4BVSA 2I6DA 3IR9A 4XCQA 4NQ3A 4TZZA 3LWQC 1K8AH 1VQOF 1CN7A 5HXUA 5G4VC 1N8RH 3SIVA 1VQLF 3VI6A 1Q7YH 2WALA 2FC3A 3CC4F 3OW2F 4BY9D 3CPWF 3I56F 3N4ZA 2KTUA 3CCRF 1VQ4F 5HWEA 3G6EF 1VQPF 1W2BF 3CCUF 3AGKA 1CK2A 3G4SF 3NVIB 3VMFB 1VQNF 1KD1H 3GYQA 3CG6A 2LBXA 3J81M 1K9MH 1ZWZA 5EO3A 1M90H 1IPAA 1NMUB 3OBYA 4BVRA 5HXZA 1W41A 1M1KH 3CCQF 5GAPK 5IT9M 3V7EA 3E20B 3CMEF 1T0KB 3CCSF 2GLZA 2KTVA 5GANK 5GINC 2FGYA 2LBWA 5G4UC 2CZWA 3LWOC 1Q82H 2JNBA 5HY4A 1YITF 1GZ0A 1GO0A 2QI2A 3N4YA 3JCMM 5GIOC 1E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3E X;  3WXM B;  3OBW A;  3CPQ A;  4X3L A;  3CCJ F;  2BO1 A;  3E1Y A;  1PXW A;  3CCM F;  1X52 A;  1H7M A;  1JJ2 F;  5GIP C;  4C4W C;  1YHQ F;  2OTL F;  2QEX F;  3G71 F;  3PLA C;  1VQ9 F;  1S72 F;  1RLG A;  3CC7 F;  1QVG F;  3HAX D;  3RA5 A;  3JAM M;  3NK7 A;  1VQ6 F;  1X7O A;  3CCV F;  2QA4 F;  1YIJ F;  3ON1 A;  3CCL F;  3MCA B;  1Q81 H;  1VQ5 F;  1Q86 H;  3RA6 A;  3NK6 A;  3CXC F;  1RA4 A;  5A2Q M;  3LWV C;  1XBI A;  1X7P A;  3CCE F;  3FFM A;  2OHW A;  3J80 M;  2OZB A;  2OTJ F;  5FLX M;  3V7Q A;  3HJW C;  2AIF A;  5EWR A;  1VQ7 F;  1YJ9 F;  2ALE A;  3CC2 F;  3LFO A;  1YI2 F;  1QVF F;  4BW0 B;  2VGN A;  1W40 A;  3CMA F;  3SIU A;  3LWR C;  1KC8 H;  1YJN F;  4NUT A;  5DCV A;  2VGM A;  3CD6 F;  4X3M A;  1VQM F;  3NMU C;  3J7A R;  1KQS F;  1K73 H;  1DT9 A;  3NVK E;  1VQ8 F;  2HVY D;  1VQK F;  1NJI H;  3I55 F;  3PAF A;  5FJ4 C;  1GO1 A;  3O85 A;  3LWP C;  2KG4 A;  1SDS A;  1YJW F;  1W42 A;  4LCK A;  2I6D A;  3IR9 A;  1K8A H;  4TZZ A;  3LWQ C;  1VQO F;  1CN7 A;  5G4V C;  1N8R H;  3SIV A;  1VQL F;  3VI6 A;  1Q7Y H;  2WAL A;  2FC3 A;  3CC4 F;  3OW2 F;  4BY9 D;  3CPW F;  3I56 F;  3N4Z A;  2KTU A;  3CCR F;  1VQ4 F;  3G6E F;  1VQP F;  1W2B F;  3CCU F;  3AGK A;  1CK2 A;  3G4S F;  3NVI B;  3VMF B;  1VQN F;  1KD1 H;  3GYQ A;  3CG6 A;  2LBX A;  3J81 M;  1K9M H;  1ZWZ A;  5EO3 A;  1M90 H;  1IPA A;  1NMU B;  3OBY A;  1W41 A;  1M1K H;  3CCQ F;  5GAP K;  5IT9 M;  3V7E A;  3E20 B;  3CME F;  1T0K B;  3CCS F;  2KTV A;  5GAN K;  5GIN C;  2LBW A;  5G4U C;  2CZW A;  3LWO C;  1Q82 H;  2JNB A;  1YIT F;  1GZ0 A;  1GO0 A;  2QI2 A;  3N4Y A;  3JCM M;  5GIO C;  1E7K A; 
#chains in the Genus database with same CATH topology
 5KMG A;  3JAS A;  5ITZ B;  3CPQ A;  5JQG B;  2HX0 A;  1XRG A;  5C8Y A;  1J7H A;  3CCM F;  1X52 A;  1JJ2 F;  2HP0 B;  4O2B B;  4I4T B;  3T80 A;  3VCZ A;  2OTL F;  3FBA A;  4LNU B;  5BMV B;  5IJ0 A;  3WPW A;  5LYJ A;  4O4H A;  3RYF B;  1YQN A;  3MBM A;  3RA5 A;  3NK7 A;  2HRU A;  2VAW A;  3JAT B;  3WGJ A;  5J2T A;  3ELC A;  4YJ3 B;  1RQ2 A;  3CXC F;  3CCE F;  5FNV A;  5CA1 B;  2OHW A;  4RHA A;  3V7Q A;  3K14 A;  3K2X A;  4BT4 A;  2Z1F A;  5MN5 A;  4X1Y A;  2W8B C;  2VXY A;  4FFB B;  4I55 A;  2UYK A;  3LFO A;  3KE1 A;  4G4V A;  3HKD B;  4NWO B;  3U0O A;  2HS4 A;  1IV2 A;  3ZO8 A;  1KC8 H;  3OON A;  1U43 A;  2IAF A;  5MN4 A;  1COM A;  1U3L A;  3RYH A;  1OAP A;  2HVY D;  3C9R A;  3VYT C;  5CA0 B;  1GO1 A;  1FNK A;  2Q1X A;  4ZI7 A;  4O4J A;  3RYC B;  3WPX A;  3BYQ A;  3D01 A;  4E6E A;  1VQO F;  4BT7 A;  3WGN A;  4O4I B;  4BT3 A;  4YJ2 A;  3VI6 A;  4O4L A;  2RB9 A;  3RYI A;  1IV1 A;  5IJ9 A;  5HWE A;  2Q1Y A;  1W2B F;  1CK2 A;  1XHO A;  3FD6 A;  4F6R B;  2LBX A;  2IG8 A;  3J81 M;  1K9M H;  2V9Y A;  1IPA A;  2BTQ B;  1T0A A;  3FD5 A;  1M1K H;  4M8I A;  3CCQ F;  2KGW A;  5GAP K;  5IT9 M;  3V7E A;  1TUB A;  3E20 B;  2KTV A;  5GAN K;  3K12 A;  1VH8 A;  2HS3 A;  5G4U C;  3CYP B;  5IYZ B;  1Q82 H;  4HNA B;  4RQO A;  4IHJ A;  1GZ0 A;  2ZOV A;  3S02 A;  2PHN A;  2VAP A;  3RE3 A;  3OBW A;  1DBF A;  1W57 A;  4EI9 A;  4ZHQ B;  1H48 A;  4TV8 B;  2BO1 A;  3E1Y A;  2ZF8 A;  5HY0 A;  1W55 A;  5LA6 A;  3MQW A;  1YHQ F;  2R75 1;  1W5A A;  1JFF B;  2CHT A;  5J2U A;  3TD3 A;  2QEX F;  4WBN A;  2ZVZ A;  3ZP7 A;  3KHN A;  5LP6 B;  2YYE A;  5HP8 A;  1IV3 A;  3CC7 F;  3HAX D;  1VQ6 F;  5MN6 A;  1X7O A;  2QA4 F;  3ON1 A;  5LOV A;  3MCA B;  3F0G A;  5HY1 A;  4U3J A;  1VQ5 F;  2LCA A;  2VAM A;  3RA6 A;  2F9Z C;  5KX5 A;  1RA4 A;  5A2Q M;  3LWV C;  3VYU C;  3IKF A;  3S0Y A;  3C9U A;  3J80 M;  1KNK A;  2OTJ F;  2IQQ A;  3VYS C;  5EZY B;  5FLX M;  2Z1T A;  4X1K A;  5LP6 C;  3D00 A;  3Q8H A;  2BTO A;  3VOA A;  1RLU A;  3V4D A;  5JH7 B;  2UYP A;  2AIF A;  3JAS B;  5EWR A;  3HWU A;  1SA0 B;  1YJ9 F;  1VQ7 F;  1TVK A;  3HKB A;  4X1I B;  5C8Y B;  3JAL A;  2HRY A;  3ERN A;  5CB4 A;  3CMA F;  3SIU A;  2RHL A;  5IJ0 B;  1KNJ A;  5LXT A;  3E22 A;  5LYJ B;  4O2B A;  2UYJ A;  5JCO C;  3J7A R;  3JAW B;  1K73 H;  3RYF A;  1XV2 A;  1Q8R A;  5J2T B;  3F0F A;  5FJ4 C;  4TUY A;  3JAT A;  5FNV B;  3C9S A;  2ZAU A;  2AIZ P;  3TD4 A;  3MCQ A;  5JVD B;  4BT5 A;  1K8A H;  3LWQ C;  3I3F A;  4X1Y B;  1N8R H;  3KIZ A;  3F6M A;  5GON B;  2WAL A;  2FC3 A;  4BY9 D;  3C8L A;  4G4Z A;  3EOR A;  2RHJ A;  4C8I A;  4ZOL B;  3CPW F;  2CWJ A;  2GZL A;  3HKC A;  3MDO A;  3I56 F;  3N4Z A;  1VQ4 F;  3G6E F;  1VQP F;  3K0T A;  2YXZ A;  3ZP4 A;  1KD1 H;  3DC2 A;  2H8E A;  1W5E A;  1SZQ A;  2P6Y A;  3IKE A;  4G4X A;  4ERH A;  2RHH A;  5EB1 B;  2L26 A;  2UYN B;  5GIN C;  2LBW A;  4ZI7 B;  4O4J B;  1H47 A;  3D54 A;  4TV9 B;  5HY4 A;  2CW4 A;  3N2G B;  3RYC A;  1GO0 A;  2QI2 A;  4EB6 A;  3HKE A;  1W3E X;  3WXM B;  4X3L A;  1QU9 A;  3GHZ A;  4O4L B;  5EAZ A;  5EIB D;  1H7M A;  1U40 A;  2CSL A;  3L7Q A;  2OTM A;  5IJ9 B;  4I50 A;  2RHO A;  3PLA C;  1RLG A;  2QTP A;  3JAM M;  4O2A A;  2ZVY A;  4B5C A;  1RQ7 A;  3CCL F;  3P0Z A;  5EYP A;  1X25 A;  3CB2 A;  4F6R A;  3NK6 A;  3FFM A;  3WGL A;  1ODE A;  4KWE A;  1TUB B;  2OZB A;  4X20 A;  4IIJ B;  2EWC A;  2GVI A;  3VO8 A;  1JN1 A;  3N2K B;  4IHJ B;  1GX1 A;  3WJR A;  3VTI C;  1U3P A;  2ALE A;  4BVT A;  1YI2 F;  5LA6 B;  1YGY A;  2VGN A;  4ZHQ A;  1NQ3 A;  4G4W A;  3LWR C;  2B33 A;  1YJN F;  4NUT A;  5DCV A;  1QAH A;  2G9I A;  1VQM F;  1FFX A;  4BT6 A;  4DRX B;  1W5F A;  1W58 1;  3S06 A;  1DT9 A;  4R40 B;  3NVK E;  5LOV B;  1QD9 A;  1JY8 A;  1Z5W A;  3PAF A;  3B6N A;  3I55 F;  3JAR A;  2Z01 A;  3LWP C;  3WGK A;  5KMG B;  4ZHV A;  1YJW F;  3JVH A;  3JAK A;  4BVS A;  2I6D A;  3IR9 A;  4XCQ A;  4NQ3 A;  4TZZ A;  4ZHY B;  3UT5 A;  5EZY A;  5ITZ A;  5G4V C;  1Z5V A;  4B62 A;  2R6R 1;  5AVM A;  5JQG A;  1Q7Y H;  3LYB A;  3CC4 F;  3OW2 F;  1TVK B;  2HP0 A;  3JAL B;  4I4T A;  4O4H B;  4U39 A;  2ZOD A;  4LNU A;  2KTU A;  1SA0 A;  5BMV A;  5CB4 B;  2HP3 A;  4X1I A;  3G4S F;  3DDN A;  3VMF B;  4C82 A;  1VQN F;  5LXT B;  3E22 B;  3IEQ A;  4DXD A;  4B45 A;  3C9T A;  3F0E A;  1ZWZ A;  4BT2 A;  1M90 H;  3P10 A;  1NMU B;  3OBY A;  4BVR A;  3KJJ A;  3M84 A;  4YJ3 A;  1W41 A;  5HXZ A;  2H8C A;  4C81 A;  3JAW A;  5CA1 A;  1ONI A;  4TUY B;  3CCS F;  3QHD A;  3FPI A;  2FGY A;  3LME A;  4I55 B;  5B8F A;  1FNJ A;  3LWO C;  3WJP A;  1YIT F;  2PMP A;  4FFB A;  2Z1U A;  3N4Y A;  3P4E A;  3CCV F;  1E7K A;  5JVD A;  1IV4 A;  3CCJ F;  1PXW A;  4G4Y A;  3HKD A;  5GIP C;  4C4W C;  5GON A;  2K1S A;  3HKC B;  3WGM A;  4ZOL A;  3G71 F;  1VQ9 F;  1S72 F;  3IMP A;  3I7T A;  4PWT A;  3RYH B;  4BVQ A;  1QVG F;  1YIJ F;  1FSZ A;  1Q81 H;  1W5B A;  1Q86 H;  4G88 A;  1XBI A;  5CA0 A;  4EI7 A;  1X7P A;  2CHS A;  1W59 A;  1VK3 A;  2H6L A;  3M1X A;  4YJ2 B;  5HY2 A;  2DYY A;  2UYN A;  4O4I A;  2DT4 A;  4EI8 A;  3HJW C;  3V3T A;  4EB6 B;  3HKE B;  3RYI B;  4TV9 A;  3CC2 F;  3N2G A;  1QVF F;  4BW0 B;  3WJQ A;  1W40 A;  2NMU A;  4I50 B;  2VGM A;  3CD6 F;  4X3M A;  3ESJ A;  3NMU C;  1UFY A;  3VIU A;  2HQS C;  1KQS F;  4O2A B;  1VQ8 F;  5EYP B;  3S03 A;  1VQK F;  1OFU A;  4B46 A;  1CLI A;  3HTN A;  2UZH A;  1NJI H;  1PF5 A;  3O85 A;  4X20 B;  2KG4 A;  2LBT A;  1SDS A;  5IYZ A;  4LCK A;  1W42 A;  4HNA A;  5HP7 A;  1CN7 A;  5HXU A;  3SIV A;  4IIJ A;  2I6R A;  1VQL F;  3M4S A;  4TV8 A;  1VQV A;  2CVL A;  5J2U B;  3N2K A;  4WBN B;  1JD1 A;  2MQE A;  2Z1E A;  1JFF A;  4C8E A;  3CCR F;  5LP6 A;  3CCU F;  3AGK A;  2N48 A;  1VHA A;  3NVI B;  1R1M A;  4U3J B;  3VOB A;  3GYQ A;  3CG6 A;  4ZK7 A;  3IEW A;  3QUW A;  3S0H A;  5KX5 B;  5EO3 A;  1FFX B;  3GTZ A;  4DRX A;  3TD5 A;  3CYQ A;  4X1K B;  1UI9 A;  3CME F;  1T0K B;  5EIB C;  5EB0 A;  2GLZ A;  3JAR B;  3QTY A;  4C8G A;  4ZHW A;  2HS0 A;  3F0D A;  2AMT A;  5JCO A;  3R0P A;  3KJK A;  3ZOP A;  3LDT A;  3JAK B;  2JNB A;  3S0W A;  5JH7 A;  3HKB B;  2CZW A;  3JCM M;  3UT5 B;  5GIO C;  2BTU A; 
#chains in the Genus database with same CATH homology
 1W3E X;  3WXM B;  3OBW A;  4EI9 A;  3CPQ A;  4X3L A;  3CCJ F;  2BO1 A;  3E1Y A;  5HY0 A;  1PXW A;  3CCM F;  1X52 A;  1H7M A;  1JJ2 F;  5GIP C;  4C4W C;  1YHQ F;  2OTL F;  2QEX F;  3G71 F;  3PLA C;  1VQ9 F;  1S72 F;  1RLG A;  4BVQ A;  3CC7 F;  1QVG F;  3HAX D;  3RA5 A;  3JAM M;  3NK7 A;  1VQ6 F;  1X7O A;  3CCV F;  2QA4 F;  1YIJ F;  3ON1 A;  3CCL F;  3MCA B;  1Q81 H;  1VQ5 F;  5HY1 A;  1Q86 H;  3RA6 A;  2F9Z C;  3NK6 A;  3CXC F;  1RA4 A;  5A2Q M;  3LWV C;  1XBI A;  4EI7 A;  1X7P A;  3CCE F;  3FFM A;  2OHW A;  3J80 M;  2OZB A;  2OTJ F;  5FLX M;  3V7Q A;  3D00 A;  5HY2 A;  4EI8 A;  3HJW C;  3V3T A;  2AIF A;  5EWR A;  1VQ7 F;  1YJ9 F;  2ALE A;  4BVT A;  3CC2 F;  3LFO A;  1YI2 F;  1QVF F;  4BW0 B;  2VGN A;  1W40 A;  3CMA F;  3SIU A;  3LWR C;  1KC8 H;  1YJN F;  4NUT A;  5DCV A;  2VGM A;  3CD6 F;  4X3M A;  1VQM F;  3NMU C;  3J7A R;  1KQS F;  1K73 H;  1DT9 A;  3NVK E;  1VQ8 F;  2HVY D;  1VQK F;  1NJI H;  3I55 F;  3PAF A;  5FJ4 C;  1GO1 A;  3O85 A;  3LWP C;  2KG4 A;  1SDS A;  1YJW F;  1W42 A;  4LCK A;  4BVS A;  2I6D A;  3IR9 A;  4XCQ A;  4NQ3 A;  4TZZ A;  3LWQ C;  1K8A H;  1VQO F;  1CN7 A;  5HXU A;  5G4V C;  1N8R H;  3SIV A;  1VQL F;  3VI6 A;  1Q7Y H;  2WAL A;  2FC3 A;  3CC4 F;  3OW2 F;  4BY9 D;  3CPW F;  3I56 F;  3N4Z A;  2KTU A;  3CCR F;  1VQ4 F;  5HWE A;  3G6E F;  1VQP F;  1W2B F;  3CCU F;  3AGK A;  1CK2 A;  3G4S F;  3NVI B;  3VMF B;  1VQN F;  1KD1 H;  3GYQ A;  3CG6 A;  2LBX A;  3J81 M;  1K9M H;  1ZWZ A;  5EO3 A;  1M90 H;  1IPA A;  1NMU B;  3OBY A;  4BVR A;  5HXZ A;  1W41 A;  1M1K H;  3CCQ F;  5GAP K;  5IT9 M;  3V7E A;  3E20 B;  3CME F;  1T0K B;  3CCS F;  2GLZ A;  2KTV A;  5GAN K;  5GIN C;  2FGY A;  2LBW A;  5G4U C;  2CZW A;  3LWO C;  1Q82 H;  2JNB A;  5HY4 A;  1YIT F;  1GZ0 A;  1GO0 A;  2QI2 A;  3N4Y A;  3JCM M;  5GIO C;  1E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...