2LCAA

Solution structure of the c domain of rv0899 from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv0899/MT0922
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan-binding protein
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lcaA00
3S0WA 4R40B 2L26A 2K1SA 3S02A 2ZVZA 5EAZA 3S0HA 4G4VA 2ZF8A 3CYQA 3TD3A 2MQEA 4G4ZA 2LCAA 5EB0A 3TD5A 2HQSC 1R1MA 1OAPA 4PWTA 4ZHVA 4G4XA 2AIZP 4G4WA 3WPWA 2LBTA 3OONA 2ZOVA 3CYPB 4ZHWA 4B62A 3S03A 3WPXA 3KHNA 4ERHA 4G4YA 4B5CA 4ZHYB 2W8BC 3S0YA 4RHAA 2KGWA 4G88A 3LDTA 3S06A 2ZVYA 2N48A 3TD4A 3IMPA 5EB1B
chains in the Genus database with same CATH superfamily
1W5BA 3M84A 5EO3A 2CVLA 3JARB 4LCKA 1COMA 4ZHQA 3B6NA 4O4HA 3ZP4A 5J2TA 3RYIA 3CMEF 3WGMA 3CC4F 4O4HB 5J2TB 3Q8HA 3FD6A 3RYIB 2GLZA 3L7QA 1W5AA 3RYHA 3JCMM 4O4JA 4NWOB 2BTQB 1N8RH 2VAMA 3IKFA 4O4JB 2UYNA 1KNKA 5EB1B 1RLGA 1YITF 2CHSA 3LMEA 1VQ4F 1W59A 2VGNA 5CA1A 2UYNB 4BT5A 2AIFA 3N4ZA 4O4IA 5CA1B 1XHOA 1IV4A 4O4IB 2BO1A 1VQ9F 1VQNF 2RHJA 4O2AA 3HKBA 2Q1XA 2Z01A 1W5FA 4O2AB 3ZOPA 4HNAA 3HKBB 3CXCF 4HNAB 1KD1H 2RHOA 2ZVZA 4YJ3A 3IEQA 2CZWA 2VAWA 1ODEA 1TUBA 4U39A 4YJ3B 2HS4A 3V3TA 2AIZP 5GONA 4DXDA 3ERNA 3HKEB 1XRGA 5GONB 3CB2A 4ZHYB 2UYKA 2UYPA 3NVIB 5GANK 3CCJF 3K0TA 3RYFA 3VMFB 3RYFB 1QD9A 3AGKA 3CMAF 4TZZA 4C8GA 3HAXD 1VH8A 4I55A 1VQLF 1M90H 4EI9A 4G4XA 1X25A 3N2KB 3CCLF 3VOAA 3M4SA 1IV3A 2H6LA 3LFOA 4C4WC 3S0YA 4BW0B 3WXMB 3VTIC 3C9UA 5LOVA 1W55A 3WJRA 3I55F 1YGYA 5LOVB 2CW4A 3M1XA 1JJ2F 1W3EX 3C9SA 5LYJA 1S72F 3CCQF 5AVMA 3I7TA 1W581 3LWPC 3ZP7A 2Q1YA 2UYJA 5EB0A 5LYJB 3MBMA 3OBWA 4PWTA 5GAPK 1TVKA 3V4DA 3BYQA 2LBTA 1IPAA 3JVHA 4BY9D 3N4YA 3WGLA 1TVKB 3VYTC 1VK3A 5GIPC 3RA5A 3KHNA 3G6EF 2CHTA 2IAFA 2Z1UA 1X7OA 3OW2F 3PLAC 1YQNA 1M1KH 1OFUA 2YYEA 3HKDA 3S02A 2OHWA 2HS3A 1UFYA 5HY4A 3HKDB 4X1IA 3CCVF 1DBFA 5JQGA 5MN6A 2HRYA 4ZHQB 5JQGB 3CC7F 3IKEA 5IYZA 3WPWA 4EB6A 4TV8A 1Q8RA 5IYZB 2QEXF 4EB6B 2H8CA 3CC2F 4TV8B 4ZOLA 2W8BC 1FFXA 1RQ2A 4XCQA 3S06A 4ZOLB 3RYHB 3WJPA 3WGKA 1YIJF 4IHJA 2K1SA 2UZHA 3QHDA 4E6EA 3E1YA 4NUTA 2OTJF 4IHJB 4IIJA 2OTMA 1VQPF 2LCAA 3NK7A 4KWEA 2RHLA 4IIJB 2OZBA 3K2XA 2G9IA 2ZAUA 3CD6F 3QTYA 5MN5A 2LBXA 3WGNA 5JCOA 5FNVA 2FGYA 1KNJA 1W57A 2L26A 3E20B 3UT5A 5FNVB 5KX5A 3HJWC 4F6RA 4G4VA 3GYQA 5DCVA 1GO1A 1YJ9F 2GVIA 3UT5B 5KX5B 3ESJA 1UI9A 4F6RB 5G4VC 1IV2A 3KJJA 2I6DA 1VQ5F 1TUBB 2BTUA 3VOBA 1X7PA 3WPXA 1VQOF 3WGJA 5HXUA 2V9YA 2FC3A 5FLXM 2VAPA 2BTOA 1VHAA 4G88A 3CPWF 1X52A 5J2UA 4RQOA 2F9ZC 1Q7YH 1U3PA 5J2UB 4C81A 4X20A 3J80M 1J7HA 4BVTA 1W2BF 3U0OA 2I6RA 3LWRC 4X1KA 1H47A 3JAKA 1H7MA 1RLUA 3CPQA 4BVQA 2WALA 4X1KB 3JAKB 3JAWA 4I55B 3VYUC 3G71F 2JNBA 3D54A 1K8AH 3IEWA 3WJQA 3VIUA 5JVDA 3JAWB 4BVRA 1SDSA 3TD4A 5EWRA 3HWUA 2EWCA 5HY2A 5LA6A 1ZWZA 3GHZA 1Q86H 2CSLA 3J7AR 4ZI7A 1JD1A 4M8IA 5LA6B 3S0HA 5LP6A 3SIUA 4X3LA 3V7EA 4ZI7B 3JATA 4TV9A 5C8YA 4DRXA 5LP6B 1VQKF 2HP0A 2RB9A 3RA6A 1T0AA 3JATB 4NQ3A 5EIBD 1VQ6F 5C8YB 4DRXB 1YI2F 2VXYA 4BT3A 4B62A 5BMVA 3C8LA 3C9TA 4ERHA 1SZQA 3VI6A 4B5CA 4BT7A 2AMTA 2QI2A 1PXWA 2HX0A 1W42A 2ZVYA 1W5EA 1Q82H 2QA4F 4TUYA 4BT2A 3ON1A 4YJ2A 5CA0A 3LWVC 1U43A 4TUYB 3I3FA 4YJ2B 1YHQF 1YJWF 5CA0B 3F0EA 3P0ZA 3CCRF 3IR9A 4X1IB 3O85A 3F0GA 2H8EA 2DYYA 3S03A 2GZLA 3E22A 1JN1A 4B46A 3C9RA 1Z5WA 3KIZA 2IG8A 3E22B 3JASA 3JAMM 1FFXB 1NQ3A 4R40B 1RA4A 3P4EA 3JASB 3FPIA 5HY0A 2ZODA 3K12A 1CLIA 3MDOA 3DC2A 2MQEA 4G4ZA 2ALEA 4U3JA 1R1MA 3KJKA 5LP6C 4EI8A 2VGMA 3OONA 2ZOVA 4U3JB 2HS0A 4FFBA 3N2GA 3R0PA 3GTZA 1K73H 1Z5VA 4FFBB 3N2GB 4WBNA 4RHAA 5HP7A 3LDTA 2IQQA 1FNKA 4C8EA 5ITZA 3V7QA 4WBNB 1PF5A 3CG6A 2DT4A 5IJ9A 5ITZB 5JH7A 3NK6A 4X3MA 1SA0A 5EAZA 5CB4A 2LBWA 4B45A 1QVGF 2Z1EA 5IJ9B 5JH7B 1XV2A 1VQ7F 5CB4B 1SA0B 5MN4A 3TD3A 1W40A 4O2BA 1ONIA 3P10A 2R6R1 2CWJA 2HRUA 3NMUC 1RQ7A 4O2BB 3CCSF 3SIVA 2KG4A 1FNJA 1GZ0A 1KQSF 3J81M 2KGWA 1JY8A 1GX1A 3JALA 4LNUA 1VQVA 1VQ8F 3IMPA 4ZK7A 3VYSC 3S0WA 3K14A 3JALB 5EYPA 4LNUB 2Z1TA 3QUWA 5HP8A 2KTUA 1QU9A 1U40A 2KTVA 5EYPB 2ZF8A 3FBAA 3CYQA 3LWOC 4X20B 1IV1A 3HKEA 3VO8A 1Q81H 5G4UC 4G4WA 3CYPB 1QVFF 4C8IA 4ZHWA 1CK2A 3F0DA 4C82A 4X1YA 5EZYA 1U3LA 3ELCA 3VCZA 3NVKE 4X1YB 2N48A 2OTLF 3PAFA 5EZYB 3EORA 2HP3A 5B8FA 2HVYD 4I4TA 5JVDB 1XBIA 5HXZA 5GINC 3HKCA 3ZO8A 5A2QM 4I4TB 3KE1A 2RHHA 1T0KB 3FFMA 3T80A 2PHNA 3HKCB 3N2KA 5JCOC 3CCEF 3G4SF 1YJNF 3CCMF 2HQSC 4EI7A 1JFFA 2R751 5GIOC 1NMUB 2P6YA 2PMPA 5LXTA 1JFFB 4TV9B 1GO0A 1E7KA 2HP0B 5LXTB 2YXZA 1FSZA 3FD5A 3DDNA 5BMVB 4BT4A 1CN7A 1QAHA 3LYBA 1VQMF 5HWEA 3CCUF 5KMGA 2QTPA 3LWQC 3HTNA 4BT6A 5KMGB 3I56F 3MQWA 2B33A 1W41A 1KC8H 4I50A 3TD5A 1OAPA 5IT9M 3F6MA 4ZHVA 3OBYA 5EIBC 4I50B 3D01A 4O4LA 5IJ0A 2Z1FA 3RE3A 3F0FA 4G4YA 5HY1A 4O4LB 3RYCA 1K9MH 5FJ4C 3MCAB 5IJ0B 3MCQA 3D00A 4BVSA 3RYCB 1H48A 1NJIH 2NMUA 1DT9A 3JARA
chains in the Genus database with same CATH topology
3S0WA 4R40B 2L26A 2K1SA 3S02A 2ZVZA 5EAZA 3S0HA 4G4VA 2ZF8A 3CYQA 3TD3A 2MQEA 4G4ZA 2LCAA 5EB0A 3TD5A 2HQSC 1R1MA 1OAPA 4PWTA 4ZHVA 4G4XA 2AIZP 4G4WA 3WPWA 2LBTA 3OONA 2ZOVA 3CYPB 4ZHWA 4B62A 3S03A 3WPXA 3KHNA 4ERHA 4G4YA 4B5CA 4ZHYB 2W8BC 3S0YA 4RHAA 2KGWA 4G88A 3LDTA 3S06A 2ZVYA 2N48A 3TD4A 3IMPA 5EB1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0W A;  4R40 B;  2L26 A;  2K1S A;  3S02 A;  2ZVZ A;  5EAZ A;  3S0H A;  4G4V A;  2ZF8 A;  3CYQ A;  3TD3 A;  2MQE A;  4G4Z A;  2LCA A;  5EB0 A;  3TD5 A;  2HQS C;  1R1M A;  1OAP A;  4PWT A;  4ZHV A;  4G4X A;  2AIZ P;  4G4W A;  3WPW A;  2LBT A;  3OON A;  2ZOV A;  3CYP B;  4ZHW A;  4B62 A;  3S03 A;  3WPX A;  3KHN A;  4ERH A;  4G4Y A;  4B5C A;  4ZHY B;  2W8B C;  3S0Y A;  4RHA A;  2KGW A;  4G88 A;  3LDT A;  3S06 A;  2ZVY A;  2N48 A;  3TD4 A;  3IMP A;  5EB1 B; 
#chains in the Genus database with same CATH topology
 1W5B A;  3M84 A;  5EO3 A;  2CVL A;  3JAR B;  4LCK A;  1COM A;  4ZHQ A;  3B6N A;  4O4H A;  3ZP4 A;  5J2T A;  3RYI A;  3CME F;  3WGM A;  3CC4 F;  4O4H B;  5J2T B;  3Q8H A;  3FD6 A;  3RYI B;  2GLZ A;  3L7Q A;  1W5A A;  3RYH A;  3JCM M;  4O4J A;  4NWO B;  2BTQ B;  1N8R H;  2VAM A;  3IKF A;  4O4J B;  2UYN A;  1KNK A;  5EB1 B;  1RLG A;  1YIT F;  2CHS A;  3LME A;  1VQ4 F;  1W59 A;  2VGN A;  5CA1 A;  2UYN B;  4BT5 A;  2AIF A;  3N4Z A;  4O4I A;  5CA1 B;  1XHO A;  1IV4 A;  4O4I B;  2BO1 A;  1VQ9 F;  1VQN F;  2RHJ A;  4O2A A;  3HKB A;  2Q1X A;  2Z01 A;  1W5F A;  4O2A B;  3ZOP A;  4HNA A;  3HKB B;  3CXC F;  4HNA B;  1KD1 H;  2RHO A;  2ZVZ A;  4YJ3 A;  3IEQ A;  2CZW A;  2VAW A;  1ODE A;  1TUB A;  4U39 A;  4YJ3 B;  2HS4 A;  3V3T A;  2AIZ P;  5GON A;  4DXD A;  3ERN A;  3HKE B;  1XRG A;  5GON B;  3CB2 A;  4ZHY B;  2UYK A;  2UYP A;  3NVI B;  5GAN K;  3CCJ F;  3K0T A;  3RYF A;  3VMF B;  3RYF B;  1QD9 A;  3AGK A;  3CMA F;  4TZZ A;  4C8G A;  3HAX D;  1VH8 A;  4I55 A;  1VQL F;  1M90 H;  4EI9 A;  4G4X A;  1X25 A;  3N2K B;  3CCL F;  3VOA A;  3M4S A;  1IV3 A;  2H6L A;  3LFO A;  4C4W C;  3S0Y A;  4BW0 B;  3WXM B;  3VTI C;  3C9U A;  5LOV A;  1W55 A;  3WJR A;  3I55 F;  1YGY A;  5LOV B;  2CW4 A;  3M1X A;  1JJ2 F;  1W3E X;  3C9S A;  5LYJ A;  1S72 F;  3CCQ F;  5AVM A;  3I7T A;  1W58 1;  3LWP C;  3ZP7 A;  2Q1Y A;  2UYJ A;  5EB0 A;  5LYJ B;  3MBM A;  3OBW A;  4PWT A;  5GAP K;  1TVK A;  3V4D A;  3BYQ A;  2LBT A;  1IPA A;  3JVH A;  4BY9 D;  3N4Y A;  3WGL A;  1TVK B;  3VYT C;  1VK3 A;  5GIP C;  3RA5 A;  3KHN A;  3G6E F;  2CHT A;  2IAF A;  2Z1U A;  1X7O A;  3OW2 F;  3PLA C;  1YQN A;  1M1K H;  1OFU A;  2YYE A;  3HKD A;  3S02 A;  2OHW A;  2HS3 A;  1UFY A;  5HY4 A;  3HKD B;  4X1I A;  3CCV F;  1DBF A;  5JQG A;  5MN6 A;  2HRY A;  4ZHQ B;  5JQG B;  3CC7 F;  3IKE A;  5IYZ A;  3WPW A;  4EB6 A;  4TV8 A;  1Q8R A;  5IYZ B;  2QEX F;  4EB6 B;  2H8C A;  3CC2 F;  4TV8 B;  4ZOL A;  2W8B C;  1FFX A;  1RQ2 A;  4XCQ A;  3S06 A;  4ZOL B;  3RYH B;  3WJP A;  3WGK A;  1YIJ F;  4IHJ A;  2K1S A;  2UZH A;  3QHD A;  4E6E A;  3E1Y A;  4NUT A;  2OTJ F;  4IHJ B;  4IIJ A;  2OTM A;  1VQP F;  2LCA A;  3NK7 A;  4KWE A;  2RHL A;  4IIJ B;  2OZB A;  3K2X A;  2G9I A;  2ZAU A;  3CD6 F;  3QTY A;  5MN5 A;  2LBX A;  3WGN A;  5JCO A;  5FNV A;  2FGY A;  1KNJ A;  1W57 A;  2L26 A;  3E20 B;  3UT5 A;  5FNV B;  5KX5 A;  3HJW C;  4F6R A;  4G4V A;  3GYQ A;  5DCV A;  1GO1 A;  1YJ9 F;  2GVI A;  3UT5 B;  5KX5 B;  3ESJ A;  1UI9 A;  4F6R B;  5G4V C;  1IV2 A;  3KJJ A;  2I6D A;  1VQ5 F;  1TUB B;  2BTU A;  3VOB A;  1X7P A;  3WPX A;  1VQO F;  3WGJ A;  5HXU A;  2V9Y A;  2FC3 A;  5FLX M;  2VAP A;  2BTO A;  1VHA A;  4G88 A;  3CPW F;  1X52 A;  5J2U A;  4RQO A;  2F9Z C;  1Q7Y H;  1U3P A;  5J2U B;  4C81 A;  4X20 A;  3J80 M;  1J7H A;  4BVT A;  1W2B F;  3U0O A;  2I6R A;  3LWR C;  4X1K A;  1H47 A;  3JAK A;  1H7M A;  1RLU A;  3CPQ A;  4BVQ A;  2WAL A;  4X1K B;  3JAK B;  3JAW A;  4I55 B;  3VYU C;  3G71 F;  2JNB A;  3D54 A;  1K8A H;  3IEW A;  3WJQ A;  3VIU A;  5JVD A;  3JAW B;  4BVR A;  1SDS A;  3TD4 A;  5EWR A;  3HWU A;  2EWC A;  5HY2 A;  5LA6 A;  1ZWZ A;  3GHZ A;  1Q86 H;  2CSL A;  3J7A R;  4ZI7 A;  1JD1 A;  4M8I A;  5LA6 B;  3S0H A;  5LP6 A;  3SIU A;  4X3L A;  3V7E A;  4ZI7 B;  3JAT A;  4TV9 A;  5C8Y A;  4DRX A;  5LP6 B;  1VQK F;  2HP0 A;  2RB9 A;  3RA6 A;  1T0A A;  3JAT B;  4NQ3 A;  5EIB D;  1VQ6 F;  5C8Y B;  4DRX B;  1YI2 F;  2VXY A;  4BT3 A;  4B62 A;  5BMV A;  3C8L A;  3C9T A;  4ERH A;  1SZQ A;  3VI6 A;  4B5C A;  4BT7 A;  2AMT A;  2QI2 A;  1PXW A;  2HX0 A;  1W42 A;  2ZVY A;  1W5E A;  1Q82 H;  2QA4 F;  4TUY A;  4BT2 A;  3ON1 A;  4YJ2 A;  5CA0 A;  3LWV C;  1U43 A;  4TUY B;  3I3F A;  4YJ2 B;  1YHQ F;  1YJW F;  5CA0 B;  3F0E A;  3P0Z A;  3CCR F;  3IR9 A;  4X1I B;  3O85 A;  3F0G A;  2H8E A;  2DYY A;  3S03 A;  2GZL A;  3E22 A;  1JN1 A;  4B46 A;  3C9R A;  1Z5W A;  3KIZ A;  2IG8 A;  3E22 B;  3JAS A;  3JAM M;  1FFX B;  1NQ3 A;  4R40 B;  1RA4 A;  3P4E A;  3JAS B;  3FPI A;  5HY0 A;  2ZOD A;  3K12 A;  1CLI A;  3MDO A;  3DC2 A;  2MQE A;  4G4Z A;  2ALE A;  4U3J A;  1R1M A;  3KJK A;  5LP6 C;  4EI8 A;  2VGM A;  3OON A;  2ZOV A;  4U3J B;  2HS0 A;  4FFB A;  3N2G A;  3R0P A;  3GTZ A;  1K73 H;  1Z5V A;  4FFB B;  3N2G B;  4WBN A;  4RHA A;  5HP7 A;  3LDT A;  2IQQ A;  1FNK A;  4C8E A;  5ITZ A;  3V7Q A;  4WBN B;  1PF5 A;  3CG6 A;  2DT4 A;  5IJ9 A;  5ITZ B;  5JH7 A;  3NK6 A;  4X3M A;  1SA0 A;  5EAZ A;  5CB4 A;  2LBW A;  4B45 A;  1QVG F;  2Z1E A;  5IJ9 B;  5JH7 B;  1XV2 A;  1VQ7 F;  5CB4 B;  1SA0 B;  5MN4 A;  3TD3 A;  1W40 A;  4O2B A;  1ONI A;  3P10 A;  2R6R 1;  2CWJ A;  2HRU A;  3NMU C;  1RQ7 A;  4O2B B;  3CCS F;  3SIV A;  2KG4 A;  1FNJ A;  1GZ0 A;  1KQS F;  3J81 M;  2KGW A;  1JY8 A;  1GX1 A;  3JAL A;  4LNU A;  1VQV A;  1VQ8 F;  3IMP A;  4ZK7 A;  3VYS C;  3S0W A;  3K14 A;  3JAL B;  5EYP A;  4LNU B;  2Z1T A;  3QUW A;  5HP8 A;  2KTU A;  1QU9 A;  1U40 A;  2KTV A;  5EYP B;  2ZF8 A;  3FBA A;  3CYQ A;  3LWO C;  4X20 B;  1IV1 A;  3HKE A;  3VO8 A;  1Q81 H;  5G4U C;  4G4W A;  3CYP B;  1QVF F;  4C8I A;  4ZHW A;  1CK2 A;  3F0D A;  4C82 A;  4X1Y A;  5EZY A;  1U3L A;  3ELC A;  3VCZ A;  3NVK E;  4X1Y B;  2N48 A;  2OTL F;  3PAF A;  5EZY B;  3EOR A;  2HP3 A;  5B8F A;  2HVY D;  4I4T A;  5JVD B;  1XBI A;  5HXZ A;  5GIN C;  3HKC A;  3ZO8 A;  5A2Q M;  4I4T B;  3KE1 A;  2RHH A;  1T0K B;  3FFM A;  3T80 A;  2PHN A;  3HKC B;  3N2K A;  5JCO C;  3CCE F;  3G4S F;  1YJN F;  3CCM F;  2HQS C;  4EI7 A;  1JFF A;  2R75 1;  5GIO C;  1NMU B;  2P6Y A;  2PMP A;  5LXT A;  1JFF B;  4TV9 B;  1GO0 A;  1E7K A;  2HP0 B;  5LXT B;  2YXZ A;  1FSZ A;  3FD5 A;  3DDN A;  5BMV B;  4BT4 A;  1CN7 A;  1QAH A;  3LYB A;  1VQM F;  5HWE A;  3CCU F;  5KMG A;  2QTP A;  3LWQ C;  3HTN A;  4BT6 A;  5KMG B;  3I56 F;  3MQW A;  2B33 A;  1W41 A;  1KC8 H;  4I50 A;  3TD5 A;  1OAP A;  5IT9 M;  3F6M A;  4ZHV A;  3OBY A;  5EIB C;  4I50 B;  3D01 A;  4O4L A;  5IJ0 A;  2Z1F A;  3RE3 A;  3F0F A;  4G4Y A;  5HY1 A;  4O4L B;  3RYC A;  1K9M H;  5FJ4 C;  3MCA B;  5IJ0 B;  3MCQ A;  3D00 A;  4BVS A;  3RYC B;  1H48 A;  1NJI H;  2NMU A;  1DT9 A;  3JAR A; 
#chains in the Genus database with same CATH homology
 3S0W A;  4R40 B;  2L26 A;  2K1S A;  3S02 A;  2ZVZ A;  5EAZ A;  3S0H A;  4G4V A;  2ZF8 A;  3CYQ A;  3TD3 A;  2MQE A;  4G4Z A;  2LCA A;  5EB0 A;  3TD5 A;  2HQS C;  1R1M A;  1OAP A;  4PWT A;  4ZHV A;  4G4X A;  2AIZ P;  4G4W A;  3WPW A;  2LBT A;  3OON A;  2ZOV A;  3CYP B;  4ZHW A;  4B62 A;  3S03 A;  3WPX A;  3KHN A;  4ERH A;  4G4Y A;  4B5C A;  4ZHY B;  2W8B C;  3S0Y A;  4RHA A;  2KGW A;  4G88 A;  3LDT A;  3S06 A;  2ZVY A;  2N48 A;  3TD4 A;  3IMP A;  5EB1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...