5LXTB

Tubulin-discodermolide complex
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
428
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural Basis of Microtubule Stabilization by Discodermolide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 174
structure length 426
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5lxtB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5lxtB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5lxtB01
4O4IB 2R6R1 4X1KB 3C8LA 1RLUA 4B46A 5FNVB 4TUYB 5J2TA 3WGLA 1Z5WA 4O4IA 2R751 3ZIDA 5M7EA 1W5BA 2Q1YA 2RHJA 1SA0A 5JCOA 5KMGB 3HKCB 3N2GA 3ZBPA 5ITZB 2RHLA 3RYFB 3JATA 4EI8A 4DRXA 3JASB 4O2AB 4YJ2B 4X1YB 3VO9A 4EI9A 3JALB 3E22A 5LYJA 3WGNA 2XKAA 3JARB 4FFBA 2BTQA 4E6EA 5LA6B 5IJ9A 3JAKB 5EZYA 3WGKA 5LOVA 3RYCB 4B45A 3RYIB 5JH7A 4ZHQA 5C8YB 4IHJB 4O2BB 4U3JB 1TVKB 2XKBA 3UT5B 4I4TA 5C8YA 2RHHA 1OFUA 5J2TB 4TV8A 3UT5A 4ZI7B 5BMVA 1SA0B 1FFXB 4ZI7A 3N2GB 1FFXA 5CB4A 2GVIA 5MN4A 3JATB 4YJ3A 3VO8A 1JFFA 3VOBA 4DRXB 4O4LA 3CB2A 3HKBA 3E22B 5LP6A 5LYJB 5IJ0A 4FFBB 2RHOA 2BTQB 1W5AA 5IJ9B 5CA0B 5EZYB 5LXTA 5JQGA 3N2KA 5LOVB 1RQ2A 3WGJA 3VPAA 4F6RA 5CA0A 4X20B 5JCOC 4EB6A 4WBNB 5JH7B 4ZHQB 3JAWB 4X20A 4LNUA 3HKDA 4I55A 4WBNA 5J2UA 4I4TB 3R4VA 1W5FA 1FSZA 5MN6A 3VOAA 1W581 4TV8B 5EIBC 3RB8A 5BMVB 3RYHA 4DXDA 5KX5A 5CB4B 4HNAA 1TUBA 2VAMA 4O4JA 4YJ3B 5EYPA 1JFFB 4O4LB 4IIJA 3HKBB 4I50A 5LP6B 4KWEA 5IJ0B 5IYZB 2VAWA 5LXTB 5JQGB 3N2KB 5CA1A 4TV9A 4F6RB 5IYZA 4ZOLA 2Q1XA 4U39A 3ZBQA 4EB6B 2BTOA 5JVDB 4LNUB 3HKDB 4I55B 5J2UB 3V3TA 4EI7A 3HKEA 1W59A 3M8KA 5JVDA 5GONB 4O4HA 4XCQA 5LP6C 3JAWA 3RYHB 5GONA 1RQ7A 2VAPA 2VXYA 4X1KA 5KX5B 5FNVA 4TUYA 4HNAB 1TUBB 4O4JB 4X1IB 5EYPB 4IIJB 5KMGA 4I50B 3HKCA 4X1IA 5MN5A 5ITZA 3RYFA 3M89A 4M8IA 5CA1B 3JASA 4O2AA 4YJ2A 4TV9B 4X1YA 3WGMA 3JALA 4ZOLB 5EIBD 3JARA 5LA6A 1Z5VA 3JAKA 3RYCA 3HKEB 3RYIA 1W5EA 4O4HB 4IHJA 4O2BA 4U3JA 1TVKA
chains in the Genus database with same CATH superfamily
3RUAA 4OXYA 4WF9V 1X8KA 2HRRA 2Z43A 3D7RA 2XCOA 1DG9A 5ICFA 1UPGA 2XNDA 3A1UA 5K1PA 2UXNA 3IEMA 3ABSB 4HQLA 4NCHA 4WN3A 4GEKA 3W2GA 5TF4A 4HX5A 1M2HA 5EBWC 4LXIA 1RZ3A 4EVIA 2B5VA 1RP7A 3K70D 4NLLA 4IOLA 3STVA 1ZJWA 3L0ZA 3CCVV 1MVLA 1IBRA 3HCBA 5DM6V 4G85A 5LP6B 4MQBA 1NXQA 5DOZA 3R41A 3JYQA 4E88A 1M6VB 3NU1A 4FZ1A 4G25A 2EIKC 5CLQA 1G66A 4YP9A 1L8XA 4IIDA 5CT5A 2R84A 5HP8A 1APBA 4MQ5A 3A1DA 3THRA 3FPCA 3BK2A 3P0HA 4X71A 4X64O 2J3IA 3H99A 2IT1A 2WJJA 4A8JA 3HR4A 2HBYA 3V48A 1ZR2A 1DAPA 3CR7A 1SXJA 1E5LA 3RE1A 2FSVA 2FPXA 2OESA 2DR3A 2PCLA 1RHKA 2PLWA 4JLWA 4JWTA 5HUHA 3CRRA 3VR2A 5CCXA 4ALMA 5MGNA 5H3CA 3H1PA 2ZUVA 2XHBA 3AK2A 2NXEA 4M0PA 4DMKA 3CUUA 4ARBA 2ID4A 4REQA 3VZDA 4D99A 3OLQA 4LNUA 4BB6A 3ICXA 5KYWB 4YCDA 3QX7A 5IAGA 4NE9A 2O2YA 3F6PA 3F67A 3OLXA 2ZULA 1HO3A 3QELA 2PRYA 2OZBA 1EFCA 4GZRB 4Z7OB 1O89A 3IS3A 1G9TA 5BORA 2ZQMA 2VDNB 5CD9A 1LRLA 2EZ8A 4F71A 2BFCB 3D3JA 2V4DA 3TB4A 2QU7A 5AXCA 2CXOA 3LV8A 4BFYA 1VE5A 3MT9A 3MIIA 4J07A 3VNSA 3GLGB 3OTGA 4TXNA 1K27A 3N3AC 4TL6A 1TGYA 3EK2A 4I5SA 4N5IX 4UTOA 4Q3CA 3EFBA 2W9XA 2NO4A 3SZRA 1ZJJA 1GR1A 3AVUA 1NH2D 1AS0A 2FDXA 4FKMA 4XD7D 5TX7A 3RBVA 1TI7A 2K9PA 5KS2A 3PIDA 5DN6G 1FA9A 1SZJG 3GAZA 1ODJA 3V7WA 2ANCA 2VAXA 2P1RA 4M2LA 1X9HA 4GBMA 5FO1A 4W6ZA 3PX2A 5F2EA 5K2OA 3GJ3A 4R98A 3PTZA 4RULA 5E6SB 2FMFA 2GZSA 1ZCFA 4GYWA 4H33A 4MUGA 1SULA 2WP8J 2GDZA 4F04A 2P9HA 6ADHA 2AC4A 1M0WA 2I3DA 3OF2A 2G04A 1QHYA 5IZCC 2EULA 4DABA 4Q6BA 4UNRA 1T9GS 2VG8A 3UB2A 2WY2D 2C61A 1IQRA 1DAHA 1CZKA 4Q18A 2ZTLA 5JECA 4H17A 1RYYA 2PDAA 1ZVQA 1FFTB 4URUR 1BMFA 2NUAA 4LCBA 4BVHA 2Q3MA 3WQRA 3VNAA 3K71B 1NF2A 3BXGA 3D7KA 4HQFA 5LQUA 1G3RA 1FRZA 3KIPA 4WBNA 3PGKA 4F2HA 2C4NA 1N2EA 4MW8A 3K59A 3BAAA 1AD2A 1P2DA 3BCUA 1C0EA 1Y7IA 3OONA 2PWYA 5JVDB 4II7A 1CTQA 4NDAA 2G25A 1B73A 1EQUA 1G60A 2QTZA 4D9FA 3CRVA 5D3QA 2XH8A 2IJJA 4KQWA 4ISCA 3WFVA 4GECA 4M0FA 2JRIA 5I7WA 4AQYO 1GPWB 3FTPA 4YH1A 3ZXUB 2WTMA 4KLRA 3BWBA 4DV3O 4X6UA 3L6CA 4UDNA 3JQ8B 1FDRA 2C4WA 1XDCA 2JBAB 3OURA 3ZD7A 3ER8A 1ENYA 1GDTA 3NTXA 2WLLB 3QOWA 5CK4A 4DSZA 2Y0IA 1IXMA 1YZQA 4FMBB 2PWPA 3QSYA 4EDHA 3AUYA 3RHSA 4QUKA 2AR7A 5B1HA 1AR4A 3KQHA 5LYJF 3VU9B 9MHTA 1YK1A 1XBTA 4EYQA 3X1WA 3PGXA 2JATA 1KU9A 2WWGA 3GRFA 1JL3A 2HHHO 2JLWA 4UATA 4J9ZB 4HFMA 1Y8RB 3TUJC 1DFGA 3W9YA 5IUJC 3F90A 2Y4TA 2HNBA 1TCAA 2GHIA 3IR5A 2GRAA 4LRTB 1QK3A 1BX0A 3FFTA 1P4JA 3AHJA 2Z56A 4RA6B 3AG4C 2RCYA 2QG9A 4IFBA 2JIRA 1ZS9A 4NR1A 1CU1A 5F98A 1E32A 4AJPA 1XHOA 4DIFA 4AULA 1GPAA 2KB0A 4E4YA 5F3WB 1T25A 4MVMA 1YCHA 1QB7A 1QDEA 3HFJA 2QWRB 4RGYA 2FP4A 1EA7A 2X7RB 4QBFA 2AOVA 3BAFA 5JR3A 2WKSA 4QE7A 1QVWA 2GYWA 3DHWC 4CQJA 1BHSA 2VQ6A 4EO7A 2FPPB 1WW8A 3IBCA 1W9HA 3RJMA 3RIEA 4RM3A 1JSRA 1VTKA 1LK5A 2PKXA 3RLIA 4TTQA 1GA4A 4XBFA 3K6SA 3PUXA 4JOCA 3PXDA 4UZFA 2K2QB 3G89A 2EERA 1JKJA 4E11A 1ZGGA 4JZ2A 2ZBDA 3PQ6A 3QEJA 2QAGA 2OYSA 2EJTA 4WFAV 5IYZF 4EIWA 3C1TA 3LMEA 4AP9A 5C8VA 1SKYB 2H0QA 4YMTA 1Q17A 2J46A 1W25A 1A2QA 1KZHA 4YK7A 1QZ3A 3NK7A 1F2UA 2EAUA 4DN6A 2H85A 2E5LB 1YHZA 4O4JB 2AZ2A 5FBWB 1B00A 4OXRA 1MO2A 1K06A 1RM4A 2I3BA 3E81A 3U80A 2XT9A 3Q8XB 1J0AA 1D2HA 3MTDA 1ZVJA 5JSHA 5IAJA 3LWVC 3G6BA 3NHRA 4GYYA 4JBNA 2YXYA 3B9PA 2PE5A 2OG2A 5CFZA 2RHTA 3W1EA 4RTOA 3TPZA 1PO7A 2XR1A 5BNIA 5ITVA 3KWJA 1X0VA 1V8ZA 3WJPA 1PT8A 2QP4A 4PV7A 3EIHA 1W0JA 1KI6B 2QUAA 2WA1A 3HU1A 5AW4A 2VF5X 2PS0A 5EHGA 1RCTE 4IZ6A 2WHPA 1ELOA 1RWMA 2N48A 1ISJA 1USGA 2J7PD 1GZ6A 4WOBA 1WDLA 3RYHB 4HTFB 2MSWA 1R37A 3T0GA 4HDNA 4IL5A 2QTVA 5JV5A 1A9XA 4DJFC 3L7AA 1A2KC 3A6PC 4I6GA 4ZPXA 4NZNA 2OB2A 2ZT5A 1CEYA 1KMNA 1GZHB 4LFBB 3A26A 3QWHA 3HWSA 4MS1B 3D8CA 2UXBB 1JLLA 3AEKB 2B6HA 3BRWD 3WMEA 4X66B 2DQYA 1LVHA 4AUMA 2GLXA 2D6FA 2ST1A 5EIWA 1K8QA 3WQSB 3SDLA 3MGCA 1GGFA 4YP0A 1MFPA 4TMZA 2YVLA 1TW3A 5DNVA 3LNMB 1N9GA 4YASA 3AUTA 4S04A 5F7JA 1E7QA 1RYEA 1AJNA 4QGGA 3G1UA 1K7DA 2R7NA 2KBFA 2W6NA 3HLTA 4JCCA 1PV4A 1LJ8A 1C8VB 1Q6UA 3JCMM 3DE6X 4R8SA 4BVEA 4DE5A 3IUNA 2REQA 3KVNA 2FLVA 1AQYA 3HB5X 2YI9A 4Z1MA 3PP8A 2AN4A 4Q3LA 2YVQA 2Z2YA 5B1EA 1P0QA 1YNOA 1U2GA 2YVKA 1SPXA 2H63A 3RQIA 3AI2A 4BIZA 2NP6A 2JFZA 3G5MA 1JFFA 1Z25A 2R1VB 4YXWD 2R5FA 2PMEA 1DUVG 2A0XA 3QG5A 5LQMA 3W6ZA 4AY3A 3S81A 1P77A 3A06A 2W70A 3V7NA 1PW5A 5GANK 2WYUA 2IWHA 2D8AA 1AQLA 3H1FA 3E9QA 3GLHA 3PV0A 2V0NA 3IGAC 1H4SA 5EXSA 1QVGF 1SCBA 4ILKA 1V11B 1IZ9A 4PINA 1UBKS 4L15A 1UBMS 2VKQA 4FDAA 2VJCA 3VHXA 3SPHA 2CE4A 4IIBA 1OUMA 1V8FA 1MMMA 4KOAA 4JJ8A 1WEKA 1WB5A 2Q0QA 3BHMA 3FHLA 3V9PA 1RM5A 2GKGA 1P18A 4GPAA 3GMSA 2OHJA 4DSUA 1S9HA 3O65A 2VPPA 4DK1A 1TC2A 2ITCC 4QNNA 1XPOA 3ENWA 2IUUA 1GPMA 3FUXA 1K98A 5IAOA 4W7IA 1KP3A 1XLTA 1OCOB 3PNBA 2VHVA 4BX3A 5DHTA 2AD1A 4P3OA 3VPBA 4ZVQA 2JEXA 4BPRA 2X3UA 3V4FA 3TXQA 2PMFA 2ZR8A 5K1XA 1FSGA 3WYEA 1MOQA 1TO6A 3QQ5A 4RZQA 3HMKA 2BGWA 1PE0A 2OQ2A 4X00A 1JBKA 5AWFC 1WV0A 3DCJA 1J9ZA 4NENA 4Y30A 1DB3A 4YRBA 4A3SA 4FCTA 1WKBA 3G2IA 4GR9A 1IULA 1CQIA 1JMKC 3HWRA 3I9OA 3K0GA 4W8GA 3QEOA 5BR8O 5DBGA 3CPQA 2YQZA 3I4LA 2QZPA 3PJFA 2DHRA 2OEPA 4N40A 1P9RA 3U60B 3EPRA 1QK4A 4UZEA 1HYGA 2OHVA 2ZJ6A 2EC5A 1F51A 1JAXA 4E5VA 3VNRA 4B48A 4YRAA 2RHBA 4BT3A 4ESOA 1A50B 3EIQA 1LPPA 4YROA 2OXFA 2H2FA 1NU1H 5B7NA 5F2NA 1YBVA 5BR1A 4K9RA 3TN7A 2MU1A 4Q6WA 4M7RA 3AW9A 3Q4HB 3MTIA 3TRKA 1POXA 3ORRA 3VYTC 2HMAA 2Q8VA 3OETA 4QLBA 3RR2A 1K4MA 1JG2A 5J3JA 4AXBA 4YRMA 5DV9A 4LV8B 4XD7A 3D3NA 1TZKA 3WYCA 1Y8QA 2AEMA 2RJOA 3K5HA 1JEYA 1VECA 1VJGA 1DU4A 4IV5A 4YCMA 1P74A 1SH7A 1B93A 1V7CA 3BIXA 3OMLA 3RVPA 4EG1A 1SQXH 2AVNA 5CP8A 4BE7B 3DE2X 3TFOA 3EXG2 3FNEA 4ZBMA 3D5TA 3AZQA 3JQ7B 1G1MA 2ZPAA 2UVQA 2GXUA 4U9UA 4LJYA 1K63A 4RNCA 2Y1CA 2CXQA 4RSGA 1M57B 1KY4A 4LHYA 2QWPB 2UYNA 1KZ9A 5F2VO 4CQMD 4OIFA 3ZY2A 1QVAA 3WJ1A 2W4QA 4WZZA 4EGJA 3PFHA 2CNBA 2HF8A 2OK8A 4J10A 2CAZC 2B3DA 4N7JA 3HJTA 3DE7X 4GYCB 3W90A 1DKPA 3Q7RA 5JNUA 2WYIA 2C1EA 1OLUA 3PXAA 2EU8A 5AVQA 2B1QA 3OZBA 2HTFA 1U4OA 1YFKA 2ADPA 3HKCB 3WLQA 1E63A 5JBIA 4PA9A 2VA8A 2B98A 4RGBA 4HY3A 1EBBA 1UZAA 2P4QA 4UB8Z 4MKXA 4IV0A 3PEEA 3HY3A 3FX2A 1T3HA 3VYRB 1I14A 1X4TA 2QTAA 5A6SB 4RKFA 5CCDA 2X0RA 4F85A 1I80A 3GUHA 2DQKA 3DSRA 4FZ0A 5DGIA 1I2DA 2I7TA 1BOFA 4YQYA 1G18A 1M8JA 2C84A 4L5IA 2O1SA 3EZ7A 2PL3A 3UQ8A 1V25A 2BOVA 4AUKA 1SQ0A 4O3MA 3KYCB 1YJ9V 1M75A 1UC8A 5JXGA 3PUKA 3PQ7A 2Q21A 4O1HA 5EWMB 1RJEA 2NPFA 2AOUA 2HBQA 3LQRA 1E3EA 3K2IA 1DJLA 1OIWA 3PGJA 2Y1WA 3ZHXA 2V7TA 4INAA 4AYXA 4BN4A 3P3NA 4QPCA 5FI5A 4LPKA 4D8XA 5LU8A 3G0OA 2HPHA 2AHOA 4UCTA 1OHHD 2ZSUA 1N2BA 5SYMA 3EXIA 4DUGD 2X0LA 1N4AA 2QPOA 2YCBA 3GLSA 4RVUA 4FIPC 1RVV1 2GDJA 2N75A 1TQ8A 2BFFB 1CS0B 3RU3A 4Z3DA 3TIIA 5A1JA 2QEXV 1P5HA 5BN4B 1ODKA 3DHNA 3M6VA 1N6RA 4BGEA 1KDTA 1JQEA 2IC5A 2OGUA 2BAGA 3MPOA 1I3CA 1XA0A 5EIBC 4DLSA 5EJ4A 4DV4O 4MI6A 3EW9A 2HMYB 2Z6UA 3OTOO 2R0QC 4QQRA 4K6MA 2XADA 4RQUA 4QC2A 4EEQA 1VLQA 1YO6A 4S3MA 3PFFA 3ZKWA 3CIOA 3KEOA 4IXNA 1GFSA 4QNRA 3PN1A 2PUGA 4X3OA 2IJKA 3K53A 5IULC 2Q46A 3WSWA 2DMXA 5JXWA 1V16A 1NLFA 1PLLA 5GAPK 2HK7A 3TOCA 5KYYB 2FRDC 3WISA 1HV8A 2RDMA 2F67A 3D3WA 4B4KA 4G8JA 1JR3D 1W88A 3F7YC 1SA0A 1QYVA 2WV9A 2O8FB 1U3DA 2BTQA 3F71A 1KQ3A 1U2ZA 5G02A 1BKSB 1ZRNA 2BMEA 3SLGA 1XNQO 1P45A 1QJ4A 1Z34A 4NMXB 2ZXWC 4IMIB 1CR6A 5CDHA 1U31A 4OLJA 4FE3A 5BWCA 4ND7A 2QNIA 1KWGA 1BS3A 5T6MA 3PF9A 4N48A 3T7EA 4KFCA 2WSBA 2RJNA 3RTDA 4C7VA 4MV7A 4B74A 5MN6A 4H13B 5C53B 5AW2A 4ZMBA 4ZYWA 3NHFA 4NEGA 3E70C 3E9NA 4ANFA 2VPXA 2N0SA 3T1YB 4FEGA 1DO8A 3WHKA 4FNAA 4MGHA 1J8FA 2BZGA 2R68A 2ZT7A 5A6VA 4LY3A 3LRPA 1H38A 3HJUA 3UV7A 2GO7A 5EB0A 3SZMA 3DE0X 3HCAA 4S1VA 3U0ZA 1NT2B 3IHLA 5CLGA 4EKGA 1N7JA 4CKBA 2AEFA 3IVMA 3CNBA 4CH4A 2J7PA 1DINA 4DKJA 1ODSA 5IF3A 2IS2A 5DIFA 2AW9A 3COSA 5DI3B 5A7FA 3DCNA 4HFJA 1FFXA 2PQMA 4P92A 5H3HA 1Z45A 1ZUHA 4V1CA 4H35A 2IYLD 1E3TA 4A0SA 2WWXA 2W2TA 4C7OB 2H0RA 5DIZA 1D6SA 1YULA 1FUUA 1N2HA 3EA0A 3LS2A 3SJAC 3C87A 4AIRA 4HNRA 4ID3A 5GV7A 4NQRA 2IE8A 1MGOA 4DV2B 4ZQGA 1PD3A 2Q3BA 1AZTA 4ND1A 3DPUA 3IFXA 1QBKC 2QMEA 1UKCA 1H2MA 5J4HA 5C2JB 3FD9A 4U2KA 3BRWA 4JODA 4L4YA 3I2JA 3LM8A 2VIIA 4URZR 2QKAA 3RDPA 2BFNA 3BRQA 1ZYUA 2C78A 4KR6A 2RAFA 1RC1A 1BXRB 3OM8A 3ZHOA 1HE1C 3HYTA 3KOZA 4YMGA 3J80A 2R8EA 5KHLB 3NVAA 1BE6A 2Y0EA 1NVAA 4BLUA 4TQDA 3OECA 4CKCB 2FU5C 4IR7A 4MPTA 3OQJA 3O21A 3LZ6A 4RMHA 3N8HA 3ZLVA 4FOTA 2X6CA 3PUZA 3GQVA 1U5BB 5K05A 3A28A 2FUKA 2PUAA 1NTOA 3KR1A 1DEXA 5D01A 5JHGB 1Y7TA 3M5CA 2NVUA 4BT2A 2J0UA 4C5CA 4ARCA 3K2EA 1BVYF 2LGWA 3UHFA 1M1ZA 5CD1A 3WP0A 3U56A 4BZQA 1NTZH 3AHEA 3LVRE 4OAQA 2R6JA 1H8HD 2DPYA 4IH9A 2PVCA 2GZ3A 5KX5B 5DLEA 3JXEA 2PSSA 1T3LA 5LYYA 2FRVA 4I5EA 1HOXA 1MCZA 3AJ8A 5ALKA 4YXWA 2IBZH 3M34A 4NYIR 4HNTA 2PUFA 5IC4A 1ZWZA 3EGXB 3WGLA 3B6JA 3NAZA 3JPYA 4WE3A 3VPSA 5IYDO 1OC2A 1Z2CA 3TWOA 1JMYA 3NATA 3MD0A 3CHXA 3KL4A 1B06A 4QPJC 3UCFA 3COWA 1VQPV 3EOBI 2FZGA 4I9QA 1T9KA 4H7HA 1YTLA 1SUFA 4QTTB 5BMVA 4Q05A 3ZJ5A 1FL9A 2MW2B 1UK6A 3I30X 2YV2A 4B71A 3SBOA 1YC5A 4KAJA 1GRVA 1TCCA 3BL6A 4E70A 3F6SA 3HNPA 2Q4PA 4CM9D 4JAVA 1Z36A 3CCVF 3G2JA 3JQCA 3QMMA 5C5CA 3GYQA 3F6MA 1SG6A 1NNI1 2AWNA 4PWYA 3F3KA 1JQDA 5EGNA 3RC8A 2Q0HA 4M6WA 1KFKB 5AW8A 1Z6XA 3DTTA 2WUGA 4XPIB 1S8FA 3OQVA 4OBXA 1S6YA 3FZNA 2A1IA 5C8XA 1Q2UA 3L77A 1J8MF 3ZZTA 4UUQA 1W73A 1KDRA 3EDYA 2JLZA 4HNGA 1H3NA 4L8JA 2P78A 4N0DA 5LVAA 1KQGA 2QN9A 2X1HA 4FLZA 3STYA 1XCJA 3HBMA 1HR0B 3DGEA 2QIOA 4YT8A 5KTPA 4UEQA 1FTQA 3CYOA 1JHDA 4L16A 2WIGA 3U39A 3HI4A 3H5TA 4HAIA 4L4SA 1I10A 5G1OA 5KWIA 1VQ4V 1OZGA 1K8ZB 3O75A 2XXBA 3K58A 4NE2A 1Z4KA 4FZ3A 3ZHTA 4OP3A 1P5FA 5FYDA 2X0KA 3FLEA 3VR0A 2OAQ1 3SHWA 2WLSA 1G8SA 1EFVB 5EUBA 2QNBA 1PWEA 3DD5A 4NMHA 3V2UA 4UCFA 1TA4A 2ZJ2A 5FI0B 5J5CA 3ABKB 4B35A 4F91B 3V34A 1N2GA 3HCWA 4MS4B 5CPBA 3PCRB 3EORA 5LMUB 1MG0A 8MHTA 1VCNA 4TQUS 2Q1UA 2JCGA 4YRTA 1F0YA 2CV1A 4G8BA 1Z7WA 1H4QA 1EFRD 3AONB 5FLEX 4BU0A 3QPCA 2ETNA 1XBIA 4R8VA 1R4MA 2GZHA 1ZISA 2FZEA 3D8HA 1YRYE 1P3DA 2P2ZA 4B7KA 2YV5A 3Q98A 5KSPA 1HDEA 4G01B 3I6QA 4P5PA 5HIKA 1Q21A 5ES4B 1FEZA 4Q3DA 3BHPA 4PQEA 4N5HX 4RK5A 3FPSA 4PC6A 1BW9B 4LN1A 4NH4A 1MB9A 2WYWA 3O8QB 2MINB 3T5CA 1XRRA 2R6DA 2W8BC 4QPDA 4EVSA 1OH7A 1SWWA 1HW7A 2P30A 1P17A 1QO9A 1JHZA 2O06A 2PZBA 3DBRA 4J16A 2X6QA 1H2AS 1EGHA 2QLLA 4EHAA 2RI1A 3R0PA 2JIPA 1YHQV 1L9XA 4I14A 1PFUA 4QU9A 4MV4A 1FRQA 4RZ2A 3QVXA 1Y33E 4MUKA 3FB4A 5KHAA 4CQMA 1PI3A 1LDGA 2WLKA 4ZQIA 4E30A 4RVOA 2OUIA 3T1QA 1GV1A 5BWMA 2NNUA 2ZXFA 1U81A 4ENRA 2SECE 4OMCA 2NM0A 1VPWA 2V6GA 5CFQA 1KRXA 3B8HA 2EV9A 4FDUA 3ORFA 2JJ2D 3BICA 3ZLUA 3FNHA 4RTQA 3RT3C 3HUFA 3OAAD 3ORYA 3BE4A 1I6WA 2C5FA 3ECCA 3I39X 2UXDO 3PF8A 1SQGA 3KAKA 1PV2A 1SUDA 1EUCB 1GM9A 3QTBA 1WVMA 4BLWA 1S5HC 5ED4A 2XAFA 2XRMA 4H6VA 3RARA 4IUCS 4ZI5A 2AEJA 4GVPA 4ZT4A 3GD5A 1CUAA 1ZW1A 2I2CA 3QWAA 1G1XB 1ZCJA 1DEHA 1FX0A 4B6GA 1R8SA 3REQA 2ERXA 1C4XA 4DLTA 1VPLA 1L4FA 2IX9A 5AM1A 1QPGA 4B3XA 1XRLA 3P26A 1V1MB 3DOJA 1AMUA 1J0EA 1CQWA 4TRJA 3BA1A 2EIHA 4ND8B 2FAXA 3HZZA 4XB6B 1Z0IA 3PWTA 3UOGA 1Z0DA 2PKQO 2RAVA 3ROEA 1GWNA 3KYDB 1Y4AE 4R1TA 1V48A 4HZGA 3O8OB 4MRSA 2XXJA 3IAM6 3RVOA 2W71A 1UFYA 1N0JA 3WX0A 4FHZA 1OHHA 1QM5A 1WMEA 3DWEX 1SG9A 4DUGA 4E2YA 2RBGA 3KQUA 5F33A 4MOWA 5BQ5A 4ITRC 1J2EA 2VF2A 4UVHA 1Q3HA 1WQ4A 4XX0B 4J76A 4PICA 3RNLA 5KMGA 1ZMOA 3VYUC 4E09A 3NBXX 5K3FB 4AY4A 1P7PA 1FVHA 5EJEA 4P98A 3BYZA 4C4OA 4DV6O 1RHJA 4LJ6A 4M99A 4WPGA 4NMLA 3UFXA 1Q0QA 1JU3A 3AOEA 4N21A 1H0SA 1N2CA 2ZZKA 1VDZA 4ZZ1A 3LSYA 2D2EA 4K26A 1PLKA 4MW0A 5GGYA 2VK2A 5KQLA 3ONVA 2IS6A 1C9NA 2DPHA 4F3CA 1B1CA 2JB9A 1M6NA 1GO0A 4CE6A 3TOZA 3K6JA 4G0YA 1T34A 5I9TA 4I55A 3QXSA 1QFMA 4TV8B 1JR3A 1FXWF 3DGFC 2H5JA 4P58A 1QD9A 1FK8A 3PEYA 4QUBA 5TNXA 2KG7B 1ZM7A 3MT0A 3KPWA 1VYHA 3WA7A 2Y2UA 2JJ8A 3RFCA 5L7YA 1IQ0A 3NIWA 3EVEA 2ZDIA 1LF5A 1RM1B 1NBMG 2CDYA 1DF5A 5IY5C 3GD7A 2FSPA 2Q7EA 3JCZA 2NZYA 3HADA 4ZJYA 4LJ8A 2XMDA 4JVSB 3ZWKA 4K6OA 1MG1A 2AL7A 4EFDA 2RGWA 1M4UA 1Z0UA 3OUUA 2MHCA 2ZETA 1BWSA 2EZOA 5M2QA 3K73O 5TQ0A 1WCIB 2Z1NA 3LD9A 3VPHA 1OR8A 2QIPA 4DDWA 1JJAA 4Q3EA 5L4NA 1A04A 2A9VA 2XZOA 1JDZA 4U6NA 4PLGA 3U0OA 3L4JA 4BB0A 3GGJA 3REGA 5REQB 5GIOC 4U7NA 2E6UX 5F3DA 4O5AA 2NVBA 2AQHA 2ZRGA 2B1IA 4BBAA 3LUBA 2Q2NA 5AKZA 1OYOA 1EGAA 3AY7A 3W79A 4INOA 1G8AA 2H57A 1VH8A 1BE8A 1TUBA 3CVVA 4CI0B 3BTVA 1CQPA 4LFCB 3CJQA 3VQVA 1NP6A 1IDOA 4HAMA 3KP1A 1P5ZB 4OX9Y 2ZE5A 1ZC4A 3WGVA 2WFLA 2FQXA 4GRIA 1YI2V 3ED5A 2P6MA 2QQGA 3D1VA 3EVTA 1H2RS 5KTYA 3WAGA 3HDYA 4O08A 2Z09A 4BGVA 3JR3A 3OW2F 2GSMB 4JUIA 2HAEA 4LF4O 4RANA 2WLHA 5JJKA 3AJDA 2WB2A 4P3NA 2IAFA 2FG5A 1T1GA 3F4LA 1S8OA 3FYUB 1N3BA 1U2QA 1CG6A 4LF8B 5FFNA 3U7QB 1HMPA 3C3MA 4YTEA 2PGGA 3QPWA 1X7XB 4BIIA 3G13A 4EZBA 3CF2A 4ZEOA 2RK6A 4ZZ3A 1YZKA 1XD2A 2ZAIA 3ZEDA 2I67A 4ODIA 2L19A 4RDXA 1QIKA 3KLPX 5JD5A 1JJBA 1VQKF 5DCVA 3VC7A 2JRCA 4I9GA 4DCMA 4LRSB 4EQZA 3GAAA 1YZYA 4DR6B 3S3XA 5K6TA 2WFZA 3L7KA 4YRDA 5FOXA 2VSQA 4QYWA 4NCIA 3RT7A 5CNKA 3HJWC 5HZGA 2BFCA 2QI9F 1NVVQ 3KEMA 2XE8A 2C7PA 5FOWA 2P2DA 3GIDA 1D9XA 721PA 2LPMA 2UUBO 1G2PA 1L5NA 1CWUA 2H2WA 3GLGA 2EIMC 1PRYA 1K5DA 3DXRB 2J33A 1FNCA 2Z2KA 1Q14A 3SIRA 221PA 3ANNA 1RNLA 1QX3A 2Y1FA 1W47A 4NE7A 1H8HA 3ESXA 1E9SA 2Q6VA 3FCUB 4DY6A 1FOEB 3VO8A 3V4PB 4RORA 2HIAA 3CR3C 3Q3EA 1Y67A 4DZZA 4A1OA 3FSEA 1VA4A 4YO7A 4MPJA 4DXDA 4JI6O 2VWJA 4KNWA 4Z5XA 2FOIA 2KX7A 4K8RB 2Z1TA 5CAEA 1M67A 4HUQA 3AETB 2H4WA 2WF7A 1UZNA 4TRMA 4MHTA 1S2NA 3C2QA 1L7MA 2V7VA 3DS8A 2FUG6 3NBZC 4MUBA 5GZ1A 3ZWPA 1YKGA 3GC6A 3NFRA 1TC1A 1MJNA 4RD2A 3KR0A 4BX8A 3DBLA 3ZHYA 4MVQA 3AV3A 3EXEB 4CM9A 4YUWA 4S2EA 1GYRA 3RRFA 5EG5A 3WZLA 4KFMA 5CX4A 3SKYA 2O8DB 1G8MA 3EZXA 3A9CA 2RD2A 2VWKA 3EMKA 5D51S 3I9JA 3LA6A 2AZ0A 1HQYE 4NXMB 4HEHA 4ABTA 2B7BA 1PR0A 5DFAA 4HFRA 2XUFA 3SEZA 1KB9F 5AW7A 4FOSA 1WNTA 3VHQA 2VOJA 1S1CA 3PXEA 5JCZA 3NAQA 2QX4A 1QG4A 1S02A 1OAPA 1L3BA 4DSAA 4I0XA 2VNKA 2X14A 2ZQYA 1OVMA 3W77A 5L4LA 1N2SA 1X59A 2Q5HA 3ZZNA 4P7BA 5JVDA 3O4JA 1FJ2A 3A10A 3IEUA 2EL7A 3QLJA 4WWHA 3X1MA 3IVAA 3D2CA 4BV8A 1QIMA 2J59A 1YB7A 3V4SA 1T5EA 3TKYA 3D2LA 3QFSA 4YJGB 4IXTA 4TYQA 4K28A 2ZIVB 4D0GA 1W8IA 3M5PA 3F8SA 4RADA 4N0QA 2CBZA 4X7MA 4WXYB 1VMKA 1R6BX 2W6OA 4TZTA 4KQEA 2XSZD 1CY6A 4UNQA 1AKVA 4CTOA 1MJHA 2FHPA 2NUTA 3QVMA 2ET6A 1CD5A 2LGJA 2G5PA 1BMQA 2J9RA 4J3NA 2XNSA 3VVMA 3J80N 4RY9A 1QU3A 1O4WA 2B4RO 3VU9A 3WC4A 3OKCA 4KXNA 1ST3A 4GEGA 4HGZA 1E4YA 4LZZA 5CLFA 4GMKA 1EFRA 3MTBA 5GGXA 3ZNPA 1ES9A 2AUMA 4NAVA 4HLDA 4ED9A 1RCUA 3L84A 3O7MA 1B26A 1B6TA 1OWLA 3KFXA 2C9OA 4Y2JA 2PX4A 2RHRA 3KZMA 5C52B 4YN3A 4DR2B 2VHYA 4TYYA 1CVIA 3CR8A 4JU8A 2QTOA 5B3JC 3RC1A 1VIVA 4XH9B 2ZSBA 4JNCA 4AZTA 1FD9A 1P19A 4FI3C 3VCZA 3A4IA 1K7FB 1H6AA 5CURA 5EJIA 1OCZC 4Q7LA 5K4GA 1KVRA 2Q9BA 4RIGA 1LVUA 4EFLA 2BLNA 3I5MA 3K1AA 4KAFA 3HPRA 3D8RA 4LK3A 3AF4A 3SK0A 2GZLA 4TQAA 2E4XA 4NECA 4CV0A 1H2NA 5M34A 1SC5B 1JIIA 4IZOA 5A3SA 1OH6A 3M3HA 2ZRJA 2IYPA 4POOA 2JDID 2Z5GA 3LWZA 1U7TA 4NH0A 5C4IA 3MQ4A 2UZ0A 3K15A 4OFBA 3R0IA 3U4QA 1I7FA 2QPLA 1S3GA 3UG6A 1F4PA 3G2OA 2A9JA 5ES3A 1J22A 4U7OA 2VTDA 3W8FA 2RHWA 2AXEA 4JI3O 4ACAA 4I50F 2AMJA 2JJ2A 3ERNA 3BGVA 3GOHA 3OZDA 1PX0A 3OAAA 4D5GA 4BRWA 2ZSKA 4OVKA 3LXXA 2H59A 1IZ8A 4L9AA 4DTIA 1AHNA 4DUZB 1DFHA 4IDFA 1QHNA 4JI5O 1Q7RA 5JSUA 3E7XA 3GJ4A 4F1KA 4AI6A 3IIIA 4RVCA 1KP9A 3P19A 2GM5A 3VFDA 3OMAB 2WAXA 4OQYA 1LNZA 3UBMA 1UMBA 5LNK1 4MRPA 2NTEA 3I9V6 2X23A 4Q9DA 1KI6A 4OYHA 2PYJA 3DVAA 1DOZA 4OSPA 2WUFA 5H7XA 5FJIA 1UP7A 4NJEB 4JI0O 1U8CB 3SR0A 4HQNA 2GJ9A 1N33O 1RZRD 3EC2A 3ABOB 1X94A 5GONB 5BVHA 4KQHA 1U9YA 1NI3A 4HNAB 4XSGA 3TLZA 1YJ9F 1XHFA 1HDGO 3U44A 2CXXA 1D6JA 3Q7EA 4CODB 4ILEA 2LCIA 3P52A 5TMBA 1DBVO 3ZDBA 2NU9A 1CCWA 4NRDA 1T5LA 4K9SA 1T8SA 1NQUA 1O7JA 4ZHVA 4PLFA 1QF6A 3RO7A 3B6NA 1SOWA 3JW8A 1U7OA 1I5XA 3A9TA 1MNGA 2FPGB 2WZCA 2CNOA 4QASA 4CXMA 4QA9A 4PNPA 1JZSA 3TD5A 1ZZGA 1XZEA 1P1CA 3ZOPA 2K87A 5CDUA 3LX4A 4R1OA 4BNFA 4K9NA 2W6QA 2PJDA 4LOIA 2QEXF 4YR7A 3WYDA 1DDOA 2VJQA 4L08A 1PR6A 1Y3AA 3VZSA 1BDJA 3U9LA 3D00A 1WP4A 1IPEA 4Q47A 1NI4B 2OAP1 3LU1A 2QP9X 3ZUGA 5TY0A 2YHIA 1K7YA 1IVNA 4LFAO 5HF9A 3OFSA 1TMOA 1G8YA 4RE6A 4N6GA 1GTZA 3VR5D 1FRNA 3L8CA 2JHFA 3PD1A 2VK4A 2IEBA 4M83A 3B53X 3LA8A 5E7IA 1I0ZA 3E3LA 2Y69C 1JY8A 1R6TA 3JWEA 1ZXBA 3Q9SA 1V8BA 2A1TS 4CF4A 1NVUQ 2NZVG 4JYMA 1C4KA 4GC9A 1SDSA 4DR3B 4YMUA 3BCCH 1I4DD 2Q6KA 4NDNE 2GETA 3PDCA 3QVGB 4Z4FA 4A6XA 4NTYA 1W3EX 1XTSA 3BF7A 4Q93A 1IZZA 4XEHA 1YVRA 3CMMA 1O9BA 1SZPA 4LDJA 1WNSA 5FKJA 4G3XA 2XUPA 3OUSA 2GN1A 2QL7A 4X45A 4PNEA 1UEIA 1A9RA 1V71A 4G1CA 4BU1A 4OQPA 1SVLA 4G4SO 3ZNQA 4Z8YA 2PH7A 1IY9A 2I2WA 2Q3FA 4RVSA 3ZZUA 4LHWA 3M6XA 3PHLA 3CU5A 1CZRA 1T0BA 1SBYA 4QO8A 2YWDA 2JFHA 2QUZA 5AKKA 4H44B 1C2TA 5FNVF 3ZWCA 1G7SA 3UUFA 3L0CA 1PR2A 2W2KA 4G81A 5KOHB 1IEXA 1Y81A 3ZN2A 3KKKA 1I2BA 3LLMA 4LOLA 4MS3B 1HRKA 1OXBB 1R2QA 4YAEA 4HEA6 4KFRA 3TZBA 5BWBA 2LE0A 4BNJA 3LTNC 2V96A 1E2LA 4N8DA 5T4EA 4JI7O 3OQMA 3GP8A 2QYTA 2R86A 5JSZB 3E05A 1W5AA 1H66A 5K8UA 1J7HA 4EUEA 3FLAA 2H9IA 4JBWA 2OBYA 5FB3A 4F4FA 2OZLA 1LH0A 4ZI7F 4GXNA 2QTLA 4Q3OA 4WX2B 4DW8A 1FTSA 4X93A 3NWBA 2D13A 1F8XA 4DCGA 1YR3A 2J9XB 3PD7A 1FFSA 1T5HX 4GBED 2FWPA 1BTOA 3UKMA 1W49A 4TX1A 2J4CA 2BKXA 1KZ6A 1G291 1U2PA 1ODFA 1TCBA 1Z6AA 3DC7A 4LJKA 1KC8H 3CLSD 4QKQA 5J40A 3QFTA 5K6RA 4G4GA 1NYQA 2C9YA 2R751 4QSHA 3D6AA 4EJ2A 4A8TA 2AJ8A 1CXZB 1EFDN 5EIHA 4YJ2F 3L7DA 4X7RA 3LUPA 1EM8B 2GUGA 3CVYA 1KGDA 4H08A 3K16A 3GEEA 5IXYA 1F17A 1T5BA 4LXGA 1OAKA 4AO7A 2G36A 4LZLA 3S44A 1Q90D 1QR2A 1MU0A 3QPDA 3VH1A 5LOVF 2NZ2A 3OZIA 1TUIA 3K5MA 2VK1A 2OFPA 1AY0A 3EIFA 4Z0TA 1URFA 4URHA 1EP9A 5AOBA 3R9XB 1X80B 3TUZC 5JQGB 5EFOA 4O0LA 5I9LA 1V5GA 1K7EB 3SQDA 3TXAA 4MW5A 4RYDA 5KQGA 1S3FA 3GEMA 3G0GA 1II0A 4NMWA 3PA8A 2ZSHA 1ESCA 4HX9A 4HQRA 2O8CA 2H1WA 1J1UA 3VRHA 5E4YA 4IHJA 4BFZA 4B32A 1JDNA 4FR2A 4M0EA 5ARDA 1GPYA 1VPEA 1VQKV 3IBYA 3VIUA 3GFPA 5HHTA 1A9YA 5CVEA 4GFDA 3NONA 4MINA 4JU9A 3EXG1 1HDYA 5JPIA 3AGKA 3ZEAA 5CMUA 3C5CA 4NB5A 1RPAA 2FB9A 3CE9A 1A9PA 3UIEA 4IJMA 1VQPF 3VOBA 3IURA 2G0AA 1WUHS 4I1RA 3GFQA 3N2NA 1YASA 1Z06A 1YFJA 2DBRA 1OIVA 2A1UB 2H1RA 5DZSA 3ICVA 4I46A 1E1KA 1EVZA 4E31A 5ERYA 3B1XA 3IVXA 4UEWA 2QYOA 4EJSB 5BRAA 1RQGA 1O8CA 3BEDA 3IPRA 3BJZA 4KOEC 3WGUA 4B3RB 2GJ4A 4BKRA 4G24A 2QUIA 3I52A 1BIFA 3IE2A 1KFJB 3V8NA 4UOQA 3SHOA 3NC0C 5F35A 2AE1A 3BZWA 3DFMA 3V8RA 3V4OA 3A58B 1KNXA 3WIUA 4DR7O 4HVAA 3MWFA 3ZXYA 3ICCA 1E2PA 2O3UA 3RUDA 3QKSA 3ZE1B 1RYMA 4HADA 4KXRA 4MKGA 4IEEA 2WG0A 1TK2A 3C85A 3GROA 3A0HZ 3E7FA 3PYLA 4X41A 3P32A 1PR4A 2BEJA 4FHDA 1EWRA 5DM2A 4XVCA 4CDRA 2C98A 3LE8A 3TRHA 2GLZA 1C0PA 3PEVA 4NUTA 4N8SA 2X2PA 2KPOA 2X4LA 2AJCA 3TDNA 3W5CA 4FFMA 4JL6A 4UXJA 5JXIA 4MGYR 1VQ4F 3P9CA 2JEOA 2XOXA 2CXTA 2XSZA 4YMVA 3TEJA 4JR0A 3PLNA 3HKDB 1M2WA 1H85A 1W59A 4ZDWA 3KYCA 1H2BA 1FS4A 2YOGA 4IJ5A 2AOTA 3FLMA 4II2A 3RI3A 4G5FA 1CUGA 1CIPA 3W7TA 2WJ6A 1FF9A 3AFIA 5LU9A 3BDVA 2C2GA 1CV2A 3CN7A 1SCAA 1NULA 4MIEA 4U2CA 3W1VA 1Z28A 3A1EA 3NETA 4P4UA 1X19A 2ZZNA 3AESA 3BMNA 2OGSA 1VG9B 3ZGVA 2FEOA 5EHIA 3KJGA 2QTCA 2KKWA 2IQ5A 3MRSA 3QTTA 4R1MA 2JLUA 1WB9A 1NZDA 2AOXA 1OFUX 4BVAA 3LPCA 3NR7A 3G9ZA 3F5FA 2IV7A 1YCIA 1VFPA 2ECKA 3G6EV 2ISCA 3I23A 1XTVA 3OX3A 2PRIA 2DRIA 3C8HA 1PXWA 2DR0A 2OOKA 2B21A 4BP3A 4IXDA 2H5LA 1RJFA 3V4VB 3LVQE 4RLQA 3AERA 2EP5A 2OXIA 4BMPB 2VTKA 5FLYA 4RPHA 4NP6A 1SOVA 3GFTA 4OXKA 3KOYA 2P4HX 1K73H 2DUUA 2QVYX 4MVYA 1E6CA 2ID9A 4EENA 1MJ5A 3I58A 2HR1A 4DILA 2DPLA 4HNUA 2JDIA 3R5XA 3F46A 4ZMRA 2KSDA 1ZSNA 2J5RA 1YHQF 2XX3A 3PHHA 3SJBA 2X0JA 1W2HA 2V54A 4DCVA 4QO7A 4J0CA 4LV5B 3LYUA 1QE0A 4PG7A 3AF5A 5JAQA 4GPEA 4CN8A 1YTUA 5AXDA 2XOKD 2O2EA 1ZGZA 3BE8A 4C9BA 4F6RA 4P0PB 2Y9MB 2LRHA 3X1ZA 2NUBA 2GXQA 1SZXA 4B8ZA 3TBFA 3DZBA 1AUVA 4E5NA 5CB4B 1UWCA 1N5OX 5KAFZ 4YRSA 1KHTA 4FCCA 4AL4A 4CF5A 5JJNB 3GTZA 1WOMA 4RTRA 1TK3A 4ZT5A 2P8SA 3M0EA 2DBYA 3VZCA 3SJCA 4C3UA 1UQTA 1L7PA 4IWYA 1C4WA 2FWNA 2C04A 3GJQA 3NWEA 1R0YA 1QHSA 3STHA 1GSIA 1BU5A 4NOJA 2D1FA 4U2GA 1NBWB 3BMQA 2PS9A 1BYIA 1NT2A 4NI5A 5DGCA 1GG5A 1TVEA 1E3SA 2IYRA 4NFYA 3E9CA 1GN3A 3H1KH 3VH4A 2YFQA 4B81A 1C0IA 5DP2A 1RZRA 2DHDA 3S02A 5L3RA 2BUCA 4BBJA 3K9SA 3UAGA 3TRJA 4FLUA 1Z6ZA 4FYYA 5CJPA 5BV1A 4E2WA 4W1PA 5JWHA 4ZVOA 2WSSG 5GVSA 1SVOA 3N27A 2H92A 2HSZA 4HLQB 1G19A 2VQDA 3B1WA 4PA4A 3L0PA 3QEBZ 3RW9A 1HG1A 1GAEO 2ZVZA 4CDGA 2BSAA 1O97C 5CIWA 4NL4H 3DO8A 1DJQA 1T5DX 3RKRA 1T0UA 2Q2QA 5LGUA 1QORA 2HU2A 4I9WA 2D2XA 5DX8A 2XUAA 3I34X 2XMGA 3RS2A 5T7BA 2EJUA 4URVR 2ZANA 4WJKB 4IQ8A 2A9FA 1VSBA 1PT7A 3SS8A 3HXPA 4F38A 4RJ2A 4W9MC 2WG2A 3K09C 1LUWA 1OZ0A 4CTMA 2FFJA 3AL3A 4CKCA 1JSLA 4P4SA 2FPRA 2WUVA 1D2CA 5IX8A 3K70C 5ESXA 4Z7QB 3NPAA 3R8CA 1J7KA 3TSWA 3K6KA 1KPIA 1KKDA 5B30A 4C0SA 4XJXA 1UDAA 3PDWA 1U99A 1VIAA 4EKIA 4QTUB 5TF0A 2I6SA 2W2LD 1WCYA 4B75A 3ZWNA 4XIFA 1YHYA 4YR9A 1QFJA 2GKOA 4Q4HB 1A88A 3NRBA 4L8VA 2UVDA 3GYBA 1NVMB 2JHGA 4OJTA 3WJQA 4B09A 5E4TA 1SFRA 1PWYE 2QAJA 4HS4A 3A9UA 2VPIA 3TLAA 2FE4A 2FK7A 1G5QA 5GQSA 4QE3A 4W5NA 4ZDJA 1GO3F 3KL2A 1NBME 3GG9A 4RHCA 1J9EA 2AZMA 1JJOA 2OZPA 4DRYA 1UMDB 3DTVB 4LQLA 1GG8A 4J0QA 3C9RA 3MFQA 1PN3A 4KVZA 5CT8A 1NX6A 3H19A 2X86A 2XUZA 4UZSA 4JT8A 3QHPA 1KEEB 3II6X 2Z2ZA 3EISA 4X63A 2ZD9A 2C7VA 5TVKA 3PVSA 1PHPA 2IE0A 5EYPA 3BM5A 2OM6A 4QJ4A 2P6PA 4GMGA 4B5KA 4ZT2A 4LMBA 4TKUA 4IIEA 1QFYA 2HZ7A 1T2FA 5JYCA 2Q68A 4QUHA 2YYYA 4BXOA 3P4YA 3NJ8A 4G67A 3VXKA 4OXIA 3KO8A 3WHLA 2JFOA 3R9KA 2VSXA 1E60A 1YI2F 3R0ZA 2ZRIA 2LIVA 5F77A 2H54A 3Q8WA 2DHQA 2LTAA 4BNXA 1ORWA 1ECFA 1AKRA 1Q6YA 4RQAA 4QYTA 5DTQA 3H2SA 3KU1A 2IP4A 1REQA 4QYMA 3P2EA 5LBUA 1GTMA 3L9XA 1GEEA 3GZNB 2MSKA 2W2MA 1CDZA 4KO2S 3H7IA 3P9NA 1GV0A 4XDJA 4TQFA 4M0CA 5CLJA 4GUDA 1KDOA 3RKSA 3E8XA 2QXUA 2A0KA 1OLXB 2G88A 3I1JA 1P7BA 3HDJA 1GLNA 5HKKD 4KDCA 1MAWA 3ABLB 4IVNA 1E9BA 3FKSG 3L8GA 3CZQA 2GD0A 2FMLA 4UMEA 3EC7A 1VG8A 1C30B 2GS9A 2DYRC 1PEDA 5C3MA 1NP7A 2QSJA 5HNKA 2VYFA 2CBGA 2V03A 3Q0TA 2IP2A 5DN6D 3OM0A 4FVMA 5EA2A 2R7KA 2UYOA 4B84A 3TSZA 1U02A 4AIIA 5F52A 3PKZA 3UMRA 2GAAA 4LI3X 1DRKA 2G9ZA 3IULA 2ODMA 2HSGA 5EC2C 4MYHA 1PJRA 4YAKA 2FVXA 4ZVNA 5FUBA 1VXOA 3TECE 1OC4A 1CJTC 3VR3D 3OY2A 3A4YA 5C8YF 4JLDA 4K6GA 4Q37A 3V2GA 1X14A 3DXFA 1XWIA 2DECA 4ACBA 1DJMA 3ABMC 2H1CA 4MTGA 2EFGA 4G26A 4KU4A 3LCMA 1CUCA 1K66A 5L53A 3QKTA 3W7UA 3MYYA 3VHRA 2XUQA 4N76A 3HCPA 3EGWA 1Z3CA 1R4NB 2R1TA 3TAHA 2YASA 2AE2A 1UJMA 3UA3A 1C8KA 3H16A 4RH3A 1IE3A 2J9FB 5G0TA 621PA 1L7VC 1I5YA 1WX1A 3R5TA 1E0JA 4G6ZA 5A02A 1CJMA 2I6DA 5EC1C 1SG0A 1G55A 3R23A 1PD0A 1IUNA 2AFIE 5C34B 3D6NB 1FP4B 3QFCA 3JYPA 4DBLE 2WJZB 3FYIB 3FCOA 3R20A 1T9DA 4CL2A 3TLJA 4N9QA 2BYTA 5EUCA 3T4EA 1VJDA 3L82B 4PFJA 4IOJA 4DV7B 4DLUA 1QCCA 4PSDA 4XRRA 2DY1A 3KFLA 3KLNA 4BP8A 3G59A 3GLIB 2HJVA 5DCWA 4BGUA 2ACVA 1GZ0A 4D6TH 2YWHA 5ER6A 3K5PA 1M7GA 4U8GA 4DLAA 1JHVA 1EUCA 1AOXA 1QGED 1AO3A 1GQFA 4D5EA 2F3UA 4AZ0A 2VUIB 4V0KA 1HQDA 5DCYA 4PRYA 4RFSB 3NTVA 3OCCA 2BMDA 4MJXA 1E0DA 4RIFA 1I30A 2OMEA 1RWPA 2DYYA 1LB1B 1EBUA 1YU9A 3IUSA 4BNMA 4G63A 4P2GA 3VI4B 3ANYB 3LK7A 3BULA 4RK1A 3RC9A 3A1CA 1DC7A 4NG5A 4EG3A 3PEUA 4GYJA 3A7DA 1M56C 5AVJA 3D2BA 2DWQA 2CSLA 4M55A 3ORQA 3I72A 2Q67A 4IRUB 1NMUB 3WAJA 4DXAA 2ILMA 2GHTA 3NH9A 1C81A 2UU9O 1H05A 3UM7A 1FMTA 3RJ5A 2I8CA 2OV1A 1YJWV 3UG7A 2JIDA 3N87A 5SZIA 3O6VA 3DBVO 5I7VA 1CRZA 3J7AC 3MERA 1DQZA 1XKTA 3K9HA 4DM4A 1WD5A 1IMJA 1LXCA 1KYQA 3RT9A 1WIWA 3HB4X 1K33A 4KXYA 1SESA 3FA2A 3P96A 1UT6A 2EP8A 1W4LA 4JP8A 3SF8B 4JELA 3K9CA 3TLCA 4EGCB 3P2YA 2DWCA 3RVSA 1XRMA 3WMWA 2XA9A 3A6GA 1S4MA 1M1YA 1SHLA 2ZSAA 1Q0UA 1PL8A 4PHGA 4CQLA 3C8MA 4CI9A 3SC4A 5GPBA 2OB1A 4MIKA 1WEHA 1EN4A 5BQ3A 2CD9A 3RYIB 2OFFA 4MWCA 3ONNA 5JO9A 1E3MA 1EEXB 4PF1A 2F1OA 3U7EB 2AKAB 4BFXA 5HWEA 1SPBS 1QFSA 3VNVA 2F6RA 3IDAA 2E3JA 4ZV9A 1ZESA 2ES4A 4K6CA 3JYCA 3O38A 1Y3DE 4QD3A 5BW4A 2NSJA 4W7SA 2ZWAA 1WJZA 4A6DA 3G2KA 3WOHA 3GBPA 3OEWA 6REQB 2XOKA 2AA3A 2WNSA 1KPGA 2QROA 4LV6A 4BNDB 1DXHA 3D5QA 1L5HA 1G6OA 2IHYA 2JD0A 3K2BA 3A04A 3MBIA 1VCMA 3QLUA 1WCIA 3EGOA 3HUEA 2YINC 1XZJA 3ZJ4A 1YTFB 4PNHA 4AVYA 1J8YF 4AYWA 4M8KA 3UTCA 3WK8A 3F7NA 3GDOA 1I5EA 1EZJA 1X1RA 3LMKA 4EDFA 1CW2B 2WR8A 3OCVA 1DIAA 3UUWA 4YY3B 4G4YA 2QX7A 4I4TB 3H6KA 2FTKE 1SF9A 1N5MA 3RVMA 1VI5A 1NJ2A 3TI9A 1M0TA 4M8NE 1JJVA 5BY1A 4LF6O 3IUYA 4QDZA 2C0CA 1ZI9A 1XDSA 4ZAXA 5IAKA 4AD8A 1BMTA 1EBOA 1XCGB 5BSVA 3GF4A 5HJ2A 5JBQA 2CJYA 2GRUA 3WZMA 5F23A 4J3JA 1ZAUA 2PLFA 3WYGA 4CKEB 3FAVB 4JLJA 5J2TA 4KSBA 1M2FA 2E6KA 2BBWA 4O2AB 1Q20A 821PA 3U7QA 1EHCA 4ERNA 4YMLA 4D4KA 4Q20A 3LF1A 2BTEA 1ZN9A 2Q3EA 4HL6A 3N07A 4X65B 4JYBA 5JH7B 3W5DA 3NASA 1JFLA 2C1ZA 3ZE6A 2ZLBA 1PV0A 4BWAA 2BI7A 1LLCA 2HF7A 4PX2A 5CU7A 4D81A 2H16A 1K89A 3E0QA 2CMFA 4JYAB 3MBMA 4L07A 2ZBPA 5FAXA 3S7ZA 1A2OA 2EX1A 4X62O 4MUAA 4MDHA 5CXSA 5AUOB 4NU8X 5F21A 4OBWA 2IXAA 1H5UA 2TSYB 4UBMA 1QGAA 1N6IA 2W2LA 2GF0A 1K86A 4WKCA 5CT9A 3T5GA 4JBIA 4RZUA 3UJ8A 3ODPA 4XDYA 2WEKA 3H9JA 3BGOS 1H1DA 2QQFA 2XGMA 2Y05A 4CCWA 2V5VA 1Q8RA 4JL8A 3Q7QA 5COAA 5AVTA 4Z49A 1TM1E 3LC7O 4N39A 2WIBA 5P21A 1YRHA 4AB1A 1RPJA 3ZDFA 3WIDA 5A3QA 5TB5A 4Q7MB 4ALKA 3C6XA 4PYRA 4DV5B 1V8OA 2QUJA 3UY4A 4P3YA 3B3JA 1ABEA 2CFTA 2VHTA 3RJ9A 5IUNC 5D1NA 2VRWA 4L0CA 2YKGA 3N0WA 3R3XA 3DL4A 4GXRA 3OTWA 3PEWA 2ZROA 3E6AA 2VRZA 1G6HA 2G9NA 2HL6A 4NPHA 5TMEA 2NO6A 1W75A 2PS1A 5LJIA 3EXEA 1HNXB 3T3NA 3D6VA 2WJIA 4NYMQ 3ZTWA 3OIUA 2O7VA 4OXSA 1ML4A 5JDIA 1HC7A 3EZGA 3HZOA 1T43A 4C4PA 2Z2JA 3PT9A 1VCOA 4BZZA 4JXKA 2WAMA 5K3EA 4FUQA 3L6RA 2YX1A 3WBBA 2WG1A 2NU6B 1ONPA 3AR8A 4WCFA 2A84A 1VIBA 2NAPA 5ALSA 4A10A 5HW0A 2BM1A 4MTOA 1B2LA 5LXTB 3ILYA 3UJAA 1FMLA 2QHXA 1ZD9A 3OLWA 4UUAA 2XGGA 1Q6HA 5E7QA 1DAMA 3MCTA 1UJ5A 1GPDG 2ZR3A 3U7IA 3HUUA 4WOJA 3FPIA 3TL3A 3C4VA 2KW5A 2C5EA 3A6KA 2A9QA 1UXJA 4AF6A 2RE8A 1XJ5A 2OY0A 3NBKA 5HS6A 4L8GA 4UVCA 1SC4A 3HN2A 3PB3A 2D5IA 5HKKA 3H5NA 1YBAA 4IPTA 3VTZA 4CETA 4YRFA 1WW3A 2QBYB 3PPIA 2I4NA 3WB9A 5DN6A 2W6ZA 2C3UA 1CUSA 1OLOA 1DWPA 5LP6A 4LEIA 3VV3A 4LSGA 4AKHA 1M6VA 4A23A 1X38A 3TQCA 2AFIB 1PWXA 3UGQA 1NE7A 1Z5PA 2HPVA 1ILEA 3QA3E 1X7WB 1F1JA 4EW6A 1SCUB 5ESWA 4HMQA 1RR6A 4P6VF 2RAUA 4RDIA 3I5XA 3KLMX 4GDFA 3QG1A 3VR3A 2PAAA 4CEIB 2JANA 1WG8A 1IPHA 4BIUA 3UK1A 3B12A 2WOOA 5MHTA 3X1KA 1X9GA 4LW8A 1TJNA 7YASA 1XRNA 3O8CA 2QWQB 3O84A 4QNHB 4B6PA 4EI8A 1KMMA 1ZX1A 3M2TA 5CNMA 3KUCA 3LOPA 5KOYA 2VWPA 3K12A 5FPPA 2IH1C 4JEHA 3VI6A 2O0HA 5KYWA 1CEZA 1ODIA 4K9LA 1WHSB 1DRUA 5CFPA 1DL5A 2BJHA 2PX5A 4OK5A 1T0KB 4QPNA 3Q4GA 3PE3A 3R0JA 2E55A 3Q3GE 1FQKA 5CW1A 5E1OA 2B4AA 3TAXA 1FXVA 5EKDA 4L51A 2VHJA 5A5DA 1EFUA 4A2WA 4WJZA 4CIXA 1RAIA 3FNGA 3OCYA 3HV2A 5H6RA 3T9CA 3GDGA 2UUCB 2ZFUA 5BSMA 3UICA 1E2HA 4RJJA 2QGFA 2ORYA 4C6TB 1AXGA 3W6OA 4IIJF 2QPTA 2XJ9A 2P5OA 4QBHA 1SXHA 1NN5A 1DT9A 4GVLA 3ROXA 1U4NA 2A30A 4X8HA 5JARA 4WZBB 1R1MA 2PZGA 4K9OA 3UO2A 3Q6IA 5FDFA 1WUJS 4INZA 2AX4A 5F12A 3V3KA 5CLLA 1XTRA 2ZRMA 4R05A 3IC9A 3HR7A 4G8DA 1S2DA 5CH3A 2WAAA 4QDOA 1QKIA 2P2SA 3AG3C 4BUZA 1H9AA 4QFMA 2YIBD 2BMVA 3JATB 4M1WA 2EHJA 3CLRC 2QLMA 3P10A 3VH2A 5JLAA 5E6SA 1T0JB 4MUIA 1N1EA 1EEHA 2XYHA 3AOEC 1NG1A 1RRPA 3OHPA 3SZOA 4MIOA 3ZIAG 1QRAA 2AK2A 3CRCA 1MDBA 5AKLA 4Q9JA 2IYEA 3KYIB 1KI1A 1VGQA 1C9DB 4U39A 2CFRA 1M2OB 1IBKO 3A8TA 1U9CA 5AIAA 3IIMA 1PNMA 5GONA 1VSTA 3TQQA 5K51A 3AJAA 4UOZA 1I0HA 3O0TA 4RF3A 4F0JA 4GHWA 3I0MA 2HA5A 4R3NA 1R73A 4CG1A 1X25A 4P4NA 2J9ZB 2BDEA 4B0OA 2HK8A 4WVLA 3NOQA 5D2CA 2ZDIC 2QORA 3CF6R 1PM9A 4G0VA 1PFYA 2WTNA 2DWDC 1KEKA 4OQZA 2AYXA 2F48A 4QUGA 4GM0A 4DJ5X 3U4MA 3K30A 3DV9A 2OILA 3KVVA 4LC0A 2JG3A 1Z7GA 4EJMA 4MEAA 4BQSA 1R00A 3NHSA 1GNLA 2JS3A 3GUCA 4LAFA 5IAAA 3RIGA 4BO1A 3G6EF 1U90A 5BNFA 5FBHA 3OOSA 3O2JA 5KUTA 4B7UA 1CEEA 3MVEA 5DP1A 4B17A 2JI6A 4PIVA 4JHXA 4E51A 3TRDA 2FX2A 3IDSA 4PHHA 1CJCA 2YZ7A 3SYQA 2HHCA 2EFEB 3H1JH 2J07A 3JQ8A 1L7NA 2JBAA 5ETJA 4QXPA 2WLLA 4BFLA 2WPDG 3OJCA 1I5OA 4X1OA 4PW0A 4OHOA 2FE1A 4YAIA 4E22A 4ETWA 4DW0A 3U3OA 1V55B 1J97A 3DDZX 1H65A 2FGKA 4OMFG 2G9UA 1A71A 3LZDA 3F6EX 2WA2A 3AF6A 5I4CA 1J56A 5KKNB 4BC0A 3G9UA 1Y8RA 3RSHA 3GRZA 1J90A 2ZI7A 5IFKA 3BX1A 4Z1OA 3OPNA 5F1KA 2VGNA 5IM4A 4RA6A 2VWQA 5I8PA 1D6MA 3LP5A 1Q1EA 3MMNA 1HL7A 4KLNA 3ENQA 2O7NA 3GJ6A 3UWKA 4E2FA 3FRHA 2XUDA 1ZN2A 4RDHA 2KMLA 3AW8A 4OHRA 1CB0A 3DTVD 3GGPA 4WY8A 3G80A 3FCEA 1AA6A 1LTQA 3QVNA 4LYJA 1Y3HA 2I87A 2BGRA 2PKEA 4J0HA 5CDSA 1SIUA 4GE3A 2FPPA 3W5SA 1P80A 4Y6SA 3QX8A 2HA0A 1N32B 2IHKA 3LSUA 2XNJA 4DUYO 4G4ZA 1MP0A 2FSSA 5DDIP 2Y0CA 2I6FA 2GGSA 1M33A 3S2ZA 2H51A 2YWJA 1XDWA 2VLBA 4FDVA 4FFPA 5HK9A 3R5HA 4I36A 4KRXA 4JJAA 2IYFA 2A9PA 3U7HB 3ZO8A 1KR2A 1YJ8A 4MQMA 2FPLA 3GLQA 4F4LA 2WJ3A 5EXPA 2WMDA 2HF9A 4O4JA 5CM9C 4NSNA 4UJ3A 4WCEV 1SKMA 2AYYA 3QMPA 1GA1A 4I8XA 2MR5A 4GWGA 2XRYA 3LWPC 5E0OA 1KAEA 1E5QA 1MV5A 2ZS9A 4ENWA 1XQ1A 4R6WA 2VT6A 3ELUA 4KYIB 3DNMA 1Y8AA 3W6NA 1SEVA 3H65A 3WPXA 1AV6A 2FOLA 4RTPA 1ZA1A 2XYVA 4C3ZA 2OIEA 4NC9A 2G17A 1NLYA 3AJEA 4A5SA 5EERA 4TUYB 2B4YA 1NKVA 3IQWA 3ZWBA 5B1YA 1L4LA 4PCLA 1IXBA 1CXZA 1NVKA 4ALLA 2OXCA 1V8DA 2UUAB 1B2RA 3SOZA 3C6MA 4M4SA 4YPVA 3EZFA 4PO8A 1HMYA 1G64A 5LD2C 1HE5A 4D3DA 5JATA 3LX6A 4NDZA 1T1JA 3ZIUA 3WJ2A 1N0VC 3FE2A 1L5GB 3BILA 4GM4A 4FKZA 3RYHA 4HTFA 4QEKA 4HK4A 4HZUB 1NAIA 3K0FB 2Y0DA 4H4CA 2R8YA 1U0JA 3KSMA 1SCJA 1NW4A 1WSDA 1U2DA 3KLBA 3D8NA 4MVCA 1KVUA 3G1WA 2FI1A 1PAUA 3UO8B 4FSDA 1BOOA 5JDCA 4ZK6A 3G23A 3BXZA 1Y48E 2HWKA 5H0IA 1ZTEA 2BGIA 1VF6C 4MS1A 3N2EA 2O2IA 5ALUA 5C80A 3U3RA 3AEKA 1DHTA 1LK7A 3IR7A 3T5PA 3ZE7A 3LW8A 3IBGA 4KPUB 2OC9A 3GA5A 4BMZA 3AF3A 2ZSEA 4C0XA 4O4IF 2AR0A 4I6EA 5LBTA 2XW6A 3L4EA 1D2RA 4IRMA 2PZMA 4J0KA 4Z53A 3INNA 2CV2A 3JAMM 2GZRA 3M6MD 3V2HA 3S55A 1Q82H 3C9UA 3C3AA 3E1YA 4QVGA 2J32A 1O8BA 5EWJB 4RCYA 4CR7A 3MAJA 4DLWA 4AY2A 2F95B 1G0NA 3M6UA 3KEFA 3I53A 3QYJA 1R5OA 3PQCA 1NDUA 3GJSA 2CF6A 3C41J 4P2BA 1VQ5V 3CC7V 1Q7BA 2C77A 2PHZA 1J24A 4MB6A 2NV2B 1VE6A 3KZ1E 1DP4A 4BNKA 4MPRA 5GM2A 2A5YB 5B4TA 2CJPA 2QRJA 4A8JC 3GYGA 3EIEA 2YXHA 1ND6A 5M7EA 3HNRA 3VSCA 3PHBE 2NZJA 2KQXA 1SXJC 3LBHA 1JYEA 4RHEA 2R1VA 2QD1A 3ZNNA 4K3AA 4GE0A 4XWOA 1ZRSA 2FSVC 4FQ7A 5BMOA 2WSIA 5PGMA 3ZU5A 2PX8A 4QLOA 4P33A 1K8AH 4BB5A 4D74A 4KIJA 1PKXA 5HBRA 1U9IA 3SR2C 1DARA 3OSZA 4E7OA 1Z8FA 1Q95A 3JVEA 1VMEA 2PIAA 3HDHA 5HM8A 3UPUA 5LZ9A 1V11A 3B6MA 4E5PA 3UWPA 3FNQA 1PNTA 1ECGA 2ZRDA 2Z01A 5K0BA 1GUBA 2AI1A 1FW8A 2OV4A 2Y9PB 1X7ZB 4DDUA 1P6UA 6CHYA 3NYQA 3D5EA 2R9IA 3CFYA 1KO4A 1OTXA 1FNSA 2HTEA 1MX5A 1YZUA 2RIPA 4R84A 2F9MA 2GLTA 2ORWA 2QVLA 3P9PA 5BV7A 2WQZA 4LHEA 4QVKA 4Z99A 1CN7A 1JSZA 2IH4A 1RP3B 3QF4B 4CMIB 3NVKI 1NFFA 3Q8KA 3DEZA 1T9BA 2F64A 2NOAA 5DGTA 2DCMA 4KWTA 3TYXA 5JJBA 3HSKA 2GEJA 1W30A 1M8KA 1E1LA 5ALMA 1SAYA 5I9IA 4Y2YA 2RHCA 2I78A 1GRJA 2BY4A 2W2OA 5ADUS 5IU6A 4MQFB 2MSEB 3KETA 3IC7A 3WLKX 4B31A 3UJ9A 1ANKA 1RI3A 4Q00A 4S1TA 5JAZA 3GBVA 1Z5NA 2X4DA 2INGX 3BRSA 4QXRA 4P8RA 3AVVA 4GMDA 1E1QD 2ZOVA 1YT5A 4YC7A 1NQVA 5JUWA 1KP2A 2O23A 4B34A 3AEQB 4CIVA 5LBIA 4BY9E 3T6KA 1AK1A 1EWKA 2QN8A 2G9QA 3W2TA 5TQ2B 1YBMA 2P9TA 2VH5R 2WU1A 4LH7A 5HKBA 2LUOA 3QF7A 3VGPA 3BAZA 5JJCA 3Q4HA 5DHQA 4AZVA 3VJKA 3REFA 2NU7B 5KA5A 3AUKA 5IT5A 3LY5A 2FA9A 4G28B 1V6CA 4L6AA 2VP0A 3TRFA 1GTSA 4BNLA 4EI2A 1Q1ZA 4UTNA 1GUZA 3C14C 1CUHA 4RAQA 4EHLA 3F5DA 4KP4A 5CA0F 5TV2A 1ADFA 3IKJA 2UYPA 1L4EA 2X6AA 3WIEA 1R6DA 4AMYA 3PQDA 3P20A 3PC6A 2A5GA 3JZFA 3DFKA 1RHRA 2B92A 3COPA 3OMIB 1UXOA 4I2VA 5JIBA 4TV9B 3VTFA 3ISVA 2VUHB 3JQ7A 2R48A 4QRIA 3UOAB 3E7PA 1NYRA 1MC1A 4WLVA 4EYEA 1XXHB 4TMKA 1E1CB 3EEFA 3EZ9A 4RHXA 2Y27A 1ADGA 1IJFA 4M0LA 4MKHA 4X60A 1YCFA 4YAUA 1X1BA 1IXKA 5IWAB 1V5EA 2E4VA 4TMXA 2FN7A 4DIMA 1NXOA 4E1VA 5EE9A 3RGGA 5CB0A 1F8UA 3NUGA 1P60A 5C7IO 2EIJB 5K0JA 1GM8A 4UVAA 4UHFA 1DX4A 1XF9A 4OH1A 1RQLA 3FPFA 4M0MA 1YJWF 1NVPB 2EKPA 4P7GA 4JT4A 1T6NA 2H3EA 3DMFA 3GLFB 1R9NA 3FLBA 3HB3B 5ITSA 1CVRA 3UXYA 1MO3A 3JQQA 3JU3A 1NSTA 3IP9A 3HKCA 3PGVA 3AH8A 3UJNA 2ZCVA 3F49S 1DAEA 4XYGA 1RCFA 3QUWA 2B2XA 4ZCSA 4BMOB 4M9ZA 1BNCA 3E5MA 5DHPA 5B2FA 7AT1A 2RQ6A 1KDPA 2XWQA 2DFPA 4L4XA 3GRPA 1PU2A 4HQKA 4GI1A 2Y77A 5A6SA 2RAPA 1EK2A 1CNEA 1DELA 2IA5A 3HG7A 1ZUQA 4MW6A 1NBMD 1I1NA 3GLTA 3MRVA 3L05A 3D64A 2V6FA 4M0KA 2OPHA 5KHGA 3G0CA 2G1UA 3RABA 1CS4C 3ESAA 4EGSA 3RSFA 1I94B 1WXWA 5IT9M 5EWMA 4IYHA 3EJWA 3EARA 3GLIE 4G5OA 1XUOA 2JBHA 3R9IA 4TM7A 4Q4HA 4ES6A 3SMQA 1CUUA 2QAGC 4LF7O 1LBQA 1T5TA 2XMSA 4Q9IA 3OZXA 2AG6A 2QD4A 4LIPD 2FPKA 1RJWA 3AQIA 4CLRB 3C6ZA 6LDHA 4KO8A 1XFAA 4BVQA 4WFFA 2ZYDA 5DMHA 2BFFA 1CS0A 2FR0A 1VMAA 3T34A 2O2DA 1RI1A 5BN4A 3OBIA 4B4WA 2P9BA 2HA6A 2P9ZA 1X7PA 3QVKA 3OMXA 5CEFA 3BPZA 2A59A 2OLJA 5SYAA 3DTVA 3O91A 4FBMA 4FD3A 4URXR 2YW9A 4AYTA 1SKBA 3LHKA 5KNDD 2OO3A 1TO1E 1U1EA 2WA4A 2BRUA 5LMZA 3TM5A 4D97A 4TLBA 4EYOA 4B7AA 4B4UA 5HY4A 4IILA 2HPZA 3PCXA 3LFHA 1JJ7A 3ZCSA 1FTWA 2J3JA 3T99A 3U4AA 4E07A 2O4UX 1FIUA 3FDJA 2NO9A 3J7AU 2DERA 3ZY3A 3WQQA 5KYYA 2QMQA 1UJBA 1NBOA 4XYEA 2EEPA 1QQCA 3H1IH 4W9RA 4Y1FA 4XIYA 4Q9NA 2A8YA 4G09A 1HTTA 2NZUG 2PZJA 3KTDA 4HRAA 4MHSA 1E58A 2O8FA 3K8YA 1PZGA 3EUAA 5JPDA 5SY6A 4CYMA 2CXRA 1HORA 1ID8A 1VK3A 1OASA 3UV3A 1J2YA 4XUGB 3H18A 3FPEA 1WXHA 1LDYA 4CJXA 1GGKA 1U2EA 5TS3A 1GU1A 4N7RA 4BJHB 5LDGA 2Q2OA 3CHYA 4J7AA 5JZBA 4BTVA 4D3YA 5JWOA 3UV6A 3C43A 2R87A 1DPFA 1TECE 3D4NA 4WH0A 3HP1A 5THXA 1SK9A 5CVJA 2QL9A 1DKOA 5I7AA 4FLVA 3ZD6A 3BHIA 2EFYA 2K7ZA 2C7OA 1TA9A 4UHJA 5AJHA 3ESQA 3V1KA 2X5OA 3E1SA 1D4OA 1T26A 2OZVA 2FW1A 2IHZA 3A4LA 3R66A 2RH9B 3QIVA 1TM4E 1C30A 3LBYA 4K9MA 1XN4A 2JL1A 1Y5NA 2A35A 4RHAA 3VC1A 3W5IA 4P36A 1JXMA 2W0SA 4CZZA 1XU7A 2SKDA 5HKOA 3GO4A 1U2SA 3NC4A 5DI3A 4YDRA 5BUCA 3FX7A 2PJRA 5I4KA 3LWOC 2IJHA 4RZHA 4C7OA 4JI1B 3HBFA 1TF7A 3BSWA 2W93A 2LJ2A 1U2GC 5EJMA 2X2OA 4F6CA 1GN4A 1Q50A 1E7WA 2YBDA 2RI6A 3PITA 2BKLA 4DJDC 1N57A 1BVRA 3ZJVA 2YC2C 4ZHQF 4AS3A 2QM0A 2ZI3A 3SIWA 2IYAA 1QGOA 1KQFA 3MJCA 1JPJA 4ZGGA 1Y6FA 1XU9A 1XJWA 3BVOA 4KQ2A 4G2TA 4LI0A 1WVGA 4LBEC 3U62A 1CIVA 1NOKA 3B38A 2RHDA 1BXRA 3AP1A 4EFBA 3PLAE 4GP6A 3TOVA 1FS0G 3ETEA 3DKIA 2C57A 4ZRDA 4UHCA 4QYSA 1ZN7A 4B4OA 2RGEA 4PYLA 1GZUA 3EXHB 3GU3A 2JGMA 1ZSPA 1U5BA 2WJWA 4HPXB 4K46A 3RVBA 5FWYB 3ABTA 4S2UA 1SB9A 2VDPB 3JCUZ 5GY7A 3VR5A 4LWZA 2F55A 1NQ3A 4R8MA 1ISPA 1Q5PA 2H65A 4NAUA 2JGIA 2PX6A 1NC3A 2H2DA 1EP3B 4DEXA 1DT3A 2E18A 3MN1A 3EPLA 5TIIA 1QU2A 4Q1AA 4BX0A 2CW5A 4H7IA 1DTSA 1GK9A 2Z58A 1W5FA 2NN3C 2BKAA 4C6HA 1DADA 1KMIY 1XLTC 5KX5A 3PUJA 1E2BA 4YJ3B 4DS3A 1AKMA 2IBMA 2V0GA 5AYVA 3HWUA 2EKLA 4BVBA 4JZGA 2BHTA 2IODA 3ER6A 1SERA 3RANA 3EGXA 2CHQA 2QTFA 3FDIA 5AKJA 5JRZA 3WMGA 2ZRFA 3NVKE 2X4IA 2P4EA 4B6EA 1E5DA 5BUQA 3DLPX 1WZUA 3GP5A 2QDKA 3M99B 4MV3A 1QRSA 4DRZA 3Q85A 3OLVA 3B8EA 4X8MA 4KACA 2WVHA 2Q0OC 3K9BA 4N6OA 4QJ3A 4GIBA 4AMUA 5JAUA 3EQ8A 2FSFA 1Y9EA 3A7EA 4M9QA 4O2BF 1OFUA 2I7XA 2O4CA 3T3PB 1JMVA 3BHNA 4LMRA 4HXYA 3OP1A 1U0BB 2XXAB 1I8TA 4BO4A 4P4TA 5CDFE 4E4RA 3PNLA 4ZN6A 2APJA 1Y4SA 1R3JC 2IDJA 3DZHA 1JFSA 3SXUB 3SVZA 4REOA 3HSYA 1VG1A 1K5HA 4LDQA 2IYXA 1FFGA 2JH9A 3IUPA 1Q57A 3ZOKA 4XPIA 4H15A 3UM9A 4IDAA 1ACLA 1XA4A 4MRRA 1VQ8F 4IIFA 4UCXA 2Z6VA 2ZBRA 4NWIA 1H2XA 4LVNA 4Q82A 16PKA 2H29A 3TQRA 2M1XA 4IMJB 2P9FA 4LTDA 3U19A 4KAXA 4UUNA 3I2GA 3BT7A 2BCEA 4R16A 5JE8A 4XVQA 4LHSA 1BA3A 4B2LA 4EK9A 4B6SA 1SRQA 4PA3A 4HWSA 3SJCC 2KYRA 1Z39A 3HHPA 4JI4O 5AKXA 4J7KA 2V0CA 2HHJA 1N6LA 1WQ3A 2VSNA 2ZUWA 5AKHA 3STZC 2X9QA 3KQMA 1E1QA 5T3UA 1EFVA 5JZMA 3JWHA 4ER3A 2UZ4A 4HNSA 3OE4A 5LZ7A 4Q4AB 1FU4A 3UT6A 4JI2B 2C5GA 1YVWA 1NVTA 1UFKA 3JRWA 1JDBC 2YIJA 4MS4A 4J9VA 3ZJUA 4ARAA 2WHEA 3MYRA 3ZGLA 4JLBA 3H05A 3MC1A 4H7EA 1W40A 2W2VA 1G7RA 3KT8A 2WZDA 4TZKA 1BAPA 4Y2TA 4S1NA 5HFJA 5NLLA 5AK3A 2QG4A 3PNQA 4ZICA 1JF8A 3QLTA 4CM8B 1OIXA 1TM3E 4KUMA 4N0EA 2X77A 4FFKA 1Z6QA 3KZXA 1TADA 2ZAGA 5J4KA 3P9XA 3ICQB 2J8ZA 1LK0A 1BW9A 3O8QA 1ZHHA 2OV3A 1EA5A 4H59A 2MINA 1ONBA 5JTTA 4BMCA 3ABQB 3CC2V 4Q21A 1QLJA 5ULLA 1V2HE 3U0BA 2J87A 3VU3A 3ASVA 5BNWA 3NV9A 4FWIB 2NSLA 2OXTA 4KYUA 4JKOA 4GLOA 4KH1A 4M46A 3DOOA 3VTIC 3L8ZA 1ZX3A 3IXQA 3EEIA 3CC4V 2R3SA 2IW1A 2D1QA 5DYTA 1XD8A 2ON6A 2Y1EA 2JGJA 1PVVA 2ECOA 1YK0A 2GEDA 2LVBA 1JXOA 4H2DA 5ARCA 4RKQA 1SN7A 1EQAA 1TNDA 4R5MA 3LYLA 3CPJB 2PKQP 1NAHA 1CZUA 1A5AB 4CKEA 2TRSB 1NZJA 4PAOA 2VDRB 1QZUA 4JQYA 3IOBA 2G9RA 2WHYA 4YAJA 2FEKA 5LSAA 3JAKB 1KJZA 4HMOA 3E8HA 3UOWA 3MGGA 3R6TA 5JFTA 1JV2B 4YP6A 1XJQA 3AMVA 5TJ9A 4KI0A 1JAZA 3M83A 3HO6A 2HFEC 3EGIA 1JKXA 3LVFO 3E15A 2CEAA 4H0LB 3CZ5A 3AHCA 3GWKC 1RA4A 1IHPA 1P75A 2QX9A 5B1AC 3VOAA 1G9SA 5EL0A 3INTA 4FS8A 4Y8VA 3C3TA 2VZ9A 3STUA 1PZXA 1PL6A 2NG1A 3TIFA 5DNWA 4AMZA 3ZWMA 4Y2UA 1TRKA 4BT5A 2L26A 4AN4A 2OHOA 4XCQA 4IDBA 1NBMA 2AR9A 3QUSA 421PA 1S5JA 4KFTA 3BQ9A 3ZE8A 2ZJ4A 1IWBB 4CM4B 3HLYA 2FOXA 3RFRA 3LL7A 1V1MA 5AVMA 3RBZA 5LUAA 3DAHA 4ND8A 4XTCS 2CYBA 3DVQX 1O0SA 3L1HA 1PZEA 2PT9A 4ZEMA 3H5WA 5K0FA 1UKYA 4XCVA 4MI1A 4PXAA 3KYDA 1PR3A 3LH5A 4WZBE 1KC8W 3WLIA 3O8OA 4YAWA 3H83A 5GJCA 5K8LA 3WK7A 4RMGA 1ILWA 2ZIUB 3CCEV 1EXWA 3AL0C 2IF0A 3AF0A 1P44A 1OMOA 3OU2A 4X20B 5EZYF 2IU4A 3CUVA 1IV2A 2OXEA 4WD3A 2RKOA 3EMVA 2PL9A 3LPNA 1GY8A 1BXGB 4XX0A 4YJDA 3AFNA 2LBXA 4MIYA 2XMPA 2ZYRA 2H94A 5K3FA 1SQPH 2DYSC 3MEQA 5A4IS 4IS3A 2IKSA 2J5KA 3LJKA 3CLSC 3O90A 5ALTA 3FPHA 3DMPA 2FUNB 2XOEA 1TM5E 3G8DA 2GMWA 1KMCA 2A5JA 1I32A 1GT91 4R54A 1MF7A 2J7KA 4JJFA 4YI5A 2GO1A 1E1NA 5B1NA 3HN7A 3L8FA 4RYLA 3R7DA 4TV8A 4HCJA 3ZQUA 1QRTA 2PL5A 5BURA 4YCNA 2CFOA 3ON5A 2KG7A 4PY2A 1TZ2A 1F0KA 4IRXA 4KXUA 3TH5A 2TMYA 1TM7E 3X43A 3M4SA 2XDQB 3SJ7A 2QDXA 3MTJA 2LBTA 4Q03A 4PZUA 1G8GA 2AN5A 1N7GA 2G4VA 4OKIA 1NNEA 3NOVA 5NULA 2XA2A 2ZR7A 1G7CA 3G2NA 1KC1A 1LS6A 1V3QE 4BNUA 2HC9A 1CR2A 2GTSA 3AR3A 1W36B 1VJTA 1X6VA 4QJIA 1B0AA 5FBVB 2DF8A 3QXJA 4XDKA 2PRKA 1E94E 1W1WA 1BKDR 5REQA 3IPXA 3TGLA 3RK0A 1ADBA 4UARA 5CTAA 3FFBA 2D1TA 4JC0A 4ZEWA 2GD1O 2ZYAA 5KTNA 3AI7A 4B3SB 2F3SA 3VX4A 2CTRA 4NMMA 1MUUA 1I33A 1E9AA 3OEEG 1TFRA 1FU7A 3L79A 2XTMA 3MTEA 5EESA 2FC3A 3CNHA 3Q8HA 3CX5F 2G70A 3VI3B 2VPQA 5TRTA 3ZXIA 5I45A 4IJ6A 1ZK1A 1X7WA 3DDUA 1SCUA 4MWDA 3PJEA 1XZPA 1TOAA 3M8AA 1CDOA 2WINI 2XQJA 4C7MA 1UXGA 2DLDA 3E58A 2YYSA 1DBSA 4PC2A 3FYUA 1YR2A 2OCYC 2VXBA 2XTJA 4WGFA 2A3RA 5ECDA 2IWRA 5HQTA 1AMOA 1X7XA 2OIGA 4P54A 4PONA 2IJIA 1C9KA 3ESCA 3ITDA 5EE3A 2IRWA 4M38A 4TSRA 2XYRA 1RKQA 4RBNA 4Z1VA 4ZVLA 2OBLA 1LSJA 1GQQA 1U9JA 1PNQA 4OQXA 2JIBA 4F06A 3TW6A 3ZDQA 3ETDA 1WUTA 2IITA 1KFBB 2BZSA 4JENA 8ADHA 2BF7A 4JGSA 1LQ2A 4W5WA 1RMTA 4H7DA 2REXB 2XF2A 1TVMA 3HXKA 5D6OA 2HHLA 2VJBA 1E79G 1NMEA 2QMZA 4TQ9A 3MSCA 3SSNA 4JAVC 3HVRA 2JAHA 2OKCA 5A4FS 5KWEA 3GGCA 4JAUA 2ECPA 3DXRA 2NVOA 1ZWKA 2GSDA 3GT4A 5KVQA 2FW0A 4XKJA 1ACMA 2SKEA 2FWBA 1JA1A 4GUNA 3F5WC 1VQ5F 3CC7F 1DBRA 4KDRA 1HDJA 1K73W 1YVUA 4Q01A 3KKOA 1NW7A 2XV1A 3QVTA 1MGPA 1S2OA 1MTOA 2X2EA 6NULA 3GUZA 3O4VA 2F23A 2GZAA 1X3LA 2ZRAA 4X97A