2LCAA

Solution structure of the c domain of rv0899 from mycobacterium tuberculosis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptidoglycan-binding protein
molecule keywords Uncharacterized protein Rv0899/MT0922
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 35
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lcaA00
2K1SA 3S0YA 3LDTA 3OONA 4G4VA 3WPWA 4G4XA 2AIZP 2HQSC 4ZHYB 3IMPA 2ZF8A 2ZOVA 3WPXA 3S0WA 3TD4A 4ZHVA 5EB1B 3S0HA 3S02A 5EAZA 2LBTA 1R1MA 4G4YA 3S03A 2ZVYA 3CYPB 3TD5A 2ZVZA 2N48A 1OAPA 2W8BC 2MQEA 3KHNA 4R40B 2L26A 2KGWA 4ZHWA 4G4WA 4RHAA 4ERHA 4B62A 4G4ZA 4G88A 5EB0A 3S06A 4B5CA 3TD3A 3CYQA 2LCAA 4PWTA
chains in the Genus database with same CATH superfamily
1YITF 1RLGA 3WXMB 3NMUC 2CSLA 4ZHYB 2JNBA 3ZP7A 3F0FA 2UYKA 2UYNB 3F0GA 1YJNF 3PAFA 3ESJA 3WJQA 1U3PA 1JD1A 3CYPB 2ZVZA 4ZHQA 2H6LA 1IV4A 3N2KB 1FFXB 2UYPA 1ODEA 3UT5A 1DT9A 3EORA 3IEQA 4X1IB 4E6EA 5J2TA 3D01A 3CMEF 3QTYA 3G71F 3CB2A 3K0TA 3HKEB 2HVYD 1Z5VA 1W41A 2RHOA 5CB4B 1T0AA 5LYJA 2GVIA 1Q82H 1SZQA 3WGKA 4BT2A 2RHJA 2CHTA 3I7TA 2RHHA 3P10A 3RYFB 3VTIC 3GHZA 2IG8A 2ZVYA 1RQ2A 1RQ7A 2VGMA 4B46A 1Z5WA 2UYJA 1OAPA 1Q8RA 4O2BB 3L7QA 2Z01A 5HXZA 5GANK 1GO0A 3KJKA 5GONB 1W40A 3V4DA 2GZLA 4LNUA 1JY8A 4YJ3A 1VQPF 3OBWA 3ZOPA 5JCOA 3TD4A 4ZHVA 4C82A 3N4ZA 3IKFA 2Z1EA 3N2GA 4O4HB 1QD9A 5LA6A 4ZI7B 5JVDA 3CCJF 1FNKA 4U3JB 5IJ9A 1W2BF 2W8BC 5BMVB 2HRYA 4X3LA 1ZWZA 4TUYB 4RQOA 1QVGF 4FFBB 1OFUA 2KTUA 5LXTA 2OZBA 3JAKA 3P4EA 3MBMA 1W42A 2IQQA 4O4LA 2VAWA 4BT7A 5MN6A 3VYTC 4I50B 3VCZA 1IPAA 5KX5B 1NMUB 2B33A 2BTUA 2CHSA 3JAWA 1YJWF 1VQ9F 3B6NA 4I55A 3SIUA 3JATB 5IJ0B 4LCKA 3JARA 1QU9A 1YIJF 3AGKA 1W55A 3P0ZA 4O4JB 2Z1TA 3ZP4A 4NWOB 3LMEA 2UYNA 2AIFA 5HY0A 1M90H 1FSZA 3V7EA 1Q81H 4HNAB 4IHJB 3N4YA 1W5BA 3IKEA 4EI8A 2ZAUA 1YI2F 3VO8A 4M8IA 3CC2F 3N2KA 3K12A 1YJ9F 1FFXA 4I4TA 5JCOC 3RYCB 2IAFA 1Q86H 3HKEA 3C9TA 5EYPB 1ONIA 3KE1A 5CB4A 3I3FA 2CW4A 2PMPA 3CPWF 3S06A 3F0DA 5MN4A 5AVMA 3JAWB 3VYSC 2YXZA 3MQWA 2V9YA 5LOVB 3RYFA 4C8IA 2YYEA 3OONA 2CZWA 3JARB 3NVKE 2HQSC 3C8LA 1X7PA 3LWVC 4O2BA 1VQVA 5GIPC 1K8AH 4O4IB 3S0HA 4BVTA 2LBXA 1XV2A 4TZZA 2VAMA 3ERNA 5GONA 2Q1YA 2AMTA 3LWRC 5ITZB 2BTOA 2DYYA 2Z1UA 2HS0A 4TV9B 3HKDB 4O2AB 1VQ8F 4BT4A 3DC2A 5LP6A 2OTLF 4NUTA 4ZK7A 1X7OA 4I4TB 2HP0B 4O4HA 2CWJA 5EWRA 3O85A 4ZI7A 1PF5A 3RYHB 4U3JA 1NJIH 3E22B 2FC3A 5BMVA 1VQ4F 5EB1B 4WBNA 4TUYA 1VQ6F 4IIJB 1X25A 4FFBA 3FD6A 3V7QA 3J80M 3S03A 3I56F 2VGNA 1KNKA 2PHNA 1W5AA 3NK6A 3VYUC 2GLZA 2DT4A 2MQEA 3CCRF 2BO1A 3JVHA 3JASB 3OW2F 1K73H 1KC8H 4I50A 4G88A 5KX5A 5J2UB 2ALEA 4B5CA 4BVRA 1QVFF 3NK7A 5JH7B 2F9ZC 1W3EX 2G9IA 3FBAA 3LDTA 2QI2A 3R0PA 1SDSA 3JATA 5IJ0A 1VH8A 5LP6B 2I6RA 4O4JA 3CPQA 5CA0B 1W581 3JALB 1RLUA 3HKCB 4NQ3A 4EI7A 3S02A 5EAZA 4BY9D 2H8CA 4X1KB 5FLXM 2QTPA 3U0OA 5DCVA 1FNJA 1SA0B 5G4VC 4C4WC 1JN1A 1CLIA 4HNAA 4IHJA 3FD5A 5A2QM 1IV1A 3RA6A 1VQ5F 4ERHA 4WBNB 5EB0A 2H8EA 3J7AR 1NQ3A 1QAHA 3CYQA 3D00A 3WGLA 3RYCA 5IYZB 5MN5A 3WJPA 4DRXB 5EYPA 4C81A 2HS3A 3S0WA 3VI6A 2VAPA 3K14A 3PLAC 2R751 3E1YA 3M84A 3Q8HA 5LOVA 2N48A 3M1XA 4BW0B 1H47A 4ZOLB 4RHAA 3WGJA 4B62A 3NVIB 3HAXD 3SIVA 3TD3A 4O4IA 1KD1H 2HP3A 1TVKB 5ITZA 2HX0A 3RYIB 3C9UA 2EWCA 4TV9A 3HKDA 4O2AA 4TV8B 3HTNA 2ZODA 3WGNA 3KJJA 2LBTA 4BVQA 2HP0A 1JFFB 2I6DA 3HJWC 1KNJA 1W5FA 4X20B 3VMFB 2RHLA 3RYHA 2QEXF 1E7KA 3FPIA 4G4WA 3E22A 3K2XA 4BT3A 2Z1FA 3F0EA 4EI9A 5GAPK 4IIJA 1VQOF 4F6RB 1U43A 3JCMM 2FGYA 3I55F 1YHQF 2UZHA 2ZF8A 3WPXA 3C9RA 3JASA 5JQGB 5KMGB 4BT6A 5J2UA 1Q7YH 3KIZA 1TUBB 4X1YB 5JH7A 3ON1A 5B8FA 1XHOA 4BT5A 4EB6B 1N8RH 5EZYB 2KGWA 4C8GA 3CG6A 5FJ4C 3C9SA 5CA0A 1H48A 3GTZA 3GYQA 1RA4A 3JALA 3HKCA 3OBYA 4PWTA 1COMA 4X1KA 1UI9A 1SA0A 3QUWA 5CA1B 1IV3A 2ZOVA 1YGYA 5FNVB 3VOBA 3HWUA 4X3MA 4XCQA 3T80A 1H7MA 5C8YA 5HY1A 2OTJF 1VHAA 1XBIA 2KTVA 5HP8A 3CXCF 5IYZA 1CN7A 1KQSF 1GX1A 4DRXA 1J7HA 4G4ZA 2K1SA 4DXDA 2Q1XA 4G4XA 2RB9A 5EIBD 3WJRA 3D54A 4ZOLA 2KG4A 3V3TA 1IV2A 4U39A 1YQNA 1W59A 1X52A 1TVKA 4R40B 3CC7F 2R6R1 3BYQA 1VQ7F 3RYIA 5HXUA 4TV8A 3RA5A 3VOAA 4YJ2A 1K9MH 3IR9A 2OTMA 5LP6C 1VQMF 5C8YB 4ZHQB 2CVLA 2BTQB 1DBFA 1JFFA 4KWEA 3FFMA 3IMPA 4X20A 3QHDA 1W57A 3VIUA 3UT5B 3CCSF 5GIOC 1VQKF 1S72F 5J2TB 1UFYA 3CC4F 2P6YA 1R1MA 4F6RA 3TD5A 1M1KH 1U3LA 3CCVF 5LYJB 3KHNA 2L26A 5HY4A 4ZHWA 3HKBA 3WGMA 5HP7A 2HS4A 5JQGA 5KMGA 3MCAB 3RE3A 1GZ0A 3S0YA 1TUBA 4X1YA 3MDOA 5EO3A 2AIZP 4EB6A 3CCUF 4B45A 3LWQC 3CCQF 5EZYA 1JJ2F 3F6MA 4YJ2B 3J81M 3G4SF 1VK3A 4C8EA 4G4YA 3ZO8A 1PXWA 4LNUB 4YJ3B 3MCQA 2QA4F 1W5EA 5HWEA 5CA1A 3M4SA 3LWPC 3N2GB 2VXYA 5LA6B 5FNVA 3CCLF 3IEWA 3LYBA 5JVDB 5EIBC 1T0KB 5IT9M 1VQLF 5HY2A 3ELCA 3WPWA 4G4VA 5IJ9B 3LFOA 4BVSA 3HKBB 3CCMF 5LXTB 3DDNA 3JAKB 4X1IA 1VQNF 2OHWA 2LBWA 1CK2A 4O4LB 2NMUA 1XRGA 3CD6F 3LWOC 1GO1A 3CCEF 5GINC 2WALA 3E20B 2HRUA 1U40A 3JAMM 3G6EF 2LCAA 4I55B 3CMAF 5G4UC
chains in the Genus database with same CATH topology
2K1SA 3S0YA 3LDTA 3OONA 4G4VA 3WPWA 4G4XA 2AIZP 2HQSC 4ZHYB 3IMPA 2ZF8A 2ZOVA 3WPXA 3S0WA 3TD4A 4ZHVA 5EB1B 3S0HA 3S02A 5EAZA 2LBTA 1R1MA 4G4YA 3S03A 2ZVYA 3CYPB 3TD5A 2ZVZA 2N48A 1OAPA 2W8BC 2MQEA 3KHNA 4R40B 2L26A 2KGWA 4ZHWA 4G4WA 4RHAA 4ERHA 4B62A 4G4ZA 4G88A 5EB0A 3S06A 4B5CA 3TD3A 3CYQA 2LCAA 4PWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1S A;  3S0Y A;  3LDT A;  3OON A;  4G4V A;  3WPW A;  4G4X A;  2AIZ P;  2HQS C;  4ZHY B;  3IMP A;  2ZF8 A;  2ZOV A;  3WPX A;  3S0W A;  3TD4 A;  4ZHV A;  5EB1 B;  3S0H A;  3S02 A;  5EAZ A;  2LBT A;  1R1M A;  4G4Y A;  3S03 A;  2ZVY A;  3CYP B;  3TD5 A;  2ZVZ A;  2N48 A;  1OAP A;  2W8B C;  2MQE A;  3KHN A;  4R40 B;  2L26 A;  2KGW A;  4ZHW A;  4G4W A;  4RHA A;  4ERH A;  4B62 A;  4G4Z A;  4G88 A;  5EB0 A;  3S06 A;  4B5C A;  3TD3 A;  3CYQ A;  2LCA A;  4PWT A; 
#chains in the Genus database with same CATH topology
 1YIT F;  1RLG A;  3WXM B;  3NMU C;  2CSL A;  4ZHY B;  2JNB A;  3ZP7 A;  3F0F A;  2UYK A;  2UYN B;  3F0G A;  1YJN F;  3PAF A;  3ESJ A;  3WJQ A;  1U3P A;  1JD1 A;  3CYP B;  2ZVZ A;  4ZHQ A;  2H6L A;  1IV4 A;  3N2K B;  1FFX B;  2UYP A;  1ODE A;  3UT5 A;  1DT9 A;  3EOR A;  3IEQ A;  4X1I B;  4E6E A;  5J2T A;  3D01 A;  3CME F;  3QTY A;  3G71 F;  3CB2 A;  3K0T A;  3HKE B;  2HVY D;  1Z5V A;  1W41 A;  2RHO A;  5CB4 B;  1T0A A;  5LYJ A;  2GVI A;  1Q82 H;  1SZQ A;  3WGK A;  4BT2 A;  2RHJ A;  2CHT A;  3I7T A;  2RHH A;  3P10 A;  3RYF B;  3VTI C;  3GHZ A;  2IG8 A;  2ZVY A;  1RQ2 A;  1RQ7 A;  2VGM A;  4B46 A;  1Z5W A;  2UYJ A;  1OAP A;  1Q8R A;  4O2B B;  3L7Q A;  2Z01 A;  5HXZ A;  5GAN K;  1GO0 A;  3KJK A;  5GON B;  1W40 A;  3V4D A;  2GZL A;  4LNU A;  1JY8 A;  4YJ3 A;  1VQP F;  3OBW A;  3ZOP A;  5JCO A;  3TD4 A;  4ZHV A;  4C82 A;  3N4Z A;  3IKF A;  2Z1E A;  3N2G A;  4O4H B;  1QD9 A;  5LA6 A;  4ZI7 B;  5JVD A;  3CCJ F;  1FNK A;  4U3J B;  5IJ9 A;  1W2B F;  2W8B C;  5BMV B;  2HRY A;  4X3L A;  1ZWZ A;  4TUY B;  4RQO A;  1QVG F;  4FFB B;  1OFU A;  2KTU A;  5LXT A;  2OZB A;  3JAK A;  3P4E A;  3MBM A;  1W42 A;  2IQQ A;  4O4L A;  2VAW A;  4BT7 A;  5MN6 A;  3VYT C;  4I50 B;  3VCZ A;  1IPA A;  5KX5 B;  1NMU B;  2B33 A;  2BTU A;  2CHS A;  3JAW A;  1YJW F;  1VQ9 F;  3B6N A;  4I55 A;  3SIU A;  3JAT B;  5IJ0 B;  4LCK A;  3JAR A;  1QU9 A;  1YIJ F;  3AGK A;  1W55 A;  3P0Z A;  4O4J B;  2Z1T A;  3ZP4 A;  4NWO B;  3LME A;  2UYN A;  2AIF A;  5HY0 A;  1M90 H;  1FSZ A;  3V7E A;  1Q81 H;  4HNA B;  4IHJ B;  3N4Y A;  1W5B A;  3IKE A;  4EI8 A;  2ZAU A;  1YI2 F;  3VO8 A;  4M8I A;  3CC2 F;  3N2K A;  3K12 A;  1YJ9 F;  1FFX A;  4I4T A;  5JCO C;  3RYC B;  2IAF A;  1Q86 H;  3HKE A;  3C9T A;  5EYP B;  1ONI A;  3KE1 A;  5CB4 A;  3I3F A;  2CW4 A;  2PMP A;  3CPW F;  3S06 A;  3F0D A;  5MN4 A;  5AVM A;  3JAW B;  3VYS C;  2YXZ A;  3MQW A;  2V9Y A;  5LOV B;  3RYF A;  4C8I A;  2YYE A;  3OON A;  2CZW A;  3JAR B;  3NVK E;  2HQS C;  3C8L A;  1X7P A;  3LWV C;  4O2B A;  1VQV A;  5GIP C;  1K8A H;  4O4I B;  3S0H A;  4BVT A;  2LBX A;  1XV2 A;  4TZZ A;  2VAM A;  3ERN A;  5GON A;  2Q1Y A;  2AMT A;  3LWR C;  5ITZ B;  2BTO A;  2DYY A;  2Z1U A;  2HS0 A;  4TV9 B;  3HKD B;  4O2A B;  1VQ8 F;  4BT4 A;  3DC2 A;  5LP6 A;  2OTL F;  4NUT A;  4ZK7 A;  1X7O A;  4I4T B;  2HP0 B;  4O4H A;  2CWJ A;  5EWR A;  3O85 A;  4ZI7 A;  1PF5 A;  3RYH B;  4U3J A;  1NJI H;  3E22 B;  2FC3 A;  5BMV A;  1VQ4 F;  5EB1 B;  4WBN A;  4TUY A;  1VQ6 F;  4IIJ B;  1X25 A;  4FFB A;  3FD6 A;  3V7Q A;  3J80 M;  3S03 A;  3I56 F;  2VGN A;  1KNK A;  2PHN A;  1W5A A;  3NK6 A;  3VYU C;  2GLZ A;  2DT4 A;  2MQE A;  3CCR F;  2BO1 A;  3JVH A;  3JAS B;  3OW2 F;  1K73 H;  1KC8 H;  4I50 A;  4G88 A;  5KX5 A;  5J2U B;  2ALE A;  4B5C A;  4BVR A;  1QVF F;  3NK7 A;  5JH7 B;  2F9Z C;  1W3E X;  2G9I A;  3FBA A;  3LDT A;  2QI2 A;  3R0P A;  1SDS A;  3JAT A;  5IJ0 A;  1VH8 A;  5LP6 B;  2I6R A;  4O4J A;  3CPQ A;  5CA0 B;  1W58 1;  3JAL B;  1RLU A;  3HKC B;  4NQ3 A;  4EI7 A;  3S02 A;  5EAZ A;  4BY9 D;  2H8C A;  4X1K B;  5FLX M;  2QTP A;  3U0O A;  5DCV A;  1FNJ A;  1SA0 B;  5G4V C;  4C4W C;  1JN1 A;  1CLI A;  4HNA A;  4IHJ A;  3FD5 A;  5A2Q M;  1IV1 A;  3RA6 A;  1VQ5 F;  4ERH A;  4WBN B;  5EB0 A;  2H8E A;  3J7A R;  1NQ3 A;  1QAH A;  3CYQ A;  3D00 A;  3WGL A;  3RYC A;  5IYZ B;  5MN5 A;  3WJP A;  4DRX B;  5EYP A;  4C81 A;  2HS3 A;  3S0W A;  3VI6 A;  2VAP A;  3K14 A;  3PLA C;  2R75 1;  3E1Y A;  3M84 A;  3Q8H A;  5LOV A;  2N48 A;  3M1X A;  4BW0 B;  1H47 A;  4ZOL B;  4RHA A;  3WGJ A;  4B62 A;  3NVI B;  3HAX D;  3SIV A;  3TD3 A;  4O4I A;  1KD1 H;  2HP3 A;  1TVK B;  5ITZ A;  2HX0 A;  3RYI B;  3C9U A;  2EWC A;  4TV9 A;  3HKD A;  4O2A A;  4TV8 B;  3HTN A;  2ZOD A;  3WGN A;  3KJJ A;  2LBT A;  4BVQ A;  2HP0 A;  1JFF B;  2I6D A;  3HJW C;  1KNJ A;  1W5F A;  4X20 B;  3VMF B;  2RHL A;  3RYH A;  2QEX F;  1E7K A;  3FPI A;  4G4W A;  3E22 A;  3K2X A;  4BT3 A;  2Z1F A;  3F0E A;  4EI9 A;  5GAP K;  4IIJ A;  1VQO F;  4F6R B;  1U43 A;  3JCM M;  2FGY A;  3I55 F;  1YHQ F;  2UZH A;  2ZF8 A;  3WPX A;  3C9R A;  3JAS A;  5JQG B;  5KMG B;  4BT6 A;  5J2U A;  1Q7Y H;  3KIZ A;  1TUB B;  4X1Y B;  5JH7 A;  3ON1 A;  5B8F A;  1XHO A;  4BT5 A;  4EB6 B;  1N8R H;  5EZY B;  2KGW A;  4C8G A;  3CG6 A;  5FJ4 C;  3C9S A;  5CA0 A;  1H48 A;  3GTZ A;  3GYQ A;  1RA4 A;  3JAL A;  3HKC A;  3OBY A;  4PWT A;  1COM A;  4X1K A;  1UI9 A;  1SA0 A;  3QUW A;  5CA1 B;  1IV3 A;  2ZOV A;  1YGY A;  5FNV B;  3VOB A;  3HWU A;  4X3M A;  4XCQ A;  3T80 A;  1H7M A;  5C8Y A;  5HY1 A;  2OTJ F;  1VHA A;  1XBI A;  2KTV A;  5HP8 A;  3CXC F;  5IYZ A;  1CN7 A;  1KQS F;  1GX1 A;  4DRX A;  1J7H A;  4G4Z A;  2K1S A;  4DXD A;  2Q1X A;  4G4X A;  2RB9 A;  5EIB D;  3WJR A;  3D54 A;  4ZOL A;  2KG4 A;  3V3T A;  1IV2 A;  4U39 A;  1YQN A;  1W59 A;  1X52 A;  1TVK A;  4R40 B;  3CC7 F;  2R6R 1;  3BYQ A;  1VQ7 F;  3RYI A;  5HXU A;  4TV8 A;  3RA5 A;  3VOA A;  4YJ2 A;  1K9M H;  3IR9 A;  2OTM A;  5LP6 C;  1VQM F;  5C8Y B;  4ZHQ B;  2CVL A;  2BTQ B;  1DBF A;  1JFF A;  4KWE A;  3FFM A;  3IMP A;  4X20 A;  3QHD A;  1W57 A;  3VIU A;  3UT5 B;  3CCS F;  5GIO C;  1VQK F;  1S72 F;  5J2T B;  1UFY A;  3CC4 F;  2P6Y A;  1R1M A;  4F6R A;  3TD5 A;  1M1K H;  1U3L A;  3CCV F;  5LYJ B;  3KHN A;  2L26 A;  5HY4 A;  4ZHW A;  3HKB A;  3WGM A;  5HP7 A;  2HS4 A;  5JQG A;  5KMG A;  3MCA B;  3RE3 A;  1GZ0 A;  3S0Y A;  1TUB A;  4X1Y A;  3MDO A;  5EO3 A;  2AIZ P;  4EB6 A;  3CCU F;  4B45 A;  3LWQ C;  3CCQ F;  5EZY A;  1JJ2 F;  3F6M A;  4YJ2 B;  3J81 M;  3G4S F;  1VK3 A;  4C8E A;  4G4Y A;  3ZO8 A;  1PXW A;  4LNU B;  4YJ3 B;  3MCQ A;  2QA4 F;  1W5E A;  5HWE A;  5CA1 A;  3M4S A;  3LWP C;  3N2G B;  2VXY A;  5LA6 B;  5FNV A;  3CCL F;  3IEW A;  3LYB A;  5JVD B;  5EIB C;  1T0K B;  5IT9 M;  1VQL F;  5HY2 A;  3ELC A;  3WPW A;  4G4V A;  5IJ9 B;  3LFO A;  4BVS A;  3HKB B;  3CCM F;  5LXT B;  3DDN A;  3JAK B;  4X1I A;  1VQN F;  2OHW A;  2LBW A;  1CK2 A;  4O4L B;  2NMU A;  1XRG A;  3CD6 F;  3LWO C;  1GO1 A;  3CCE F;  5GIN C;  2WAL A;  3E20 B;  2HRU A;  1U40 A;  3JAM M;  3G6E F;  2LCA A;  4I55 B;  3CMA F;  5G4U C; 
#chains in the Genus database with same CATH homology
 2K1S A;  3S0Y A;  3LDT A;  3OON A;  4G4V A;  3WPW A;  4G4X A;  2AIZ P;  2HQS C;  4ZHY B;  3IMP A;  2ZF8 A;  2ZOV A;  3WPX A;  3S0W A;  3TD4 A;  4ZHV A;  5EB1 B;  3S0H A;  3S02 A;  5EAZ A;  2LBT A;  1R1M A;  4G4Y A;  3S03 A;  2ZVY A;  3CYP B;  3TD5 A;  2ZVZ A;  2N48 A;  1OAP A;  2W8B C;  2MQE A;  3KHN A;  4R40 B;  2L26 A;  2KGW A;  4ZHW A;  4G4W A;  4RHA A;  4ERH A;  4B62 A;  4G4Z A;  4G88 A;  5EB0 A;  3S06 A;  4B5C A;  3TD3 A;  3CYQ A;  2LCA A;  4PWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...