2LCAA

Solution structure of the c domain of rv0899 from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv0899/MT0922
molecule tags Peptidoglycan-binding protein
source organism Mycobacterium tuberculosis
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lcaA00
3CYPB 3TD5A 3CYQA 3S02A 4G4WA 5EB0A 2MQEA 4G88A 4RHAA 3KHNA 3S0HA 3IMPA 2K1SA 2ZVZA 3OONA 2ZVYA 4G4VA 5EB1B 3LDTA 3WPXA 4G4XA 2LBTA 2KGWA 2ZF8A 3TD4A 3S0YA 1R1MA 3S06A 4R40B 4G4ZA 2HQSC 4B62A 2LCAA 1OAPA 3WPWA 3S0WA 2AIZP 4ERHA 4B5CA 2ZOVA 4G4YA 2N48A 3S03A 2W8BC 3TD3A 4ZHYB 4PWTA 4ZHVA 4ZHWA 5EAZA 2L26A
chains in the Genus database with same CATH superfamily
2R751 4KWEA 1VQNF 5JQGB 3JAKA 2RHJA 5GAPK 3JALB 2Z1TA 3CC2F 2HS3A 3WPXA 3N2KB 4TV8B 1H48A 3PLAC 1YGYA 4O2BA 1SDSA 2Z1FA 3CB2A 3N2KA 4BVTA 1YQNA 2LBWA 5G4UC 1JN1A 4BT4A 1ODEA 4F6RA 2LBXA 5KMGA 3FFMA 2HP0B 1GZ0A 3VCZA 3JAWA 3WGKA 4X1KB 2KTVA 3V7EA 3KHNA 1JFFB 3ZO8A 1VQ8F 5EB1B 4X20B 1UFYA 4I55B 3NK7A 4EI7A 4O2AA 5MN6A 3ZP4A 3VYSC 5J2TB 5FNVA 3VYTC 1VQVA 3B6NA 1W55A 2Q1XA 4X20A 5LOVB 1JD1A 2UYKA 2W8BC 3TD3A 1CLIA 4ZOLA 1E7KA 5HY1A 2H6LA 2L26A 2Z01A 3HKBB 5JVDA 3RYCA 5HY2A 1QD9A 3V7QA 4BT5A 2HP0A 4BY9D 5IYZA 1X7OA 3L7QA 3HKCA 3E1YA 1VQ9F 3F6MA 3V3TA 3IR9A 5EIBD 4U39A 1W59A 5LYJB 3K2XA 4TV9A 5JH7B 3PAFA 2AIFA 1XHOA 4O4LA 4ZHQA 5LP6A 2GLZA 5GINC 1M90H 1Z5WA 4ZI7A 4TV8A 3N4ZA 1TVKB 3O85A 3F0FA 4I50A 4O4IA 1KNJA 2QTPA 5C8YA 3J80M 3CYQA 2DYYA 3GYQA 4G4WA 4DRXB 1CN7A 3LMEA 4C82A 3JVHA 3VTIC 3U0OA 4I55A 1FNJA 3CD6F 3N2GB 4IHJB 3I56F 3VOAA 5IJ0A 5GIOC 1VQ7F 3CCSF 3CMEF 3C9RA 3WJPA 1U40A 2BTUA 2HRYA 3JAWB 4C81A 4ZOLB 4BW0B 4IIJB 2UYPA 3EORA 4PWTA 1S72F 3F0EA 1X7PA 2JNBA 4F6RB 5EAZA 1VK3A 2OTLF 4B45A 3DC2A 3OBYA 4X1IA 3G71F 1H7MA 5C8YB 3CCQF 5LOVA 3C9TA 3E22A 3S0HA 3R0PA 3AGKA 1W5BA 1Q7YH 2GVIA 4G4XA 4I4TA 5HXUA 3JARB 5LA6B 2AMTA 5HY4A 3UT5B 2CHSA 3CPWF 1NJIH 3HKDA 2LCAA 3CCMF 5JCOA 1YITF 4X1YA 3CYPB 2I6DA 2YXZA 3DDNA 5MN5A 5EWRA 3HKBA 1T0KB 3CXCF 4X1IB 1VQ6F 1VQLF 2QEXF 2I6RA 3ERNA 1FNKA 1CK2A 3LWOC 2F9ZC 3RYFB 3CMAF 4BT7A 3HAXD 2G9IA 1VQOF 5KX5A 3RYHB 3I55F 3C8LA 1VHAA 1Q82H 3M84A 3SIUA 2ZAUA 3I3FA 3S03A 2CVLA 1U43A 2KTUA 4C8IA 4EB6A 3MBMA 4X1KA 5BMVB 2BO1A 1OFUA 2IQQA 2FC3A 3JCMM 5IYZB 4NQ3A 1K9MH 5ITZA 5IJ9A 3WJRA 1SZQA 3P4EA 3UT5A 1M1KH 3I7TA 3CPQA 3S06A 3CCEF 3E20B 5MN4A 4BVSA 5HP8A 1VQ5F 4O4IB 5CA1A 2CWJA 2VAMA 2CSLA 2Z1UA 4C8EA 5EYPA 3IEWA 3RYIB 5LXTB 1Z5VA 3K12A 4RHAA 5J2UA 3OBWA 1XRGA 5HWEA 4YJ3A 1FSZA 1W5FA 2LBTA 1K73H 3ELCA 4O4JA 3VOBA 3RYHA 3K0TA 5IJ0B 4O2BB 5GIPC 4C4WC 4TZZA 1UI9A 5FNVB 4ERHA 2ZODA 4DRXA 5EZYA 1YJWF 3LYBA 3CC7F 1RLGA 1DBFA 3IKFA 3ESJA 3MQWA 1U3LA 5GONA 1QVFF 4HNAB 1Q8RA 1W3EX 1X25A 1W57A 5JH7A 4U3JA 3RA6A 3CCUF 2OHWA 3HJWC 3LWRC 3IMPA 3RA5A 1QAHA 2IG8A 3CCVF 1SA0A 5LP6C 2IAFA 3QHDA 4RQOA 2RHLA 3LWPC 3HKEA 3GHZA 4R40B 4U3JB 1W2BF 5HXZA 2HS4A 4EB6B 3FD6A 4EI9A 3N4YA 4YJ2B 5A2QM 3E22B 3FBAA 3RYFA 4E6EA 2BTQB 3RYCB 1TVKA 3WGNA 1X52A 5GONB 2MQEA 4G88A 4M8IA 5JCOC 1COMA 2UYNA 5EIBC 2VGNA 1YJ9F 1KQSF 4EI8A 4C8GA 4TV9B 2VAWA 3ON1A 3MDOA 3D00A 5HP7A 5AVMA 4LNUB 3S0YA 5LP6B 3C9SA 2HQSC 5CB4B 3RYIA 2HP3A 4G4YA 2N48A 1RQ2A 5CA0A 5J2UB 1XBIA 1YJNF 3T80A 5CB4A 3KIZA 3J7AR 1XV2A 2HS0A 5KX5B 2UYNB 2UZHA 4G4VA 4ZI7B 1W42A 3CCJF 5G4VC 2R6R1 2VGMA 5B8FA 5IJ9B 1VQ4F 1FFXA 1R1MA 1VH8A 5GANK 3CCRF 2CZWA 4O4JB 3V4DA 4X1YB 4B62A 3VYUC 4YJ2A 1TUBA 3JAMM 1ONIA 3JATA 3G4SF 1KNKA 2AIZP 3CCLF 1N8RH 4O4HB 1YIJF 3G6EF 5KMGB 1IV1A 5HY0A 1J7HA 2GZLA 3N2GA 5CA0B 4WBNA 4ZHWA 5EB0A 1Q81H 4BT2A 5LXTA 3MCQA 3JASB 2B33A 3OONA 5LA6A 2UYJA 3RE3A 4BVQA 2ZF8A 4NUTA 1YHQF 4B46A 3M1XA 3JALA 2ALEA 2DT4A 1QU9A 1W5AA 2HX0A 4O4LB 4ZHQB 4B5CA 3C9UA 1JY8A 2P6YA 3NVKE 3M4SA 2PHNA 3K14A 3JAKB 3TD5A 3CG6A 3HTNA 1U3PA 2RHOA 3GTZA 3HKDB 3WJQA 2K1SA 3D01A 3LDTA 5JVDB 1FFXB 3LWQC 4FFBB 4BVRA 3D54A 3F0GA 5CA1B 5EYPB 1SA0B 3NMUC 1PXWA 3JATB 3BYQA 3FD5A 2Q1YA 4DXDA 3IKEA 2QI2A 4ZHYB 1RLUA 4TUYB 1RA4A 3LFOA 1IV3A 1JJ2F 1ZWZA 2KG4A 1DT9A 2CW4A 2QA4F 5IT9M 5ITZB 1GO0A 2OZBA 3NK6A 1W581 2ZVYA 4BT3A 1JFFA 4LNUA 1IPAA 4O4HA 4YJ3B 1VQKF 2HVYD 3HWUA 1KC8H 2FGYA 2WALA 3P10A 1OAPA 3WPWA 1VQMF 1W41A 2RHHA 1VQPF 1TUBB 4NWOB 2PMPA 3Q8HA 4LCKA 2H8CA 2EWCA 3VO8A 4ZHVA 3LWVC 1IV4A 1Q86H 4O2AB 5FJ4C 1KD1H 5J2TA 4I50B 3WGMA 5JQGA 1YI2F 4XCQA 4WBNB 3CC4F 5BMVA 3JASA 3J81M 4IIJA 2BTOA 1GO1A 3TD4A 3KJJA 2HRUA 3MCAB 1IV2A 2RB9A 3HKEB 4X3LA 2NMUA 3S0WA 3NVIB 2VAPA 5FLXM 4BT6A 4I4TB 1T0AA 3JARA 4TUYA 3ZOPA 4HNAA 1PF5A 2YYEA 1H47A 3VI6A 2V9YA 3F0DA 1RQ7A 3ZP7A 4ZK7A 3WGLA 3IEQA 3VMFB 3S02A 3QTYA 2OTMA 1W40A 2ZVZA 1W5EA 5EZYB 2KGWA 4X3MA 3QUWA 1QVGF 2Z1EA 4G4ZA 1NQ3A 5EO3A 3WXMB 5DCVA 1K8AH 3KJKA 4FFBA 1GX1A 2ZOVA 3HKCB 5LYJA 3WGJA 2CHTA 3OW2F 3P0ZA 3FPIA 2H8EA 4IHJA 3KE1A 3VIUA 2VXYA 1NMUB 2OTJF 3SIVA
chains in the Genus database with same CATH topology
3CYPB 3TD5A 3CYQA 3S02A 4G4WA 5EB0A 2MQEA 4G88A 4RHAA 3KHNA 3S0HA 3IMPA 2K1SA 2ZVZA 3OONA 2ZVYA 4G4VA 5EB1B 3LDTA 3WPXA 4G4XA 2LBTA 2KGWA 2ZF8A 3TD4A 3S0YA 1R1MA 3S06A 4R40B 4G4ZA 2HQSC 4B62A 2LCAA 1OAPA 3WPWA 3S0WA 2AIZP 4ERHA 4B5CA 2ZOVA 4G4YA 2N48A 3S03A 2W8BC 3TD3A 4ZHYB 4PWTA 4ZHVA 4ZHWA 5EAZA 2L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYP B;  3TD5 A;  3CYQ A;  3S02 A;  4G4W A;  5EB0 A;  2MQE A;  4G88 A;  4RHA A;  3KHN A;  3S0H A;  3IMP A;  2K1S A;  2ZVZ A;  3OON A;  2ZVY A;  4G4V A;  5EB1 B;  3LDT A;  3WPX A;  4G4X A;  2LBT A;  2KGW A;  2ZF8 A;  3TD4 A;  3S0Y A;  1R1M A;  3S06 A;  4R40 B;  4G4Z A;  2HQS C;  4B62 A;  2LCA A;  1OAP A;  3WPW A;  3S0W A;  2AIZ P;  4ERH A;  4B5C A;  2ZOV A;  4G4Y A;  2N48 A;  3S03 A;  2W8B C;  3TD3 A;  4ZHY B;  4PWT A;  4ZHV A;  4ZHW A;  5EAZ A;  2L26 A; 
#chains in the Genus database with same CATH topology
 2R75 1;  4KWE A;  1VQN F;  5JQG B;  3JAK A;  2RHJ A;  5GAP K;  3JAL B;  2Z1T A;  3CC2 F;  2HS3 A;  3WPX A;  3N2K B;  4TV8 B;  1H48 A;  3PLA C;  1YGY A;  4O2B A;  1SDS A;  2Z1F A;  3CB2 A;  3N2K A;  4BVT A;  1YQN A;  2LBW A;  5G4U C;  1JN1 A;  4BT4 A;  1ODE A;  4F6R A;  2LBX A;  5KMG A;  3FFM A;  2HP0 B;  1GZ0 A;  3VCZ A;  3JAW A;  3WGK A;  4X1K B;  2KTV A;  3V7E A;  3KHN A;  1JFF B;  3ZO8 A;  1VQ8 F;  5EB1 B;  4X20 B;  1UFY A;  4I55 B;  3NK7 A;  4EI7 A;  4O2A A;  5MN6 A;  3ZP4 A;  3VYS C;  5J2T B;  5FNV A;  3VYT C;  1VQV A;  3B6N A;  1W55 A;  2Q1X A;  4X20 A;  5LOV B;  1JD1 A;  2UYK A;  2W8B C;  3TD3 A;  1CLI A;  4ZOL A;  1E7K A;  5HY1 A;  2H6L A;  2L26 A;  2Z01 A;  3HKB B;  5JVD A;  3RYC A;  5HY2 A;  1QD9 A;  3V7Q A;  4BT5 A;  2HP0 A;  4BY9 D;  5IYZ A;  1X7O A;  3L7Q A;  3HKC A;  3E1Y A;  1VQ9 F;  3F6M A;  3V3T A;  3IR9 A;  5EIB D;  4U39 A;  1W59 A;  5LYJ B;  3K2X A;  4TV9 A;  5JH7 B;  3PAF A;  2AIF A;  1XHO A;  4O4L A;  4ZHQ A;  5LP6 A;  2GLZ A;  5GIN C;  1M90 H;  1Z5W A;  4ZI7 A;  4TV8 A;  3N4Z A;  1TVK B;  3O85 A;  3F0F A;  4I50 A;  4O4I A;  1KNJ A;  2QTP A;  5C8Y A;  3J80 M;  3CYQ A;  2DYY A;  3GYQ A;  4G4W A;  4DRX B;  1CN7 A;  3LME A;  4C82 A;  3JVH A;  3VTI C;  3U0O A;  4I55 A;  1FNJ A;  3CD6 F;  3N2G B;  4IHJ B;  3I56 F;  3VOA A;  5IJ0 A;  5GIO C;  1VQ7 F;  3CCS F;  3CME F;  3C9R A;  3WJP A;  1U40 A;  2BTU A;  2HRY A;  3JAW B;  4C81 A;  4ZOL B;  4BW0 B;  4IIJ B;  2UYP A;  3EOR A;  4PWT A;  1S72 F;  3F0E A;  1X7P A;  2JNB A;  4F6R B;  5EAZ A;  1VK3 A;  2OTL F;  4B45 A;  3DC2 A;  3OBY A;  4X1I A;  3G71 F;  1H7M A;  5C8Y B;  3CCQ F;  5LOV A;  3C9T A;  3E22 A;  3S0H A;  3R0P A;  3AGK A;  1W5B A;  1Q7Y H;  2GVI A;  4G4X A;  4I4T A;  5HXU A;  3JAR B;  5LA6 B;  2AMT A;  5HY4 A;  3UT5 B;  2CHS A;  3CPW F;  1NJI H;  3HKD A;  2LCA A;  3CCM F;  5JCO A;  1YIT F;  4X1Y A;  3CYP B;  2I6D A;  2YXZ A;  3DDN A;  5MN5 A;  5EWR A;  3HKB A;  1T0K B;  3CXC F;  4X1I B;  1VQ6 F;  1VQL F;  2QEX F;  2I6R A;  3ERN A;  1FNK A;  1CK2 A;  3LWO C;  2F9Z C;  3RYF B;  3CMA F;  4BT7 A;  3HAX D;  2G9I A;  1VQO F;  5KX5 A;  3RYH B;  3I55 F;  3C8L A;  1VHA A;  1Q82 H;  3M84 A;  3SIU A;  2ZAU A;  3I3F A;  3S03 A;  2CVL A;  1U43 A;  2KTU A;  4C8I A;  4EB6 A;  3MBM A;  4X1K A;  5BMV B;  2BO1 A;  1OFU A;  2IQQ A;  2FC3 A;  3JCM M;  5IYZ B;  4NQ3 A;  1K9M H;  5ITZ A;  5IJ9 A;  3WJR A;  1SZQ A;  3P4E A;  3UT5 A;  1M1K H;  3I7T A;  3CPQ A;  3S06 A;  3CCE F;  3E20 B;  5MN4 A;  4BVS A;  5HP8 A;  1VQ5 F;  4O4I B;  5CA1 A;  2CWJ A;  2VAM A;  2CSL A;  2Z1U A;  4C8E A;  5EYP A;  3IEW A;  3RYI B;  5LXT B;  1Z5V A;  3K12 A;  4RHA A;  5J2U A;  3OBW A;  1XRG A;  5HWE A;  4YJ3 A;  1FSZ A;  1W5F A;  2LBT A;  1K73 H;  3ELC A;  4O4J A;  3VOB A;  3RYH A;  3K0T A;  5IJ0 B;  4O2B B;  5GIP C;  4C4W C;  4TZZ A;  1UI9 A;  5FNV B;  4ERH A;  2ZOD A;  4DRX A;  5EZY A;  1YJW F;  3LYB A;  3CC7 F;  1RLG A;  1DBF A;  3IKF A;  3ESJ A;  3MQW A;  1U3L A;  5GON A;  1QVF F;  4HNA B;  1Q8R A;  1W3E X;  1X25 A;  1W57 A;  5JH7 A;  4U3J A;  3RA6 A;  3CCU F;  2OHW A;  3HJW C;  3LWR C;  3IMP A;  3RA5 A;  1QAH A;  2IG8 A;  3CCV F;  1SA0 A;  5LP6 C;  2IAF A;  3QHD A;  4RQO A;  2RHL A;  3LWP C;  3HKE A;  3GHZ A;  4R40 B;  4U3J B;  1W2B F;  5HXZ A;  2HS4 A;  4EB6 B;  3FD6 A;  4EI9 A;  3N4Y A;  4YJ2 B;  5A2Q M;  3E22 B;  3FBA A;  3RYF A;  4E6E A;  2BTQ B;  3RYC B;  1TVK A;  3WGN A;  1X52 A;  5GON B;  2MQE A;  4G88 A;  4M8I A;  5JCO C;  1COM A;  2UYN A;  5EIB C;  2VGN A;  1YJ9 F;  1KQS F;  4EI8 A;  4C8G A;  4TV9 B;  2VAW A;  3ON1 A;  3MDO A;  3D00 A;  5HP7 A;  5AVM A;  4LNU B;  3S0Y A;  5LP6 B;  3C9S A;  2HQS C;  5CB4 B;  3RYI A;  2HP3 A;  4G4Y A;  2N48 A;  1RQ2 A;  5CA0 A;  5J2U B;  1XBI A;  1YJN F;  3T80 A;  5CB4 A;  3KIZ A;  3J7A R;  1XV2 A;  2HS0 A;  5KX5 B;  2UYN B;  2UZH A;  4G4V A;  4ZI7 B;  1W42 A;  3CCJ F;  5G4V C;  2R6R 1;  2VGM A;  5B8F A;  5IJ9 B;  1VQ4 F;  1FFX A;  1R1M A;  1VH8 A;  5GAN K;  3CCR F;  2CZW A;  4O4J B;  3V4D A;  4X1Y B;  4B62 A;  3VYU C;  4YJ2 A;  1TUB A;  3JAM M;  1ONI A;  3JAT A;  3G4S F;  1KNK A;  2AIZ P;  3CCL F;  1N8R H;  4O4H B;  1YIJ F;  3G6E F;  5KMG B;  1IV1 A;  5HY0 A;  1J7H A;  2GZL A;  3N2G A;  5CA0 B;  4WBN A;  4ZHW A;  5EB0 A;  1Q81 H;  4BT2 A;  5LXT A;  3MCQ A;  3JAS B;  2B33 A;  3OON A;  5LA6 A;  2UYJ A;  3RE3 A;  4BVQ A;  2ZF8 A;  4NUT A;  1YHQ F;  4B46 A;  3M1X A;  3JAL A;  2ALE A;  2DT4 A;  1QU9 A;  1W5A A;  2HX0 A;  4O4L B;  4ZHQ B;  4B5C A;  3C9U A;  1JY8 A;  2P6Y A;  3NVK E;  3M4S A;  2PHN A;  3K14 A;  3JAK B;  3TD5 A;  3CG6 A;  3HTN A;  1U3P A;  2RHO A;  3GTZ A;  3HKD B;  3WJQ A;  2K1S A;  3D01 A;  3LDT A;  5JVD B;  1FFX B;  3LWQ C;  4FFB B;  4BVR A;  3D54 A;  3F0G A;  5CA1 B;  5EYP B;  1SA0 B;  3NMU C;  1PXW A;  3JAT B;  3BYQ A;  3FD5 A;  2Q1Y A;  4DXD A;  3IKE A;  2QI2 A;  4ZHY B;  1RLU A;  4TUY B;  1RA4 A;  3LFO A;  1IV3 A;  1JJ2 F;  1ZWZ A;  2KG4 A;  1DT9 A;  2CW4 A;  2QA4 F;  5IT9 M;  5ITZ B;  1GO0 A;  2OZB A;  3NK6 A;  1W58 1;  2ZVY A;  4BT3 A;  1JFF A;  4LNU A;  1IPA A;  4O4H A;  4YJ3 B;  1VQK F;  2HVY D;  3HWU A;  1KC8 H;  2FGY A;  2WAL A;  3P10 A;  1OAP A;  3WPW A;  1VQM F;  1W41 A;  2RHH A;  1VQP F;  1TUB B;  4NWO B;  2PMP A;  3Q8H A;  4LCK A;  2H8C A;  2EWC A;  3VO8 A;  4ZHV A;  3LWV C;  1IV4 A;  1Q86 H;  4O2A B;  5FJ4 C;  1KD1 H;  5J2T A;  4I50 B;  3WGM A;  5JQG A;  1YI2 F;  4XCQ A;  4WBN B;  3CC4 F;  5BMV A;  3JAS A;  3J81 M;  4IIJ A;  2BTO A;  1GO1 A;  3TD4 A;  3KJJ A;  2HRU A;  3MCA B;  1IV2 A;  2RB9 A;  3HKE B;  4X3L A;  2NMU A;  3S0W A;  3NVI B;  2VAP A;  5FLX M;  4BT6 A;  4I4T B;  1T0A A;  3JAR A;  4TUY A;  3ZOP A;  4HNA A;  1PF5 A;  2YYE A;  1H47 A;  3VI6 A;  2V9Y A;  3F0D A;  1RQ7 A;  3ZP7 A;  4ZK7 A;  3WGL A;  3IEQ A;  3VMF B;  3S02 A;  3QTY A;  2OTM A;  1W40 A;  2ZVZ A;  1W5E A;  5EZY B;  2KGW A;  4X3M A;  3QUW A;  1QVG F;  2Z1E A;  4G4Z A;  1NQ3 A;  5EO3 A;  3WXM B;  5DCV A;  1K8A H;  3KJK A;  4FFB A;  1GX1 A;  2ZOV A;  3HKC B;  5LYJ A;  3WGJ A;  2CHT A;  3OW2 F;  3P0Z A;  3FPI A;  2H8E A;  4IHJ A;  3KE1 A;  3VIU A;  2VXY A;  1NMU B;  2OTJ F;  3SIV A; 
#chains in the Genus database with same CATH homology
 3CYP B;  3TD5 A;  3CYQ A;  3S02 A;  4G4W A;  5EB0 A;  2MQE A;  4G88 A;  4RHA A;  3KHN A;  3S0H A;  3IMP A;  2K1S A;  2ZVZ A;  3OON A;  2ZVY A;  4G4V A;  5EB1 B;  3LDT A;  3WPX A;  4G4X A;  2LBT A;  2KGW A;  2ZF8 A;  3TD4 A;  3S0Y A;  1R1M A;  3S06 A;  4R40 B;  4G4Z A;  2HQS C;  4B62 A;  2LCA A;  1OAP A;  3WPW A;  3S0W A;  2AIZ P;  4ERH A;  4B5C A;  2ZOV A;  4G4Y A;  2N48 A;  3S03 A;  2W8B C;  3TD3 A;  4ZHY B;  4PWT A;  4ZHV A;  4ZHW A;  5EAZ A;  2L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...