5LXTB

Tubulin-discodermolide complex
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
428
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Stabilization by Discodermolide.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 174
structure length 426
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lxtB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lxtB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lxtB01
3RYIA 2VXYA 3HKBB 5CA1A 1W59A 3JARB 4X1KB 1FFXA 4IIJA 4ZHQB 4ZI7A 4IHJB 4DRXB 4WBNB 5CB4B 1RQ2A 5ITZB 1Z5WA 4X1YB 3HKEA 3RYFA 5CA1B 5LYJA 4YJ2B 1W5FA 5IJ0A 4ZI7B 1W5AA 4XCQA 3WGJA 4EB6A 4O4IA 1SA0A 5FNVB 1FSZA 3E22B 4TV8B 4O4LB 5J2UB 4O4JA 3C8LA 3JASB 4I55A 4O2AA 5EZYB 5LP6C 3R4VA 5KX5A 4TUYB 5BMVA 4B46A 5LP6A 4FFBA 4EB6B 5LXTB 3RYCB 4LNUA 5IJ9A 3RYHB 5M7EA 4M8IA 4O4JB 3VO9A 3N2GA 5C8YB 3WGKA 1JFFA 4HNAB 3JAKA 3HKDA 2VAMA 5GONA 3WGLA 3JALA 4FFBB 4E6EA 2R751 3CB2A 3UT5A 4X1IA 1TUBA 3ZBPA 1TVKA 5CA0A 4YJ3B 4O2BB 1JFFB 4TV9A 3RYIB 3HKDB 3N2KA 5GONB 3JAWA 1FFXB 4IIJB 1W581 4I4TA 5MN6A 1Z5VA 5JVDA 5LA6A 2VAPA 3HKCA 3WGNA 3HKEB 3RYFB 5LOVA 3JAWB 5LYJB 3JATA 4I50A 5IJ0B 3ZBQA 4F6RA 3M8KA 4ZOLA 4EI9A 4O4IB 3ZIDA 1SA0B 1RQ7A 4X20A 4I55B 4O2AB 2R6R1 5KX5B 4F6RB 5BMVB 4U3JA 5LP6B 5KMGA 5J2TA 5MN4A 4LNUB 5IJ9B 2BTQA 2XKAA 5IYZA 4X20B 4U39A 3N2GB 4O4HA 4KWEA 3RB8A 1OFUA 4B45A 4DXDA 3JAKB 3JALB 1W5BA 5EYPA 4EI8A 3UT5B 4X1IB 2RHLA 1TUBB 5IYZB 1TVKB 5CA0B 2Q1XA 2BTOA 3M89A 1W5EA 2GVIA 4TV9B 3HKBA 5JCOA 3JARA 4X1KA 3VOAA 4ZHQA 3N2KB 4IHJA 4DRXA 2XKBA 5CB4A 4I4TB 5ITZA 5JVDB 4X1YA 5LA6B 5JQGA 2Q1YA 3HKCB 4YJ2A 5LOVB 3JATB 4I50B 3VPAA 4ZOLB 4EI7A 5FNVA 3E22A 4O4LA 4TV8A 5J2UA 3JASA 2RHOA 5JQGB 5EZYA 2RHJA 4TUYA 3VOBA 5EIBD 3RYCA 5LXTA 4U3JB 1RLUA 3RYHA 5KMGB 5J2TB 5MN5A 5JH7A 3WGMA 2BTQB 5C8YA 5JCOC 3V3TA 3VO8A 4HNAA 4O4HB 5EIBC 4WBNA 2VAWA 5EYPB 5JH7B 4YJ3A 4O2BA 2RHHA
chains in the Genus database with same CATH superfamily
3VFDA 3ANSA 4ICGA 4I0WB 2ONJA 1BYIA 1XQ8A 3CWCA 4ENTA 3B1FA 3GLHE 2II6A 4KQKA 2EKPA 3ZN0A 3EAFA 5L4NA 4O8CA 1Q90D 1RP1A 2W2KA 1PL7A 1PHRA 3U3RA 1ND5A 1Y4SA 2C2GA 5AIBA 1IWBB 3HJCA 2OV1A 3UO2A 1T5HX 1Z0SA 2E48A 3NASA 2XCUA 2JGMA 2RGUA 1GTL1 4D0RA 4BPBA 1OGYA 5KVVA 2UZ1B 2H18A 1J0CA 4X61A 3V34A 4TRJA 2V9YA 5C7LO 3T4UA 1HKHA 5BQPA 4BWVA 3ZGVA 3OE5A 3FDZA 4TV9F 5FPYA 5E3HA 3G2LA 1V8ZA 4I1RA 4M21A 1XYVA 1KDVA 1DIRA 2HU5A 2I4MA 1KVUA 5JAPA 4CLDA 5T64A 1CEYA 3VU9B 1F5NA 2JI4A 4MVJP 4YV7A 4I2NA 1M67A 2FYTA 2XWQA 4AUNA 4PTYA 1MSWD 1JBQA 1OIVA 4N18A 5C7IO 2H1IA 2V0CA 3MILA 3TL3A 4O4LF 4DUZB 3UK7A 4ALNA 1ZNXA 1XU7A 3RRFA 3GB9A 2ZSKA 2JANA 4OATA 4K6GA 2BMFA 2CDNA 4WNAB 2OKCA 2JEYA 4ENUA 5LQRA 1WQ4A 3KQUA 4KVGA 1E32A 5DTQA 1LV7A 4J0KA 2HJVA 1XZIA 3DTNA 3J80A 4I8DA 2UZHA 1EYZA 1A69A 1DC3A 2QEXF 2E7ZA 5I4IA 2A9KA 1GGMA 2AEEA 4WXRA 1EUCB 2A8YA 4DK0A 3PC8A 1WUKS 3ZMUA 4DT1A 1AQIA 2TECE 3PPXA 3PXAA 1FFTB 2VLBA 1TUIA 1I2MA 4A0SA 3FVQA 2I55A 4CM1A 2ZINA 3HUDA 4PZLA 1E61A 3BGWA 4C3VA 4LNUA 2CGEA 3AF2A 3ED1A 4H1VA 2GFHA 1ZK2A 3PUKA 1MZEA 3NETA 3GFOA 1QYXA 3GGGA 3ZI0A 4X45A 3WNVA 2WFZA 2HO5A 2CHEA 4CKBB 2OGWA 3HLTA 2BP7A 4F04A 2JW5A 5KYVA 4MVQA 4F92B 1RKVA 4IFBA 2RHLA 3AR5A 4DV1O 4IGKA 5AKXA 1RKBA 2QU8A 1Q82W 3L6DA 3U4QB 4DV3O 3LPLA 3DG9A 1NNI1 4IXTA 4RL4A 2EWCA 3JVUA 3E03A 3FHCB 4QJFB 1JVNA 1VSQA 1RAEA 1T5TA 3QEMB 3ZEAA 1NI4A 4WT7A 5C9ZA 4IV0A 2J85A 1L8AA 2H1CA 4DLVA 3DOJA 1D5NA 2JBAB 2L42A 1UJ2A 2ATVA 4P4NA 4GPEA 4L9AA 4A0RA 4EABA 1SEVA 3WKBA 2VWKA 2N42A 3F3MA 4TPKA 4RD0A 3CY6A 5REQB 1ZY2A 4X89A 3DH0A 1UFIA 5KNCH 2GKSA 2I22A 3CPSA 1Y1SA 3C5CA 1UK6A 2X41A 1SO8A 2ZBFA 2LW1A 1G8PA 3RRJA 1KJWA 2BUAA 5KNBA 2XZLA 3EC2A 5D6OA 1GK9A 2BTOA 5HYVA 3IDAA 2Z1NA 4CGYA 4QIHA 4V38A 2JFOA 2Z1DA 2Z6UA 2BE3A 1FUKA 1MC1A 3C3TA 4OLFA 2P35A 4CG3A 1WMDA 2EFDB 2QY9A 3D4LA 1ITZA 3FCYA 4HN4B 1N8RW 3WYDA 1T3HA 3GU3A 4GYKA 3VSAA 5DN6G 2R3SA 4EJ6A 2WAOA 2FK8A 2JAXA 5EE3A 4L27A 3AJAA 5DEOA 3MTJA 2D5BA 3F5QA 5IXSA 2D1SA 1U3LA 4JLUA 1Z6YA 4D8XA 5IJAA 2QN1A 5DB4A 2PANA 5HTKA 3VAYA 2EZ4A 4PYLA 4WFFA 3PQ4A 1JG7A 3RC9A 2O5EA 5I7VA 1X7ZB 1ND6A 4JMLA 3U4CA 4BZWA 3DTTA 1XRNA 3K9CA 5C18A 3DKVA 3RSOA 3HV2A 1R3UA 2NV6A 3C3EA 3VR5A 1QOPB 3UT5B 2ACWA 3AL0C 3QSGA 4NIMA 2EF0A 2O7SA 1QTRA 3CCVV 4PZZA 4Q9KA 2OCIA 5I51A 5GM2A 2XVZA 2X0LA 1MB4A 1FP1D 1XEFA 3QVGA 1YS6A 4TYNA 3IPYA 2GN1A 3BICA 1DI0A 1QQ6A 3EZ7A 1OU4A 3QM1A 1ENZA 3ETQA 3MRTA 4R2KA 4OU4A 3COZA 3R9XA 5DNDA 2J87A 2I7TA 4HWSA 1Y5LA 4M83A 1R4ZA 3KJXA 1JFVA 1V48A 1I14A 3F7MA 5I7RA 5FP0A 1H8HA 2MYTA 2CB9A 1IN4A 1YEWA 5KWVA 3K09A 2ZREA 1WMEA 1C1DB 4Q0MA 1A3CA 3VJMA 5EIEA 3C85A 4CIXA 4KGZA 4R54A 5IJ9B 3I34X 1QHYA 3EA5A 3QKTA 3QE4A 4UCFA 2IJJA 3PHHA 1NV9A 1SKMA 1G5PA 5DNVA 2R8YA 3I55F 2CVOA 4YY3B 1E8DA 4XRRA 1Y7HA 3FKSA 5B6IA 3FYEB 1MOPA 3QUBA 2PEYA 1MTOA 2X5JO 1OXXK 3VYWA 4ER3A 4U2BA 3BH7A 3DXRB 4E1BA 3ABMC 1U1DA 3O8QA 2DQSA 4C08A 5KDDA 1UZLA 1WZ2A 1GL3A 1BRMA 5KOIA 1JJOA 3WK9A 3GWZA 1Q0HA 2PS9A 2J4DA 4JC4A 3GUCA 1ECJA 3TD9A 1GLVA 1EA5A 3E3MA 1OX5A 2QZJA 5FIUA 1I4DD 1SG9A 3BC1A 2P6RA 3OUSA 4AS2A 5AKLA 2OHIA 3ML0A 4CLEA 1SHJA 2AN3A 3Q0TA 3PAFA 3DEHA 3P9YA 5H82A 3COYA 1F3OA 2VK2A 5CCEA 3ZMVA 2Y1KA 1JUDA 2AE1A 2OKGA 7MDHA 4NABA 4E32A 3EIEA 1L1EA 2VZ0A 4FMCF 3O1JC 4US1R 3KXDA 1HE1C 5E6RA 2CBXA 1RMTA 3EBLA 1NY6A 4X8LA 4WXMA 2QI9F 3IMCA 5EP1A 3WQHA 3U7IA 2CGNA 4FQ8A 4AMVA 1T0UA 3CXUA 1E3SA 1YC5A 3BD6A 1HGXA 1A8HA 5GJCA 1BN7A 2XI4A 1PE0A 5K0EA 4C0KA 4AQYO 1KYZA 4I1VA 2E5FA 2C7GA 3NWOA 3K79A 1QTIA 2P9BA 1KDZA 4UU8A 4A5OA 1BQ0A 4EMSA 4BLOA 3R5KA 4TYQA 5JJCA 3CN9A 2HCJB 4L4SA 1U4NA 3SLGA 4B8WA 1T9AA 3TQOA 1H66A 1MXHA 1U8AA 2XY4A 1XZEA 3TRDA 1E7RA 3KHSA 1H8ED 5HGJA 2XDQA 4F4LA 1GNQA 1XTQA 4OMFG 2P9FA 4DW0A 1CXZA 1EE2A 1VYVA 1M34E 4JP1A 1CNMA 2D00A 3U39A 4FCWA 2IA5A 1UMBB 3JWEA 3DFZA 4ETMA 5JPIA 1U99A 3VHRA 4BWFB 3F1KA 5CCDA 3F4BA 1XGKA 5D85A 1VLVA 3EPHA 3R6WA 4ZYVA 2J9GA 3TZ6A 2DWPA 4HDNA 4MQBA 2R7NA 2JLVA 3MMSA 2E5LO 5HPYB 1T5OA 5AVOA 3LBNA 5IT9A 1B2RA 2YS6A 4A5SA 1UANA 4CIYA 1PNLA 3GWOA 1XRJA 1U94A 1QZZA 3F67A 4DPLA 4DMUB 3TRJA 3COVA 2VTKA 3ZI7A 1OFIA 3VC1A 1FXKA 2R85A 4UPEA 3AK3A 1KDOA 3F5SA 3V33A 1PZFA 4JI5B 4ZZ1A 3OIUA 1N7IA 1RBQA 3G5UA 3ZHTA 3RS0A 3MAJA 3TPZA 3M70A 4DBLC 4PD4F 3VQVA 5HCIA 2YHUA 3S8YA 2QTHA 4QQRA 4GMGA 4JA0A 1U2EA 3HY4A 4D4HA 3C6XA 1I1OA 3I64A 3NUGA 1FXUA 4PZ9A 3F7OA 3I5YA 1H1TA 2EFEB 5F52A 5GGXA 5ERGB 5AW4A 3GPIA 4WFGA 3ZDYB 2ZAGA 2HJFC 3O75A 4JLKA 1VBKA 3WAJA 4WFJA 2DYRB 4GICA 4R40A 2H4ZA 3MTDA 2HPZA 3U40A 1DTWB 1PYDA 2W6PA 4DM3A 1JQJC 5EYPA 1NVPD 3ZDEA 4QU9A 3EVNA 1A82A 3IUSA 1T9ZA 3K8QA 1RR6A 3ICXA 4ROSA 1M5UA 5GZ3A 3JRNA 3VYRB 1M2VB 1RYEA 3VOUA 5IFLA 1X7XB 2V9PA 2C9YA 3T1YO 3DHNA 4I66A 2AFRA 4C0LA 4PIMA 4QPDA 1Z0FA 3STWA 4B40A 1PXWA 5K6RA 3OEED 3IBCA 3S7ZA 2ODEA 3QPVA 1XVIA 4OHZA 2V1XA 1KO5A 1DRVA 2O2SA 2NZYA 1E2PA 4EGSA 5ENDA 4RF2A 3EVGA 2IITA 1W2HA 5K4AA 2NUTB 1NMXA 3T5DA 3V5NA 3H1FA 3PUXA 4BNDB 4HWRA 3AR9A 3BT7A 5ISMA 3C6MA 4YMUA 4OAOA 3H7AA 1YHYA 4DCPA 1SQXH 3PGKA 4G1VA 1XG5A 1TT5B 4ZU1X 1W4RA 2JLSA 2ZIGA 4KO4S 1YF3A 2QA4F 3SYCA 2WSMA 4MUJA 4OI4A 4RDXA 2OAP1 2OQ2A 3HCRA 4L4YA 1JB1A 2CL7X 5K3BA 3FUXA 5DBGA 3P9RA 2FMLA 2WWIA 2IXAA 2BGWA 4PGHA 3HYCA 4H0CA 1WNFA 3GXOA 1U8EA 3D6AA 3CC2F 2ZRJA 3F7YC 1OZFA 1YBAA 4B6QA 3CD6V 3DAFA 3ASYA 3OF5A 4C8GA 1YJ9F 5DM60 4BVQA 1LRJA 1D6MA 5CAEB 5HS6A 2EC5A 3OC0A 4MI1A 5IJ0A 2NM0A 4XDKA 4DIUA 2OC9A 3Q7SA 1Q7BA 3B3GA 5TQJA 1QUEA 3L7KA 4HLNA 2G9VA 4DDVA 5GTDA 1TTHA 1CP9A 4G4GA 1RRPA 3HB9A 1BH6A 2JZNA 4BO8A 4URVR 3QRWA 4TTAA 1XSEA 1GQFA 3IP9A 3V1UA 3HG7A 3T38A 4N65A 3LCCA 1CF9A 3H5NA 1M3SA 4GS5A 3ESZA 1FX0A 2OTLV 4YFVA 3EXEB 3K6SA 1JCHA 3TMKA 1D07A 1L9KA 3HZZA 5KU7A 4AP5A 4E33A 4C04A 3OLZA 3QVWA 3EGIA 1TYAE 3O92A 4BLPA 1Y4ZA 2OOSA 4P7JA 2BGGA 4JB2A 1NT2A 3I39X 1NVBA 3HZHA 2ZM6B 5EIBD 1OLSB 4MJXA 5FTWA 2WJJA 4RHEA 2ET6A 2DWQA 5E6UA 4I08A 1SXHA 4RSMA 3FWYA 2XSZA 5EUQB 1OXMA 5HE8A 1RKUA 3V55A 2OTJF 4XSVA 1Y1KE 4TV8F 4M0UA 2Q1UA 2GCNA 2ZP1A 5E1AC 2IX9A 4I9NA 3TQQA 3MHPA 4PDLA 3CC2V 4YJGA 3CCFA 1KRWA 3GELA 1UKZA 1VQ1A 3N75A 2WM8A 1W581 4RTMA 2JVIA 1M54A 2F1RA 2Q9AA 3H6KA 4ZRDA 3MAGA 1DF4A 2ONKA 5LGTA 2IY8A 5IVPA 2ZYIA 2ZB7A 5DYIA 3STXA 2QI9C 1C0KA 5KMGA 2HNBA 3GFTA 3W8FA 2CNLA 5DHAA 1ZM3A 2AXNA 4YRFA 4C0JA 1VQ4V 4L1KA 2R11A 3ZCXA 4IX9A 2DLDA 2QRKA 2YXYA 4HYEA 3LC2O 2Q99A 1XXLA 1WCIB 5KUKA 4NFSA 4PR0A 2IBZH 1U0TA 3I9LA 2DBZA 1OVGA 3BA9A 3HI4A 4J0JA 1CBUA 2DQ4A 4RLSA 3EOAI 1E1DA 3LGSA 3OMNB 4MR7A 5C2JB 3P45A 4O25A 2HNKA 4WIAA 1RSOA 2EWWA 3AGPA 1Y4AE 1W85A 2AHRA 4Z54A 4IGEA 3LC7O 1PR5A 3RC8A 4P81A 2A78A 2Q41A 3OEHA 2FPWA 4EKEA 1DC5A 5F12A 2ILVA 4YH1A 5H9VA 4PBSA 5FUMA 4WOKA 5KBYA 3MWEB 4OJTA 2ZTMA 5HFLA 3CEPB 2GUWA 4PIVA 5ECDA 4O3FA 1OFUA 2OA0A 4RJLA 2XUFA 3CU5A 4KE9A 2JGDA 3DEFA 3EXHC 2ATCA 2WWHA 1AF4A 5LC1A 3UWDA 2QN2A 4XD7D 1ROPA 3V4FA 4NG4A 1YK1A 4DV5O 1TIKA 4JI3B 2AXEA 1XZFA 1NKDA 4DUPA 5CFZA 3GLTA 1CZRA 5L3RA 2O2XA 3AF0A 5FFFA 1WVMA 3GLFE 4QLOA 5I8WA 4YBRA 1OYWA 4BJ5A 1WPBA 2JLAA 1CZHA 3B2NA 1FSZA 4HVLA 3EHDA 1YFKA 4IKOA 3WIUA 1LLDA 4N0QA 2QRPA 1NU6A 1XRSB 4MDYA 2VZ9A 3SS7X 5LM3A 3LM8A 5C0OE 2KG4A 4G5GA 4K81B 5JZVA 4RESA 1DPGA 3G2KA 3MN1A 2M6RA 3NYQA 5MN6A 2EKDA 3MWYW 1P4SA 1YJBA 4WY5A 1YCFA 2E4XA 3R3ZA 4XA8A 4YIKA 1RQGA 4HAMA 4KNWA 5EC2C 3PQEA 1WSWA 3PPWA 5K6AC 3HCOA 4L6IA 2ZK7A 5FXMA 1VJ0A 1PSZA 4XVHA 3B2QA 1BGXT 1UK9A 4AI6A 1CDDA 3OWXA 4JLAA 2XRFA 3AERB 1PFYA 4CMHA 4MKRA 3CLRD 3CVJA 3IMKA 1HLGA 3KU1A 4OGGA 5DMHA 3ZWAA 4FILA 2QPTA 1AILA 4EFNA 3U9LA 2G9NA 1NG9A 2RJNA 1Z63A 1YDGA 5AK4A 2BFFB 3WWEA 1LFDB 3OQIB 4CC5A 5CM8B 4QGSA 3P2JA 1VF6A 1VHDA 3DLBA 4ZODA 2DXIA 3BGDA 4FR5A 3D54D 1HFEL 3DZIA 4R8CA 3BS4A 4WZBA 1NP7A 3E9CA 2CKDA 3TETA 1RRCA 5L3EA 3OF2A 3O2QB 1HR0O 4RX1A 3L8GA 3TW8A 1HXHA 3RFVA 2RAFA 3LHIA 3VR4H 5DGXA 3QX9A 3N39C 3KVVA 2DCMA 5A62A 1JR2A 2XQKA 4XYLA 3HWWA 1FBNA 1D2GA 4KXUA 2VNHA 4EPYA 4GL4A 4OQEA 3ND8A 2GJAA 4OQDA 4Q7MB 1QFJA 2Z9BA 1R8SA 3DLTA 2DMRA 2JHPA 4L7QA 3H4IA 3EWIA 1Q1NA 3WICA 1R8JA 4G4ZA 4O2BA 3D7LA 4CQMA 2C7BA 1E2LA 5DYGA 2KM1A 4MS4B 4KUMA 1VI2A 1U97A 1J0BA 4V3BA 4Y2TA 3C14C 4EKNB 4R9VA 4MSWC 4BJ6A 1QONA 4LHWA 4WV3A 1I7QB 5TVKA 2JJQA 1QHSA 3II6X 4JZGA 1JFFB 1TAEA 3N70A 4IS3A 2B5WA 5GZ1A 4IIJB 1NKSA 3W5JA 3VNAA 2Z30A 3HR0A 1K5GA 2P65A 2NXEA 2F3RA 1LC3A 4UCOA 1WABA 2HFEC 1KJNA 3OKAA 3I8OA 3H0KA 4L87A 3BMNB 2XA9A 3IFXA 4C8EA 2AC2A 3JALB 4EG3A 1XEWY 1N2EA 4X1IB 1C30B 1Z25A 2BGIA 5CA0F 1C3OB 1I6LA 2J45A 3ITEA 1UXIA 3A2NA 4K88A 1S76D 5F77A 1DCFA 1N6PA 2NUAA 4OAPA 5EJMA 3FWKA 4EQZA 1NUQA 2GXSA 4CR8A 3RVBA 2CHQA 1BMTA 2QLTA 5DP2A 1CUAA 4ZPJA 4LX8A 1PZMA 1P84F 3U9SA 2R1VA 3RRXA 3AH8A 2W8ZA 4IGFA 5HWEA 3SP1A 4DMRA 1WJGA 4PO3X 4XWAA 2O59A 3ZE2B 2ZDIC 4KNVA 1TU0A 3AUSA 3WK5A 5EZYB 5HBGA 2BGNA 3NOVA 3EULA 2FGYA 1GZVA 2VSNA 2ZE5A 3HEMA 5G0WA 5IARA 1R5BA 2ZSFA 5LQKA 2P8JA 4DJAA 1UXKA 5HDBB 2FF7A 1CRWG 3BILA 3CMMA 4R1MA 4DLPA 4P86A 3LC1O 1AY0A 1JQBA 2IU0A 3FPFA 4P32A 2RQ6A 2DR3A 2P68A 3Q40A 1Q82H 1LDMA 2WHQA 4Q19A 2Q5OA 4IZOA 2ODMA 1DCKA 4HLQB 1ACMA 1Y89A 5LPNA 2QKCA 1SUDA 5G4KA 1J95A 2WSIA 1I2CA 1RA4A 1UF9A 4H4EA 2NTJA 1V8OA 3UHAA 2KGWA 5KTTA 4UM5A 3ZLTA 2HJGA 2WSSD 2H59A 3SVTA 1E3MA 4E2LA 3AM3A 4MA5A 3QFRA 1VQLF 1RM3A 5BMVA 3EZ6A 4CMCA 4AWXA 5A4FS 5AQEA 1MZPA 1C0IA 3TXYA 5HKOA 4DYVA 4F2HA 3CB2A 4KUHA 4ZAVA 2AN1A 3ADCA 2OE2A 4LRWA 4AUKA 1PDVA 4MYTA 1JXAA 4WRRA 1DRWA 5KC8A 1N75A 2JFZA 1B23P 3V32A 1JDPA 2EEPA 3KYIB 1E1QD 2JJ2A 1JPUA 5AM5A 1C3VA 5CVTA 4FYWA 5CNMA 4IT5A 2VRWA 1WXDA 4KH0A 2M6LA 3DA8A 4DCCA 1DLIA 3FJOA 2F8TA 1QRSA 2GXUA 4UUMA 4EFBA 1R3DA 1VK3A 2H63A 5PGMA 4FLMA 1N8RH 5KKAA 2Z8XA 2VXCA 1IXMA 3SPGA 4E5KA 4RD6A 1VKNA 2EYUA 2P4KA 2CBZA 3GRZA 1VZ2A 1VMEA 5TT1A 3U4AA 4YDRA 3WDLA 2ZJYA 1FFXA 2WD7B 3WAKA 1VE9A 5JMOA 2OBLA 2FW7A 4KMRA 5HFAA 4JI2B 2CE7A 4GX2A 3DVRX 1X2BA 2HCFA 2VJCA 3GUZA 4J43A 1KMHB 5K45A 1FRFS 2PMBA 4KO1S 5B1IA 2LUOA 1L4MA 2GSWA 2NG1A 3VXKA 4BNLA 1FYEA 3OTHA 3O8OA 3GFFA 2GO7A 2M7WA 2PMPA 1SXJE 4GVLA 2B34A 5HIAA 4J0CA 4K9RA 2VHUA 3GHYA 4I9HA 4DLKA 3WV5A 2PBZA 4E07A 2OHWA 1XMQO 5TPWB 5J40A 4XWOA 1SHUX 2GZ3A 2K1SA 2QM4A 1IN7A 3JAMM 4KK3A 2XF2A 1NXQA 1GZUA 3C3WA 1HEIA 4L0DA 4ARZA 3OONA 2XWJI 4FYVA 4ZP1A 5BRNA 3E0XA 3LWBA 2CD7A 2PM8A 2VDJA 3FE2A 3KXPA 4GP9A 1WU7A 2OEPA 2FE4A 4C2TA 2IH3C 4NMWA 5CNIA 4PX9A 2XNHA 4TWAA 4DQDA 2QUAA 1XAGA 3KTAB 3WGGA 1M5RA 2V97A 2E1PA 4QYIA 5IDXA 2BDUA 2I34A 1XZBA 2AIZP 4X8AA 1F51E 4GE3A 1T5SA 1G42A 3U4IA 1JTVA 3CXCU 1Q8IA 4BQEA 2W0FC 2MCFA 4AJNA 4QRDA 4RFVA 4URHA 2XQIA 1RWMA 5D7BA 2X6TA 2Q5CA 2HLHA 1OCOC 3FSRA 3GCZA 4ML3A 1R9NA 2OCAA 3CXRA 1RBMA 1QMPA 3K15A 5SZKB 4HT3B 2F90A 5EHXA 1FXVA 2HDWA 4S1NA 1E2QA 1Z15A 1SK9A 1F0KA 4EG5A 4DR1B 4V02A 4LDNA 4WFQA 1Z0DA 3AR3A 1VCMA 5JI2E 4GM1A 3AO0B 4PAWA 4PSKA 2DERA 1KMIY 2GMWA 3G82C 4RIEA 4XCXA 4FWTA 3GVHA 1GL9B 5FA6A 4RF3A 3BORA 3NKFA 1WHSA 3DNFA 5JH7F 3QYPA 4I9WA 4MVJA 1UK7A 1ZGAA 1U0JA 2Q4RA 5HDQA 3WNQA 1R9JA 3TZHA 4JLVA 4P6VF 4ZI7F 2MSWA 3SR3A 4DS3A 4IQGA 2QM0A 1H2GA 3L40A 4I7ZB 2R72A 2JNWA 2DT8A 1UJ6A 4ZHYB 1J33A 3KD2A 4RK7A 2YDYA 3SYNA 1VQ5V 3N2LA 2GS9A 2IUTA 4K1XA 1AV6A 4DRXA 5CHEA 1DQSA 3TZLA 1Q3HA 3ADBA 2GDZA 1QU2A 3N07A 3NHLA 3Q4HB 1VL1A 3SZUA 5FF9A 2ZUTA 5DYWA 1EP9A 4AY4A 4O8ZA 4Z9XA 5B53A 1P9LA 4ZMBA 3L5OA 4DCGA 3DUWA 4NPHA 4HNRA 4ZAWA 2XWBF 1MP0A 2QD5A 2X9GA 4NXNB 5C1IA 3IBGA 3KYDB 3DVAB 1P61B 2FW6A 3FFQA 1VXOA 5JD3A 5L3VA 3GOQA 2HTEA 1KI9A 2XB8A 4G5FA 1PFVA 3AY7A 4AO8A 2D59A 4YRTA 1B6SA 2GLXA 3RFTA 5BNZA 1QIJA 5JBIA 4H3HB 2PSFA 3F5MA 1RNLA 1W9MA 3KUXA 3A1SA 1C81A 1L2TA 3CH6A 2VQFB 4P0PB 3CJTA 4XW2A 1UWCA 3L6BA 4D9CA 5TB5A 4BW9A 2A67A 1XTKA 4LGCA 2JDIG 5BW6B 4QTZA 3TIFA 3IUEA 1I7SB 3K1YA 7AT1A 1OH7A 4KYUA 4PLWA 4XWWA 3OT7A 2FCRA 2AZTA 2LFSA 1R6VA 3Q0EA 2CV0A 4CH3A 4PY2A 1XVUA 3BFRA 2FMUA 2X86A 3NH6A 2P9TA 3UIEA 2QD4A 3AVOA 3RIHA 3VQTA 1RZRD 4TSKA 4R68A 3RQSA 4M9XA 3UJHA 1QRTA 4EIWA 4RNCA 4N8SA 4P2GA 3VPXA 1W75A 3DZGA 4BO3A 4JUCA 4WOBA 4DKJA 3NK7A 3CISA 3I2IA 3QOFA 1V11A 2XOKD 3GZTB 1YFLA 4PG4A 3K3WA 3CS5A 2G8LA 3O8BA 1FDVA 1U3GA 2B5UA 3BSYA 4FXPA 3H6GA 5J4KA 2WV9A 1DF5A 1H05A 4GKJB 4U6NA 3L4JA 1QUFA 5EQTA 1VMAA 2AI2A 1ULBA 1KI4A 2K7ZA 1ZL2A 4J1QA 2GXAA 5KVCA 4RKEA 2XZDA 4HI0E 3D4IA 1GILA 5GVRA 1RXSA 4AU1A 4ISCA 4PSCA 4QYTA 1SU8A 4LF5B 2IE0A 1V95A 2F1KA 2QT1A 3IVGA 2HK9A 3H9CA 2P5OA 1GKIA 2WP8J 4U2GA 1TYEB 1JR3A 1V41E 5JQGB 5H4GA 1DBIA 1XWFA 4CUZA 4XWKA 1VYUA 1DCTA 1VSTA 2QN7A 1YRYE 2DYKA 4HYOA 1R37A 1JR6A 2E4VA 3KFVA 2Q5HA 4X88A 1ZDMA 4CCYA 1SA0A 5CB6A 4N3CA 2R4QA 1Y8QB 3ZX4A 1JJ7A 1A4XA 4PS1A 2PUCA 1M6HA 4UZEA 4HDRB 2PL3A 2WUFA 3ZGLA 4YJ3B 2IZ6A 4WK6A 3KCNA 1OW3B 5LMCA 1HNWB 4Y18A 4MAFA 3UUGA 4YRSA 2RJOA 3VI4B 1MIHA 1CUZA 4FQ5A 3F0FA 4PC6A 4NOMA 1MPTA 9MHTA 4BW5A 1HNZO 3QI7A 2ZOSA 3LWNA 3DV2A 4JBLA 2QTMA 2TYSB 1WUHS 3EZNA 4US0R 2VO1A 3FAVA 1QF9A 2ECKA 2CVLA 3CG0A 2QW1A 3A1NA 4NRDA 1G3QA 2IU4A 2AFIE 2VP6A 3OUUA 2RMKB 1YKFA 3TKYA 1L5SA 2ZVJA 5F5LA 2I29A 3HDHA 1X8LA 5ALTA 1QDEA 2CMHA 3WLJA 1DWUA 2PUHA 3RUHA 4FZJA 4HQ6A 3ESYA 4FBLA 4HDKB 1G21E 4BR6A 4C01A 3SU8A 1PTJC 1U3UA 4JI1B 4Q9HA 1EE1A 1RAFA 2GPYA 3WLKX 1NRWA 3EQ2A 3VKUA 1S7CA 1EE9A 2J41A 3MCVA 4JENA 1X9IA 2X3UA 2G06A 4LZLA 3E70C 4B3RB 1VF7A 1DFGA 2W2LA 3K1AB 1SR8A 3D6UA 4AZ0B 4LCUC 2SCUB 3LVQE 4ECEA 5CDUA 1FIUA 3MYYA 1OFGA 4DAOA 4NATA 3OZUA 1VJGA 3ASVA 4LCJA 4R7TA 2ZPUA 3FVWA 1W4AA 4QE9A 4WESA 1N5IA 4JLPA 2NZJA 2R9IA 4S1PA 2HSGA 4HSGA 5FPHA 4NCXA 3ND9A 1P7BA 1T2FA 1RTKA 4ZHQF 2BGJA 3IDOA 4ZYTA 1XQWA 2J0UB 1YCIA 4R9NA 2YYEA 2AFHE 1QU3A 3F6EX 3IAAA 2WUDA 3U3ZA 3PHCA 5EBLC 4FFBA 2C04A 1Z6XA 1RYDA 4P2BA 3X2FA 4P58A 5BVGB 2PSHA 2IX3A 2VC2B 3DVLA 4M76B 3GJ0A 1AVMA 4YT4A 2O8EA 2OFFA 3NP7A 1AKRA 2X8JB 1DJOA 2XVXA 3JVEA 1G8HA 5A5VA 3V8PA 2GAJA 1Z0JA 7ADHA 2Y0EA 5CCBA 1JXOA 5ICCA 3BX1A 4XFDA 4FT2A 2AV6A 4M2LA 3N05A 1FNKA 1U5BA 2X19A 2CZGA 2YY6A 4DJEC 1QHHB 3A6GA 1XZNA 1WULS 2QT0A 1UKVY 3MLEA 4OFXA 4DJTA 4RPLA 4DR4O 2FPXA 1YA8A 4P5EA 4OUKX 4XI9A 4I99A 4LF9B 1I1HA 5LZ7A 2ZBQA 4LJ5A 4OJYA 2QTRA 5I9BA 3U5ZB 4XYEA 3CZ4A 5I9IA 3FPEA 5B2EA 1XQ9A 4NC9A 2DT4A 5HFNA 3B5IA 1CUCA 1W2WB 1VA5A 4L28A 1QJCA 1JU4A 2PZKA 5JS2A 2A88A 5BXYA 3E53A 4RUEA 4OD0A 2HKIA 4WBXC 3AL2A 4M8LA 3UPTA 3G02A 3EUAA 1TUGA 3RSSA 3W2IA 4TV9A 2LVBA 5DM1A 3U4GA 2ZT8A 4CEIB 2MSNA 3PDUA 3CCEV 3ZCCA 2WJAA 1UPBA 2H5IA 1TD9A 2Q5FA 3FRJA 4K6OA 4QG3A 1BSMA 3IKMB 5HKBA 1N8TA 2FZEA 5DM0A 4FKMA 2NUBA 2RGXA 2ODWA 1C9DB 4QU5A 4QBFA 1N1MA 4O4LA 3THOA 1DDOA 3HVKA 4ZDJA 4N9QA 2H7CA 2HU2A 2ZRKA 4E11A 4BN0A 3PL1A 3AR8A 3LLVA 8AT1A 4E1AA 4X92A 4XM0A 3HSYA 3CPQA 1WSAA 1E1CA 3O4HA 4R6WA 1GNPA 2QY6A 3GLGA 3E89A 3CWBH 3ZTWA 3W34A 4CMIA 5IKEA 5LHGA 1EEXB 4LDPA 4IDNA 4TMYA 4W1SA 2FF5A 3LBAA 2Y76A 3GZNA 2DPGA 2HHLA 2PMKA 4WZAE 7REQA 1E9EA 5IK2A 1JA1A 1RQ7A 1DT5A 1Z2NX 5AXDA 4HNHA 3MAQA 4DEXA 5AW1A 2G9ZA 1OTXA 3L0SA 2MINA 1OBFO 2XYRA 3PEUA 1FLVA 1E3WB 2F66C 2OOKA 1GAEO 3RTEA 3PFGA 2FCAA 3VOBA 1MV5A 3B52X 4U3JB 5K5EA 1VGVA 4IF4A 1E9RA 3EK2A 3K7EA 4JL5A 2D2VA 5J47A 1QIGA 1R8YA 5A2QM 1EK6A 2G1PA 2GTAA 3FNRA 1W76A 1DRUA 4QYSA 3RSQA 1GZ4A 3LUGA 4KSCA 1P33A 3AR7A 4N9WA 4CLOB 3G89A 3NBQA 3MHHC 1FCJA 2B78A 4FGSA 3CJQA 5EUCA 3K5OA 2C5AA 2X42A 1B0ZA 3H9JA 4R2MA 1YS7A 4J94A 3AUXA 3HNRA 3PEYA 1E5VA 1D8AA 1VRWA 1HZZC 1R4NA 2GD6A 2ZBVA 3CF6R 5GIOE 9GPBA 3FPAA 3I3SR 4F46A 4YJFA 3L8FA 2IJKA 3DP9A 3QVOA 2J3DA 1ZH6A 3VSCA 1AI7A 4G65A 5FFNA 2OZLB 2IHVA 3AEQA 4RYLA 4TROA 4JV5B 3C5HA 3IAXA 3DDUA 1B8VA 4WH0A 3BF7A 3V80A 2PYIA 2P0YA 3FB5C 4PQRA 1W47A 3PC4A 2B4RO 4HEHA 4BB6A 2V3VA 4AYTA 3HVIA 2FEWB 3MGBA 1RRVA 2TS1A 2EXXA 4IQ4A 4BQNA 1YGPA 4CH4A 3L0YA 3EYWA 2AB0A 1YXBA 2BFBA 3QY9A 3BA8A 3D9QX 3U81A 3V1YA 2NTYC 2GVDC 4KGXA 2BZ1A 1EDOA 4DSZA 3G2JA 4LMRA 4J7JA 4RCVA 3C4VA 4JR1A 4L15A 3HUEA 1SQ6A 2I4OA 2WU8A 3CCVF 2P4HX 4D44A 4C30A 1RXIA 1GO3F 4KXVA 4MVUA 2IIQA 3GJ4A 1W49A 2D74A 4JT9A 6ABPA 2IS6A 2R66A 2JD0A 1C1YA 2A0XA 1TUEA 2QQGA 2H0AA 3VMMA 1V8FA 4F1JA 1UBMS 2QJ1A 4JAUA 2AGAA 5KNBD 3C9UA 1NJ1A 4I55F 2DPXA 3ODPA 3T7KA 3QLUA 4Q3NA 2YDXA 2H5EA 4TTSA 1T2CA 1PJ2A 3HXQA 4NBWA 1NVGA 1WZNA 4QFCA 1PBTA 3RI3A 4LC0A 3TKLA 5C46F 1GH6A 2VL7A 2IUFA 4U7JA 1TX4B 3TTVA 1R18A 3H99A 3QLEA 5CLIA 2Y1OA 3JRXA 3O95A 1KS2A 5DYYA 3GJ3A 4L8GA 4TQGA 1RI1A 1QK4A 1NVPB 2E9SA 4NBVA 4NCHA 5JTTA 5EGNA 1IEWA 3PRYA 1KI2A 4KFCA 2EKLA 2YTZA 1IVYA 2ZKLA 2J3EA 3LF2A 3VCZA 3WHPA 3HTNA 2D5IA 3N27A 4GUDA 3FD5A 3H05A 1Z26A 5GINE 1GYPA 5SYAA 4GPAA 3KZVA 4COKA 2VQ6A 1X80A 3VR5D 5DBIA 3WG9A 2G71A 5A4AA 3WIOA 1TA4A 2RI6A 2R86A 4J42A 1YQUA 1AKWA 1N2BA 1ZOIA 4C4OA 1U7DA 4DR3O 4TWRA 4DN6A 4RZQA 1EXVA 3MS4A 3CT4A 3CNNA 4RWEA 3UAOA 2R4TA 4EPWA 4RNDB 3U13A 1H2SB 2WLJA 3DKPA 3R5XA 3FUTA 5BY2A 4EX6A 3BXFA 2OLJA 3UUWA 1R6AA 1R4MA 3G0HA 3DEZA 1WCWA 2IZ7A 4RIIA 3UQZA 3FJYA 2PL5A 4CJXA 4S1OA 1KEZA 1H8HD 1RM5A 1XALA 2PUJA 3EIHA 3HL0A 1QV6A 2EJTA 3BMOB 3H2SA 1K75A 2DBRA 5FBZA 5AIAA 5CFPA 1G64A 2AJDA 1OCCB 3IH5A 4ENVA 4NULA 4JI4O 2FPRA 1SOUA 2OG1A 3B5EA 1VE7A 1W2BU 4XEHA 3KR9A 1PZNA 2BFEA 3H11B 3U4DA 3SDBA 5IE9A 2ERXA 4IJUA 1BNCA 2XQGA 2IBTA 5JFGA 4B3CA 2W4QA 1CW2B 4G97A 3FKSD 2GVIA 2BFDB 1XQ6A 2LV8A 1QE0A 2DUUA 3UXEA 1SFRA 4LSZA 2F4VB 3G0GA 2EYQA 3MD0A 2RNBA 1QLJA 1BT8A 5B3SB 3ZDAA 4B33A 5TIIA 3PNBA 5BSTA 3QF7A 1P9NA 4MUXA 1K9MW 3TLZA 2CTQA 3VQYA 1SBYA 4MX8A 4F4FA 1YR6A 2I2DA 1T2VA 5CTAA 2XUPA 1SQFA 3Q7RA 2EBUA 3ETJA 2AZDA 4B3DA 4AQ7A 3X2SA 2QAIA 3E22B 3DZJA 3A0RA 2WVJA 1CUFA 2DJIA 3SPCA 2HRBA 3QELB 4QQKA 5DBHX 2A33A 2GNOA 5BXQC 2VTVA 3EA0A 2I2FA 4V2UA 4WUTA 3T5MA 4B7AA 5EMMA 3VBBA 1ZRMA 1AQUA 2HW8A 4G0QA 1UIRA 4FYXA 2HMVA 2HWKA 4F21A 1QVGU 3I01M 1JEQB 3OFSA 4Q7JB 4A15A 2HH9A 5BSHA 4NQZA 2OCPA 2PAFA 5CU7A 1O4WA 3QTYA 4G4YA 2ID8A 3ZLVA 4B8YA 2YN2A 4NCBA 2JCXA 3I9OA 4N6OA 5CG1A 3TQTA 3MERA 3G6KA 4WFAV 4LHSA 3EASA 4YASA 3G59A 4QDUA 1X7WB 1IDN1 1SC4A 1QCZA 3OQPA 3AEYA 3ZR4B 4MTOA 4MQEB 3WIBA 2WIGA 1V54C 1T9GR 1IWPB 5TC4A 4F12A 4LRQA 2CYCA 2X6AA 2QV0A 1Z2GA 1TC1A 1KYXA 3BFJA 3EXAA 3EBPA 1FD9A 3ZV7A 2WLLB 4RIGA 2WLHA 4K5QA 2AKEA 1YI8A 1HMYA 1NW4A 1JHXA 3UZUA 3NHSA 3WGNA 4CZ2A 2F1MA 1WLYA 4FGKA 2FX5A 1M1NA 1IZ9A 3K08A 5F2OA 1Z4KA 3F9RA 4ZU6X 1Z28A 3O4RA 1J5XA 1APBA 4J7CA 2AI1A 3DVSX 3I0MA 4X8OA 3AF5A 3VISA 5EB0A 5F9FA 3ZDBA 1YZ3A 2UKDA 3K72B 2JD2A 3KZCA 3TLKA 1Y3BE 4GMHA 5DM4A 1RLUA 2WA2A 4WLFA 1UFVA 5IULC 2XV1A 1ZISA 2WLKA 1WMBA 2QSZA 5CB4B 2Y27A 5PNTA 4YRLA 2CXPA 3Q1LA 1GCOA 4WDRA 2PZ8A 1F6BA 3ZX6A 4E2WA 4JLBA 1EXNA 2WPDA 3LUTB 2J9YB 5AXBA 5COQA 1E1RG 2V5UA 4ROTA 1TCAA 2E4ZA 2FPIA 1A5ZA 2FEAA 4KQ9A 3IPRA 1H6CA 3LXRA 2FSFA 5DHQA 3FRHA 2IT1A 4V0SA 4IDOA 1Y9JA 4DCUA 4WCVA 3T3EA 4GZMA 3OZFA 5DTMA 3GAMA 2IXGA 4C6SA 1QNFA 4B5LA 4DAEA 3I12A 3FYUA 4QGPA 1T2DA 4K3UA 3R6GA 1RPZA 4CU5A 4YAOA 1E1LA 4K8RB 4B3JA 3L1HA 2DRIA 1L5ZA 2UYYA 4CG1A 2VSXA 4CMGA 1K2WA 2GGSA 3S8MA 3DBVO 2IYRA 4QPZA 9ATCA 3VI3B 1ULZA 1FA9A 1XLVA 3DQQA 5IHXA 3ZDCA 3O8DA 4QFBA 3CUUA 1AQ6A 2V7EA 2L0XA 1QJ4A 3OPYI 4NTYA 4Z49A 4YIOA 2GBLC 1SZQA 3SZLA 3H13A 3OFNG 1NRJB 1DMSA 2WHPA 2UUCB 1TI7A 4B76A 4KE6A 5CBHA 3CD6F 4QQFA 1EESA 4DNXA 3MWJA 5FV7A 1VRCA 1GQOA 2ZJBA 3HADA 3M3PA 4MQ6A 1RD4A 3P0ZA 2ZJ0A 2P9YA 3L7OA 4BQQA 5T4FA 3LT1A 1RCFA 1NYQA 1YBHA 5DK6A 1NQXA 1F17A 2CXTA 2UDPA 5AVMA 2F62A 3IP8A 3SX2A 2VUSA 3AG1B 1S4QA 1CVLA 3FOFC 5EKDA 3I1JA 4DNFA 4KEAA 3GR6A 2OYRA 4DE5A 2VJQA 1D6JA 2OM2A 4KUGA 2E0IA 1IBKB 1E2GA 4Q4HA 2OTLF 2VJDA 2HLPA 3QW2A 1OY1A 3OQOA 5I9LA 3IJ5A 3PNMA 1AGXA 2VOJA 4NTXA 4WBNB 2DLCX 1YXMA 4MICA 3WGQA 1YZLA 2ZSIA 4KL1A 1G1AA 3H9UA 2MYPA 4ER5A 4DRZA 1TKBA 2ORYA 5LQCA 2HJWA 4D45A 1MW8X 1F2UB 1Z7EA 5FD8A 4R0MA 4ENPA 4IRMA 1IV3A 4AVYA 4H16A 2CHUA 1CHNA 4UHDA 3EUWA 1TDJA 1ZAUA 1DMRA 6LDHA 1G19A 5IU6A 3DYIA 2UUAB 3RJ5A 2IUSA 4S24A 4ZWNA 3AHGA 3SE0A 2IYYA 3MWGA 2I6UA 3W2FA 1SUFA 5D5QA 2YYZA 1EK0A 3QFSA 4ZIRB 3J7AU 1ZSNA 1FMJA 1XFDA 1YZGA 4DSUA 1M6WA 1XA0A 1WX1A 1WIWA 2QR4A 1FLAA 4ZO7A 5CH5A 3LDFA 4KQMA 2ZGVA 4QGBA 2VHZA 3VTAA 5F1OA 3GUHA 4FGWA 2HLNA 1B93A 2HVKC 2XOXA 4BZPA 2PUWA 1L5YA 1TOAA 1VQ4F 4EA7A 3H3FA 4YCSA 1K98A 2EQAA 3QUCA 5K3CA 2P6UA 3TCKA 3LXXA 5AVSA 3PFKA 3SBDA 1P7YA 3BBLA 3DDWA 1IFXA 4D7AA 4ZHSA 2ASEA 4DLBA 2BGRA 3EJ6A 1JIQA 3LWDA 1I3MA 3RVYA 3QEJA 3N2NA 3K03A 4R8LA 3JSLA 1LZKA 5DW0A 3FYCA 5JS7A 3HXLA 1UPFA 2Y0CA 3KKNA 4D9KA 3OD4A 3OFKA 1P0IA 3UN1A 1W57A 1X7YB 5LP6B 2WR8A 1GT91 3NJRA 2IIPA 3OIYA 4C14A 4ZVKA 5TXGA 2IS1A 5DNCA 1XMOB 1JPNA 4XYBA 3UMJA 4BKPA 1YZYA 3QA9A 3BGVA 3TPCA 4TMTA 5B7NA 3GHZA 4TV8A 3PICA 4QDOA 4DG8A 2XSZD 2MDTA 3O83A 4HNAA 1WKCA 2NVOA 5ALMA 5HRCA 2VDPB 3KLOA 4IILA 1L4HA 4E5VA 3ABKC 3ZS8A 1QGAA 3IIMA 4WEQA 3RIMA 1S72V 3W3AA 3A6JA 3CG6A 4G1CA 2P2DA 2IHBA 5J2UB 1IC6A 1HTWA 3PIRA 4LCEA 1CT9A 3ZLUA 3S29A 4KACA 5FWDA 2I2WA 1IV1A 1RC8A 1A4UA 4D79A 1YI1A 1T25A 1YRHA 1CY1A 3BYZA 2Y2UA 1K6MA 2EQBA 3THWA 4UXNA 2XKKA 5K3DA 4G37A 5IWAO 2Q4OA 3NBMA 3KTOA 4F1WA 5ENVA 4W5QA 4LVUA 2XXAA 1PR2A 4LW8A 5TR9A 1NW5A 2Z4SA 1G4AE 4XLZA 2W71A 5IAOA 1I6KA 3K53A 2WUGA 3RUEA 2H4HA 1TIPA 2FUEA 1Z2EA 4GGMX 5FWYB 4R41A 2R6ZA 1MRNA 5LQJA 2KI5A 2CF5A 1F2VA 2IPOA 1NLYA 3PSAA 2EGGA 5TQ0A 1R10A 1GDDA 2WWVD 2ZRIA 5KHJA 2QTGA 1IOVA 1E1YA 3OEHD 3OP1A 1X0XA 2ANBA 4I19A 5U4XA 2GZHA 3FMOB 2PGGA 3N2KA 1LPBB 4GBGA 4OJNA 1GIAA 2UU9O 1PV4A 2IBSA 2QJOA 3KWMA 4M3NA 1GR0A 1AD2A 3M3HA 3KNZA 2NUPA 5CM9C 5AVZA 4KWEA 2PH5A 4BNMA 2Q0OC 2TSYB 2B25A 3L9XA 1V5IA 1W87A 4H6WA 1F4PA 4HEQA 4RPKA 3DMTA 2AOUB 3V7WA 1A2BA 1RJFA 5J43A 1NLFA 3ZWQA 3UM7A 1EHCA 1JE1A 3F6SA 4XM1A 1EHYA 2V55B 3L8ZA 4QJ5A 2IDMA 2ZZKA 1TF5A 3TCNA 1PO7A 2VJNA 3PC3A 5DKFA 1FLDA 2CDBA 4DCOA 4HQKA 4U02A 3K9FC 4X64O 3BABA 5TE9A 4RM3A 2FOLA 2HJ9A 1KQPA 5HHTA 3CVOA 4CEHB 2Z0MA 3M5CA 1WB8A 5K1PA 2W2NA 4UAJA 3WB0A 3VNVA 5IPFA 1XVTA 3ELWA 3QHAA 3NONA 3IQIX 4BNHA 1STOA 2HMTA 2IW5A 1J5PA 3AMVA 2DUJA 3KRTA 2GBPA 3WMXA 2IEZA 1NTOA 3J80M 1OAOA 2HP0A 1V8BA 4XB1A 5BR8O 4MTXA 4DR7B 5BT8A 3ELCA 2IDJA 4H77A 2P91A 3TVDA 3H17A 3I9V6 2AMVA 1J7HA 9LDTA 1SCKA 4BGEA 1MVLA 2BCJQ 3B1VA 1SKVA 3DOUA 4FJ2A 1OLUA 2Y77A 2IXTA 4CI0B 4I4TB 1K63A 3QJGA 2BCEA 1P2TA 4ESOA 2RBKA 4CH5A 4MLZA 4D4GA 4WADA 2ZR8A 2LIVA 2Q7DA 3LV8A 1WXEA 1IBMB 2W8BB 1CULC 1Y82A 3C8UA 4PNPA 4Y3UA 4UCUA 2WUVA 4CQLB 4DLWA 6ADHA 3NC0C 1QNMA 4EY5A 1U2DA 5F1KA 5HP7A 3RWRD 3I6YA 3NALA 2XECA 4AMBA 1IXRC 3E8SA 3ZRVA 3F4KA 1JSLA 3K92A 3UJ6A 3RYHB 1N7GA 4JXXA 2IOFK 2FK7A 2ZIVB 2ORVA 1SD5A 1HE8B 4KSBA 4PZCA 3BEDA 4EW2A 1OWLA 2EL7A 3WFJA 4YRAA 2HRYA 3C6BA 3E35A 1L7AA 1N5RA 4XIYA 3PNYA 1VQ8V 2O3RA 2WLMA 1U5CA 2JAPA 3FA2A 3A6KA 4L72A 5A0FA 3X3HA 1R9GA 5JYEA 4EKIA 3SXUB 3LRTA 3HYNA 5EO3A 3QTLA 2BMAA 1EXDA 1T0JB 1ZSVA 4RTQA 1QZUA 1QB7A 5DWDA 4GI2A 3PRJA 3GEHA 4A6EA 3AVWA 1TGYA 2VPQA 4CQMD 1SM4A 4ER0A 3ZHUA 3RF7A 2QRVA 2V8OA 5EWMB 3A26A 1FSSA 1PLJA 5HUHA 3CLVA 1BX1A 3CGGA 1DAEA 1S8AA 3RTBA 2OCGA 4B73A 1XAIA 3OOWA 3O84A 5L6LB 3EPPA 1G6KA 1ICEA 1TJ5A 3B48A 4A23A 4RHYA 3MJSA 4A26A 1CY2A 3S1AB 1KZHA 5CA0A 3SOPA 4ZCRA 4LY3A 2A57A 1XTSA 3OCCA 3PT9A 2OHFA 3D5EA 2FVYA 4FOTA 4AT1A 4PC2A 2WJPA 2GF0A 1XU9A 1GZ7A 4KN5A 3K2XA 1PGNA 4Y6PA 2G76A 4NZPA 3CH5A 1R27A 2EV9A 2EZ9A 1CERA 3R3XA 3CZAA 4L3OA 1LDEA 3AP3A 4KR2A 4YV0A 4UUPA 4FIDA 2JRLA 4Q3DA 3D64A 3B13B 4XB2A 3U3JA 1V2GA 2ZJ4A 4AMZA 1EDEA 4CVNA 1OI2A 5G41A 2ZRGA 3DFKA 3D6NB 3SK0A 4E21A 4M46A 5HM8A 5JO9A 4FIZA 4ZYYA 2A9JA 1I3NA 5LB4A 3RS3A 2WB2A 1ORRA 5CDYA 1EX9A 2XIJA 4C0HA 4FOOA 3TOZA 3HKDA 3ZD8A 4FUTA 2IP2A 4N41A 1PGQA 3CGWA 3IOMA 5J9PC 1D4FA 1SRRA 2JNBA 3AIIA 2A5JA 2H8EA 5DTRA 3GLVA 3VYUB 1X42A 4FMBB 4QDTA 3OT1A 1C7RA 2WT8A 2OZBA 1SBCA 5D6NA 3GNTA 3FMIA 5HEKA 4G1MB 4A0HA 1NJ8A 1RJ9B 4BLSA 1RPJA 5TJ9A 2J4FA 4GD3Q 4JI6B 1DO8A 1F2DA 1LSSA 2PHZA 2QROA 4GOJA 4HY3A 2X5NA 2BBTA 1BE6A 3DTVD 2MYUA 5DGDA 2CDRA 2ZTHA 3G8CA 2Y48A 1JG1A 1G3MA 4PO8A 4A9AA 4OEHA 1BHBA 4UMFA 1COZA 2GEFA 3H1EA 4B3FX 3ZZ0A 3O2SB 4LWZA 1IK4A 5KUTA 1F3LA 2J8ZA 4IIGA 1FXSA 1KKLA 1JT9A 3CXHF 1Z0AA 3WNBA 2RHCA 4N3BA 5IABA 2RARA 3KEMA 1FFAA 4BVRA 3HBAA 1DIGA 1PK8A 1HL3A 3DAPA 4K0KB 3L18A 1EFPB 3S3XA 1QH8B 1ZD9A 4EA9A 1SCQA 4JDPA 2ZQMA 2JJ2D 2R7KA 1O97C 1DZ3A 3T7AA 3BIJA 2WWXA 1KJIA 3G49A 3UGTA 1KSFX 4X3LA 3GPCA 1P1HA 1Z29A 4P7FA 4KZKA 1UEIA 3LUAA 2QE7A 4GC9A 4BVSA 1VYHA 3NK6A 1IB6A 5KQPA 3CVWA 2FLKA 5F73A 4BTEA 3RODA 5M5BA 1JSZA 2P9JA 1AROP 4D3ZA 1XN4A 2WTAA 1DWQA 3OJCA 2UZAA 1EIWA 4DQLA 4MMYB 4DC0A 5BR4A 2C7VA 1MX9A 4B3XA 4OXNA 2VXYA 2XE7A 3QVMA 2MSEB 2PE5A 3FI0A 4BFYA 2QMEA 2Q46A 3ZWYA 2G38A 1OWNA 5EPEA 5LLDA 1S8OA 2AD5A 2AIFA 1S1MA 4MR8B 3I58A 1VCOA 4FFRA 4N39A 2EG9A 2YJ6A 1JHZA 4U2DA 5HZMA 2ZS9A 1U7UA 1COMA 3ND6A 3A3OA 4XLLA 2ZSDA 4JU8A 1CR2A 5D2CA 2G72A 2CWJA 3QVJA 3VSDA 3PYMA 3BFXA 3W5CA 3GL9A 3DMNA 1KPIA 3LUBA 5JWHA 2R6FA 3IJPA 4PC3A 2G5TA 3MJCA 4B5CA 1B14A 4MCJA 1PQUA 5HX7A 1G20E 2ZWPA 2KBFA 2B1QA 4ZOLB 1P18A 1X70A 1VQ7F 1GUFA 3CEMA 3RWOA 4J9YB 3U11A 4FYHA 4CW7A 3QGMA 5EJEA 1VQ5F 4F6LA 1JEAA 2AW3A 4OHBA 4UJ3A 1NUAA 1B3RA 2IVFA 4ESVA 4YJ2F 4ED9A 2CLOB 5JSQA 3D2BA 1QHNA 4L5YA 2IHKA 1GPNA 4E6PA 3RVQA 2WABA 4OBWA 1LZLA 1I13A 2PHNA 3B8EA 4P4SB 3HDQA 1ZIYA 2XBLA 4OI2A 2Q9UA 4DLRA 2HA7A 1TRKA 2OIGA 1C9YA 1DKPA 1KJJA 4PC7A 3K5NA 6REQA 3VJLA 2KB0A 4J4HA 2EZUA 3T5AA 3V4RA 4MV9A 2NU6B 4JIMA 1XD8A 1AG9A 4M9QA 2FGJA 3CHYA 3WTCA 1YBMA 4BBPA 4ND8A 1P81A 3TCXB 4UTZA 5GAPK 1PSDA 4D3DA 1K9MH 1FU7A 2R25B 2FFQA 4JITA 3IULA 3AHJA 3QXSA 3CHXA 4RK1A 5JH7A 4EW1A 1N2JA 3TD2A 3DULA 2NT4A 4R8KA 3S02A 3EY9A 5LGNA 4ZI7A 2E2WA 3G5MA 1JYSA 3JD0A 4U0JA 1MABA 2RSLA 4P31A 2FN7A 5IT9M 1XPRA 4MVJD 5EMHA 1S2NA 5AJUA 1LLFA 1H65A 3FLAA 2RJZA 4QRHA 1VQ7V 2CWDA 4BC0A 4Q3LA 4JY7A 5CXUA 1WTAA 2X2EA 1JTFA 4MVSA 3ZBHA 4ND3A 1L4LA 2I71A 2EJ7A 4J91A 1DJLA 4FZ5A 2C03A 2WLSA 1KOFA 1GKKA 2ZAIA 2W2KB 3MOGA 3PQCA 2YC0A 3PJSK 5JEDA 1I4LD 5CD9A 1JDBB 2I1QA 3UJ9A 4IZHA 3DSQA 3U60B 2PD6A 4ZQCB 4AF8A 1MQAA 1KZ9A 2PUEA 3DL7A 1XRGA 3F7NA 1YRBA 5TS3A 4N1AA 3MCZA 3CYPB 2DMXA 1EJ2A 1K33A 3O7WA 3EFHA 2YVLA 3A70A 3WC4A 3GT3A 3IL2A 3V42A 4B6SA 2G17A 2IYZA 3FDZB 4LJRA 3I72A 2WNIA 1YB2A 4P30A 5CNJA 1XDCA 3SG0A 1B73A 4US2R 3G2MA 1OPRA 3NHJA 2IXEA 3VIUA 2FC3A 4DWJA 1OXKB 4FSXA 4LXYA 4JAVC 4QELA 1BTOA 2XA2A 3DE3X 5IASA 1TM3E 1W0KG 1YJQA 4N48A 3I6QA 5BVHA 2R1TA 3Q15C 4RV4A 4Y9RA 4O1HA 4F6RB 2QAGC 3G3EA 3O8LA 2DGDA 2GRJA 1DUVG 2K87A 2WLNA 4YHHO 2J7KA 4KB5A 4BUJA 1H22A 3I2HA 4OB6A 2H11A 1MJFA 2NYRA 4HVTA 3U44A 1WW8A 1VQ6V 4MXDA 2C95A 2XUMA 3UXYA 1QCEA 4ZZ2A 1EVIA 5KYTA 3A04A 3QLJA 1K3TA 5LIRA 4Z1MA 5KYNA 3M6FA 3WMEA 1ZJWA 2YKGA 1D0VA 4M1ZA 4DT1B 4LFCB 1DKRA 2MT9A 4X8HA 3I62A 1RXEA 5EKXA 1HZZA 3H2JA 2N1BA 3U3OA 1F8YA 4RM2A 2IXBA 1GN8A 2ZB4A 5LD2B 1B8NA 3VPBA 2K1EA 1KWGA 1I7FA 4LNUB 1JLMA 4EFLA 1NJIH 5K2OA 4TVSA 3W9BA 1HDEA 4EPTA 2BHTA 1UT5A 1UBRS 1JR3D 4B82A 3WI7A 4QFDA 5A4KA 3UAYA 4V0NA 3PEVA 1MEJA 1G5HA 1XDWA 1TO1E 1K7XB 5EMJA 3CXCF 4YRRA 4F4IA 3H5AA 2BP7B 2C20A 3ENVA 1M10A 3A4NA 4UU1A 3IAM6 5E9WA 2BUCA 4LFAO 3A4YA 4NZYA 4N0EA 4ZEXA 1NMZA 2Z5GA 3E83A 3TNLA 3QY0A 1VQPV 3SQDA 3AF1A 5DM70 4OGKA 4HYYA 1KTIA 2AR9A 4LRUA 1NI4B 2WYWA 4CIDA 1FXWF 3TF5A 4UCTA 2C9BA 1M2GA 3IJ4A 4H7DA 3PGVA 3HWSA 2ZT7A 1PZHA 1FAFA 2ZT6A 1FOEB 2BFPA 1DRJA 5A4JA 4LOIA 2HHHO 3Q8LA 4HUTA 2XAUA 2GJ9A 3UT6A 3C3AA 1U9CA 2WA1A 3GT4A 1WG8A 2RDMA 3OE7G 4II7A 2GH1A 4WXPA 1UJMA 5BUQA 1Y76A 4P83A 4Y1RA 2QRUA 1V26A 4ZRNA 1WY7A 3JQGA 1CR0A 1JLRA 3TFOA 3A1TA 5JS8A 1VE5A 2Q8PA 3HBMA 5M2QA 1B8OA 3S2YA 2HUPA 3C3XA 3OMLA 5B2FA 4LS3A 1VMIA 5FR2A 3V3KA 3DE2X 1WBJB 3ASOB 2PTHA 4K05A 2PGOA 3LUKA 1AZSC 3WWZA 4X97A 3WBKA 4ME6A 4E5PA 2C1EA 4RQEA 4Z1VA 1NLZA 4UNSA 3E86A 4R3UC 4TZZA 4C05A 1EAMA 3TI9A 4Z7QB 3KTDA 4Y6RA 3NU1A 4CL2A 4F8YA 3K0GA 1B4DA 2W2LD 2X76A 5K20A 2IXDA 1TU3A 4N12A 4QO7A 1UBSB 4CV1A 4EPRA 5JAZA 3S8EA 4K26A 1JG4A 1TVCA 4ZHQA 1BMDA 3HR4A 1H5UA 1LI7A 2WHXA 4R1PA 4MV1A 1IM8A 4P93A 4E31A 1TW3A 1CWUA 2OM6A 4M1KA 3KDPA 2IYVA 3CCEF 5JLAA 4L9RA 4LCKA 2Y1XA 4DR6O 3V7QA 3CBQA 1U1EA 1NI8A 1FDTA 1ZJ5A 5KZMB 2DC1A 1OGIA 1WLSA 5CGQB 1YSCA 1H2EA 4CM5A 4YAIA 2C5EA 4Y0NA 4LVNA 4WACA 4TM7A 5FBHA 1S3JA 2YFKA 2EF1A 5GW7A 3DBHA 1GGHA 1JP7A 2ONYA 3DOHA 1TAHA 2OCCC 1QQ5A 3R9XB 3TECE 5DTEA 4BVKA 1ZPDA 2UXNA 2EX1A 3HLKA 2BTQA 4RDHA 5B4UA 2A0WA 3ZWOA 2I1VB 3LZDA 3MMZA 4G4JA 2GEJA 5K09A 3MFYA 3EB9A 4M1YA 2BCCH 3I9KA 1V6SA 4LWOA 2GLZA 3D3WA 2ECFA 1Z5GA 2D3TA 4MZXA 2WMYA 5FOWA 5FWXA 5AVKA 4TTQA 3SC2A 3IB6A 3S06A 4G36A 4KP7A 4N0MA 4E5NA 3CCSV 5AVRA 1F23A 1E4EB 3HJTA 3T1HO 5B1SA 3UG6A 2VKQA 1SUCA 3ZY4A 2FJUA 5EJ2A 1AA9A 3B9RA 5FBVB 4KO2S 2PN1A 3G67A 1E79A 1UKBA 1ACLA 4BPRA 1FUEA 4RYDA 3AM1A 3O8QB 2M2IA 2CFCA 4NDNE 4BLRA 2H8GA 4EHFA 3BKXA 1I4TD 3G6WA 3JRWA 3L7CA 1X13A 2NVUA 3BZUA 4EJSC 1G8GA 3LI2A 1OT5A 5I7OA 3B82A 5LP1A 5EZ5A 2JFBA 3TEFA 5GOZA 2B30A 1E7WA 3GRPA 3UOWA 4LECA 3GUYA 2QF7A 2CXXA 2VH5R 1C0EA 2JCSA 1RYFA 5K8UA 3L4KA 3FB8C 5C35A 1P9RA 2ON6A 4NEHB 3SS8A 1F4LA 3ASNC 1N2XA 5E6RB 4B46A 1AHHA 5IWCA 3WP0A 3UVEA 1TUBA 2PZAA 5IK2D 4IUDS 2CL5A 2VK1A 1B2LA 5CGZA 1UDXA 1Q0SA 3N3AC 2X7HA 3ZIDA 1OI3A 3TOVA 4F45A 4GR9A 3ILSA 2CZQA 2FDCA 4ZC1A 4BB9A 2YXNA 1KE1A 4R1TA 1DP4A 1ES9A 3S70A 5T5QA 4MV0A 5H1YA 3D2LA 1HG0A 2AR7A 5I5GA 3AILA 3GYBA 4PAQA 2FZKA 1D2NA 3AHHA 1BG6A 1PUXA 1ZD5A 3L6CA 2IOFA 2BBSA 1JSRA 1K5PA 1ZJ6A 2XDQB 1CJMA 5DT9A 2CJYA 3LP6A 4R6ZA 3D0KA 4ZJZA 1CXZB 5JSHA 2Q0XA 1NVAA 4P9NA 4KXWA 2WLIB 3BWMA 2LCAA 1TEVA 3P9CA 1Q3KA 1VCIA 3KZOA 3HN2A 4MITA 1EZZA 3KWLA 2A5YB 4J03A 1XNQB 2Z6VA 3W5BA 5FOXA 1AXRA 2VOEA 3IKLA 3PPYA 2JFYA 3DDZX 5HFMA 3LNCA 1ZKMA 5DEIA 4HDNB 2H51A 3VZQA 2YRXA 4ZC8A 1PQYA 1SQBH 2EFGA 4C03A 2J59A 1ZL0A 4LHYA 1KKMA 2Y9MB 5GADl 1PS8A 1WA8A 3LE8A 4S35A 5CLGA 1WLEA 2DHRA 4QUDA 4BQRA 1YULA 1AR5A 2ZRDA 4WN9A 1E9SA 3OOYA 1BX0A 4ASUG 4F3YA 1RMQA 1FXKB 2A1TS 1YDXA 4MGZR 4TL8A 1HQDA 4D4LA 1V3VA 1YVEI 3BPZA 1D3AA 4KQJA 3USCS 4HYQA 4B87A 1CJCA 1ZOOA 1JAHA 4YUXA 3LA8A 2WZQA 2GBLA 4I55A 2GFIA 5DULA 4UQPA 3DMGA 1XTPA 3TLGA 4JWKA 1H2XA 5HCNA 1TYBE 3C5VA 3CMEF 2GBOA 4AO7A 3QUAA 2Z3VA 1WUIS 3ZBTA 2YWRA 2X6RA 1XXHB 3HRHA 3HN7A 2GKOA 2H29A 1S3FA 1FQOA 2YFHA 1Y4DE 1XTUA 1KJ9A 1IUNA 2ZG6A 1F20A 2A4MA 4OHXA 2J9FA 1JDNA 1E5XA 4A0GA 2WG2A 4R40B 5IN5A 2C54A 4PPQA 2FN9A 4B47A 5IVDA 4J4BA 4KDEA 4LDRA 1RYMA 2GHTA 3IC9A 1TPZA 4DWOA 4CHGA 1U1CA 2Q0HA 5EYPB 3NDRA 4XD2A 4BIUA 1QGUA 1L4BA 4LWQA 1FTYA 2ZU0C 3M1YA 3KR1A 3HB1A 4KOAA 4LYFA 2VRZA 2H85A 5LJLA 4D9IA 1EZ1A 2GTHA 1Q1EA 3A6DA 1G16A 1BRTA 1CLUA 3FDXA 3CX4A 2PLRA 1JKIA 1C29B 2X0NA 4QXOA 4OL9A 4QBIA 5EIWA 1UFRA 3T7RA 5CB0A 4QIWF 1G66A 1RTTA 3GPLA 5ALPA 4R2IA 3A9CA 3A9VA 4S1TA 4RD2A 1H0SA 1IIBA 3CMEV 2QM7A 4QXAA 1OXVA 4G01B 4EEXA 5J59A 1N92A 2EINC 1SBQA 3WU2Z 4D6YA 1H2YA 4RA9A 3DEJA 2KG7B 3DZ8A 1I24A 2X1VA 5EKTA 4RUFA 3KIZA 1BJTA 3N6RA 4CTNA 2QUBA 1Z5NA 1II0A 3I5UA 1HORA 5IY5B 2WYHA 4OLBA 1DUSA 3HM2A 4L07A 3ANXA 2PS0A 4N03A 1D9XA 1R74A 4UTRA 2ZSHA 4JNKA 2ALJA 3F0TA 3KB2A 3FFXA 5LQUA 1ZUHA 3CX6A 1GZ0A 4NAUA 2AOTA 3FX2A 3DT6A 3KETA 3K70D 5LZ5A 2YW9A 4IIVA 3ZE6A 1N3YA 5IJ0B 2V7TA 3FBWA 2BGLA 1V4VA 3D6JA 3BTVA 4CZZA 1HM5A 2DE0X 4LOHA 5CBFA 3IO5A 4EJ0A 2BZGA 4QL3A 2EIJC 4B3MO 2VVTA 5ITZA 2QMUA 3RVDA 1G6UA 3T9CA 5J1TB 5THQA 1FX0B 2XF8A 3IQZA 3CRAA 3OEEG 2HYIC 3HBJA 3K6SB 3SEAA 1A8PA 3BPSA 4N5IX 3PTLA 3DSRA 3TW6A 5L7WA 1J90A 1N1GA 3K3PA 1NT2B 5BPFA 3KKMA 1WP7A 1LLCA 1FRQA 1Q95A 2WA3A 1RCUA 1GSHA 3C7DB 1BAPA 3F3KA 4D9JA 4GPD1 3ROMA 4J4TA 3ACBA 5E6UB 2JJ1A 1GSOA 2V74B 2GTPA 4HTAA 4BJHB 5JASA 3GWGA 1DUIA 4OV6B 1E2JA 4R7CA 2GR9A 5E4YA 2H6EA 3AQ4A 5JSKA 1XDUA 4OPHA 3DHVA 3ROTA 1JQ5A 4YJGB 3OTOO 1KETA 3MQ2A 2N75A 5CYGA 3RHSA 4C22A 5CFLA 2OO3A 3RIGA 3Q4GA 3M6WA 3OLCX 4ZVRA 2PFSA 2ILMA 5KMGB 2XAAA 2ZVZA 4PYNA 1LFAA 1P6QA 2CLSA 2KE5A 3PP8A 2VHWA 5I7HA 2VJOA 3VYSB 5IKMA 1RM4A 1RYNA 3MUFA 3EC1A 4IXNA 4U5XA 3Q8KA 1DGSA 3EGOA 5JCJA 4F71A 2RB5A 3PGXA 5JXJA 3ABOB 3NKVA 3IOEA 4MVJM 4EVSA 1JX6A 2VRCA 4K8XA 3WJ7A 1QHTA 1DOHA 4M6WB 3CJRA 3G8DA 4H7JA 5DHFA 4AZ3A 3UMGA 3QHQA 2IEIA 5C8VA 4BAYA 1IBRA 5LMUB 1C4WA 4YREA 1PR9A 3ZU2A 2D7DA 4MR7B 5IRCD 2CKMA 1ECGA 3EXHA 2BD0A 1QM5A 5E9JA 4Y2RA 1RSOB 1V2HE 1QU7A 3LIPA 1VP3A 4PI0A 1W85B 1RE1A 2FUG6 3HM9A 4KAXA 3K14A 5CFNA 1XHXA 1P2BA 2O3QA 1YQNA 1QFZA 2IYTA 3O1IC 1ZN9A 2W6QA 2L35A 1SEPA 2PI4A 4UDNA 4GLLA 4DPKA 1MDFA 3OZEA 1NVKA 4Q9DA 1O87A 2XT6A 4Z2AA 1PNOA 3SIXA 5I4KA 2ASVA 5FL3A 1XHZA 3GVCA 2AF3C 3EDQA 2UYCA 2JGDB 1UINA 3IURA 4JYPA 2WPDD 2QSUA 2J5RA 1PL8A 3ANTA 3T4XA 4IAOA 2GI4A 4L5JA 5IMBA 1RPOA 3LU1A 1LBSA 3PSHA 3TAHA 3QBDA 4IL5A 4RXTA 5K6AA 4HP8A 4MUBA 1ECBA 4R1UA 5L8VA 1NJIW 1E62A 4BEWA 4YP1A 4F7DA 2LGWA 1NR7A 5FRDA 5D00A 3NWEA 3UWOA 1YJNV 1SKYE 4PINA 1SBIA 5GAJA 1NJ2A 2DHDA 3GYGA 3AVPA 2X58A 2PTMA 3V1LA 4P22A 4G0MA 2C4NA 2RBGA 4GOND 2R97A 1W0JG 3OQ1A 5IFKA 3PNQA 3ZK9A 4YXFA 1W2BF 4CF6A 1C8BA 3I6MA 3QWIA 4BMSA 2AKYA 3Q7PA 3HY6A 3N8GA 1OAAA 2QWNB 2P6OA 4V0KA 3EH2A 2F3PA 4PX3A 3SIPA 2O3UA 3DZKA 3AVTA 1ORHA 4WMLA 1KYIA 2TMYA 1M76A 2RBEA 4JEMA 1WU8A 1RRKA 5GTHZ 1ODEA 1RBYA 4HFNA 4QHSA 1D1TA 4DV0B 3T3IA 4DRYA 1OWPA 2V6FA 1SHZA 3HUFA 1H3FA 1Q6ZA 2XDAA 3PE6A 3MBKA 4AJHA 3LCJA 1O6FA 1NF2A 3AC0A 3AUTA 2EW8A 1EN5A 3CVVA 1JBKA 4IS2A 5FULA 3AG2B 1QS0B 1VFNA 4WZBB 2AOVA 3ONNA 3PUJA 2JLBA 4KQEA 4RY8A 4B0PA 1L8OA 3A11A 1GZ3A 3DAGA 3QPUA 3TW8B 3UQ8A 3M7MX 1U7TA 4NJOA 5FWAA 5IZCC 4WKPA 3RREA 1G8FA 4Q1DA 4C4XA 1QVGF 1TKRA 3R3JA 4WSOA 1V25A 2XX3A 3LY5A 1OUMA 5JD6A 4MRMA 3GJRA 2FLWA 5CD1A 4O4JB 1GT6A 4MUYA 5I8PA 1W19A 4O3MA 2V0GA 4O2BB 2YY7A 3NRBA 3MWKA 4CQMB 5H5JA 4EI2A 3ELYA 1E6UA 5LWQA 4PRYA 3S1LA 1S72F 3LVFO 1EUZA 2P1RA 5JFOA 3P0EA 4HKTA 5EP4A 5AI0A 1WV1A 3IC5A 3PXGA 1KIAA 1QYDA 5IEJA 1JPVA 5JZ9A 2PAAA 2HV8A 5A4DA 1N6HA 3T1OA 4MI9A 1NBMA 2YV1A 1CEQA 4KPFC 4DIDA 4ERXA 4LRYA 4F4DA 2ZDIA 4DCMA 3AU9A 5IYZF 1WB4A 1GVHA 3D1VA 4LV8B 3ZJ4A 1E2FA 2VJMA 3O3CA 1MEEA 3H8JA 1PNQA 3AEIA 4LF7O 3HS3A 1P4RA 3PQ5A 2NUAB 1RFGE 2XEDA 3RDPA 3GDWA 2XYHA 3CTPA 3N2GA 2GBGA 4AFNA 2ZI7A 4YO7A 3BQNB 5EBMC 1R4AA 2R1VB 2Y1GA 3YASA 2CW5A 4AWAA 1H2LA 2N3ZA 4OOFA 2O54A 1JJFA 4GMXA 3D0QA 2ZSJA 2BLNA 1JA8A 4ABYA 1S2LA 4B45A 2VXBA 1P2SA 2QMZA 4RZ3A 3S0HA 3CNBA 1SVLA 1Q12A 1B6GA 2PWPA 4RY2A 4D0SA 1J0DA 1YFZA 2V59A 4ARBA 3TZQA 2JHFA 5IUKC 3QU5A 1H6DA 4A8JB 4Q16A 4M7OA 5BSEA 2WJHA 1E2DA 4Z86A 3SYOA 4QQ8A 4RV5A 3UMVA 4MVWA 5EAIA 3P9KA 1CJUC 1WF6A 4WHMA 3KEOA 4JKIA 4EUFA 3W3AD 2C78A 4E2XA 3TQHA 2PJRA 3KS9A 2XD9A 4UDXX 3NQ41 2GA8A 1ATIA 5G4KB 3KM0A 5D1HA 2A9VA 3U4MA 4V0ME 3SMVA 3G7NA 4P82A 1T2UA 4OPMA 3DTVB 3TMAA 10MHA 4L85A 2W2XA 3GCGA 5EWLB 3CF0A 2K4MA 4OVKA 5TARA 3IAYA 4CM4A 4XUEA 1MQ8B 2CNOA 3P20A 3VGJA 5FUYA 4EB3A 3ELBA 5A2GA 2Z5UA 1DAHA 4PF1A 3OJLA 1GXSA 5JFTA 3L1KA 3ORHA 3PC6A 2QA5A 3FY4A 2F48A 5BMVB 2FSPA 4GRAA 3K31A 2W9XA 3ZE7A 5BN1A 1CUYA 1VLLA 4G4SP 1JHDA 3LY8A 4IDHA 3A1CA 4EO4A 4XUGB 3ZKAA 1CUXA 3R7WA 4JYYA 2YFQA 2C3UA 2WIKA 1NS1A 3GWKC 4B4UA 1ISJA 4HPJB 3GD5A 4EENA 4KYIB 3FRIA 4QDKA 1XEXA 1TZ2A 5ALGA 1YT5A 4URWR 1M93A 4OA8A 5FUWA 1HOXA 1B1AA 1QIDA 5AK0A 4AZTA 5JDIC 4V1CI 1EGQA 4UBIA 2BKEA 4RO2A 1QOQB 3Q6NA 4O1IA 4YNBA 1PQPA 2QD2A 3C24A 4D97A 5LKRA 3OQJA 4KPUB 2XCLA 5L45A 3BMXA 1FFXB 3W4IA 3BY6A 4WERA 4HNTA 1LVHA 3NNNA 2ZYVX 1T8YA 2J46A 1KJZA 1FP6A 3EQ9A 4X3CA 4BMNA 1ILEA 4ZMSA 1M90H 1N6IA 1YIDA 1NR5A 1N2OA 3C90A 3AW9A 3O8OB 1XAHA 1NVWQ 3ORRA 1S2MA 4NVRA 4R0NA 3JV7A 1VQ8F 3LWQC 3RS4A 2JLUA 1NTRA 4TVKA 3ASZA 1E66A 4GEGA 1EJBA 3TDMA 2KQXA 1JMVA 3AR2A 4PA3A 3E9ZA 3AB3A 3W6UA 5YASA 3DO6A 5HXZA 4ARZB 2JLCA 2XKJE 3WHLA 4Q1AA 3DL0A 2YYAA 2NSHA 3ESAA 3V4SA 3DE4X 2QLFA 1HC7A 1TD1A 5LWHA 3VVLA 3FPIA 4JLNA 3KR2A 5THXA 1F6WA 2J7PA 1QGDA 5DT2A 3WGTA 2PLWA 2PVCA 4TLMB 2ONCA 3P2OA 3RIEA 2R8RA 1JPJA 2FFAA 7ABPA 5KYYA 4FGZA 1RLOA 4TYYA 2WJWA 2DB3A 1P31A 3ZD7A 4PAMA 4KFRA 2NO6A 1YDEA 1UEJA 2HWYA 5LMNO 4GZLA 4O63O 4XFJA 2GHIA 1PPJH 3EG5A 1K0FA 2OFOA 1NVVR 4RAIA 3V97A 1XA4A 3MJFA 5JOQA 4FLZA 1FNDA 3WB9A 3T7EA 3CJHA 1WXFA 3LDAA 3GLIA 1C8LA 3V8VA 1Q15A 3KL2A 4Q05A 3ZWDA 4LMPA 2HVJC 2BOCC 3B77A 4GH5A 3RUPA 1X74A 1NN1A 2D1FA 2UYNB 4V0QA 2O5RA 3TUJC 4KKVA 3TZEA 1BGYH 1GQRA 1OLXB 4HQ0A 1WAMA 3PDCA 2MU1A 1XEAA 1IE3A 4JJIA 3W6ZA 2YV4A 2VJPA 2I9PA 2OV8A 1WHSB 1FP7A 3QJYA 1ZC3A 4V2IA 2QK4A 3MCWA 1JBEA 4N21A 5EJAA 4HGZA 4OKNA 4ONEA 3R9KA 4TRMA 1XREA 2RFLA 3E8XA 3I9V1 3Q7QA 4D5GA 3KTFA 3ABTA 1YU6A 1KARA 3AG7A 2PZFA 3KJFA 1QRAA 3JQPA 2O3SA 2GN2A 1U1FA 1T6BY 5GJWC 1Y34E 4B84A 3IEPA 2NO7A 3L71H 1DIHA 2ZBUA 3WL6A 3QUTA 2R6CA 3RRNA 2GQ0A 2QE6A 3T3HA 4DRXB 3PA6A 1FUUA 4LJ6A 4DSOA 4DLAA 3LUHA 4C29A 9ABPA 2BZ0A 2CDAA 2FSSA 2L18A 1T9DA 2EJVA 4AQYB 4FBGA 4D4KA 1PNMA 1XJQA 4EB6B 1XHFA 1PF7E 3ERCA 1TFUA 4YMWA 2IHZA 1USVA 4PYKA 5BT9A 3E8GA 5HIKA 2ZB2A 4UMEA 4JAVA 1SS3A 1ZUWA 2Q6AA 1R15A 2AMFA 4R1QA 4JTAB 1I7DA 4NYMR 2JHGA 2ZCUA 4FLVA 3NIFB 2QAGA 3UPUA 3WLAA 1NVVQ 2YI8A 1G8YA 2OGUA 2J30A 3E1GA 4UBJA 1JHUA 2ZLBA 1XTZA 4IM7A 1Y80A 1AO0A 1YC2A 1IN1A 1VOTA 3STHA 3F3YA 2P7TC 3L6EA 3VKGA 3R23A 3PZBA 4Q4AA 3IV9A 3R3WA 3HEBA 4UBOA 4GWGA 2NV0A 4OYRA 2ZR0A 1OKKA 2DFKB 1A8UA 3R65A 1E3LA 4YLGA 4COOA 2YJ3A 4PYOA 2AG5A 5CA1B 2W83A 3JU3A 4B4WA 5KOJA 4CN8A 2GZDA 3THXA 1J7JA 1HT3A 2CE4A 1MO6A 4JLSA 4V0RA 4JB3A 2BMEA 2E5LB 3Q1KA 3PTZA 4BKRA 1E60A 2IWHA 3HVRA 5L3FA 4NV1A 3RFFA 3TNFA 2P90A 4MLCA 3WE7A 1BEUB 1SQ5A 1F48A 5A71A 1IK6A 1F8UA 2PUSA 1MNQA 2UXCO 1G9SA 1V1MA 1V11B 1KD1W 5FPQA 1VL8A 3M4YA 1Q7GA 2GZAA 4GCZA 5JCPA 4B8ZA 4JR0A 4KPGA 1KQFA 3EAGA 3MC1A 1IXYA 1MJNA 4XDGA 1JY8A 4P2ZA 3BRWA 3CONA 3I0NA 3TTXA 2H4FA 1TEHA 121PA 1CETA 3MNFA 4HEJA 2HREA 5ESXA 1SXJC 1W73A 2HM7A 1JKJA 3KZNA 4LF6O 2OQVA 3IEIA 1XK7A 1T3ZA 2O2CA 2HCTA 5DNUA 3K1JA 2QPAA 3MAAC 1OTYA 4K6KA 4JPRA 5KWSA 3UBTA 4PJ0Z 3MBIA 4L4RA 2AXPA 3AHEA 4G4SO 4ZVLA 1RI5A 3OU7A 3BXPA 3S7TA 3N7UA 5BURA 2GK4A 2DWCA 3G23A 2PZEA 3WFZA 4RU1A 3OUTA 4FSHA 5F76A 1M8KA 1Y5RA 2O14A 4GYYA 1TIBA 4R2JA 3W04A 4AY5A 5G4UC 4C6TA 1D1SA 4CKWB 3VNBA 1J8DA 2EZ8A 3SC3A 2HU8A 3P0IA 4MWTA 4CCYB 2HB6A 1A98A 1S4MA 1SA0B 3ZWNA 2QE7D 2AXTZ 5ADHA 3IO3A 4X20B 4ZT7A 3ILHA 4R1OA 4G8CA 2QVYX 4PLYA 3G71V 2JGAA 4HJXA 3JQ8A 4BWYA 5JNWA 3P71T 4DDMA 1DU4A 4R05A 2YC4C 3NGMA 2YY5A 4ZAXA 4I9GA 5K0CA 2GZLA 3T1YB 4Q03A 2XOKG 1W6UA 1BIFA 4OYYA 3AK1A 5B30A 5JNVA 1MX1A 4BJ1A 1PTJA 2HI0A 4L4ZA 3VOSA 1KOLA 4UATA 1N6NA 3VHXA 2UXDO 4OSOA 4TX1A 4GNKA 5H6QA 3FAVB 2BEUA 2B9ZA 1QHIA 2DVMA 4B71A 3H5WA 1ZZEA 4P34A 1KU9A 1LC0A 5G0VA 1KFEB 2Q45A 3OTGA 4AB1A 4CCAA 3GLHA 2G9QA 1S77D 3HVJA 1IUOA 4JTCB 3VDMA 2FYUH 3ZDFA 5I3CA 4BAUA 2I6GA 4KNYA 4HR7A 4UHCA 1P2GA 1IATA 1BH2A 4K9KA 5F23A 3ET4A 1P2UA 2YWDA 3KEFA 1I32A 2OIEA 3DWIA 4CYMA 3NTXA 4YJ2A 3EVBA 4P3YA 4G9BA 4G86A 3J7AC 3CLSD 4HZGA 3RT3C 2PSJA 1OD6A 3F71A 5CVDA 4UM8B 3G1UA 5CT5A 3ZIAG 1INLA 3GC6A 4P35A 3EN0A 4A92A 2NIPA 3RGWS 2C9CA 4LHXA 3VAAA 3A9RA 5J5VA 4WESB 5FL7G 1U2SA 4YROA 3WRVA 2OCHA 1AMUA 3IAS6 3UG7A 2ECOA 3KQPA 1UFOA 1ZQ1A 2WJIA 3FOBA 2NMUA 2HPAA 3RC1A 2QNRA 2ZUDA 1O3YA 4F6EA