3HKEB

Tubulin-t138067: rb3 stathmin-like domain complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
428
structure length
420
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 128
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkeB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkeB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkeB01
5LOVA 5J2UB 4X1IA 1FFXB 4ZI7A 2Q1XA 3R4VA 4U39A 3WGKA 3WGJA 4U3JA 5KMGA 4B45A 4TUYB 3RYFB 5GONA 5LP6B 1Z5VA 4E6EA 2VAPA 5JH7A 4I50A 4IIJB 4FFBB 5J2TA 4O2AB 4ZHQB 1W5AA 2GVIA 3RYIB 4TV9B 2Q1YA 4X1KA 4O2BB 3JAWB 1TUBB 5IYZA 4DRXA 5MN5A 2BTOA 5JQGB 3VPAA 4O4JB 5LYJA 4F6RB 5IJ0A 5LOVB 3ZIDA 4X1IB 3WGMA 4HNAA 1W59A 4ZI7B 3VO8A 5C8YA 4U3JB 5KMGB 4B46A 4EI8A 3WGNA 3JATA 5GONB 4M8IA 3HKBA 2VAWA 4I4TA 4WBNA 1RQ2A 2RHOA 4LNUA 5JCOC 5JH7B 2R6R1 4I50B 5EIBC 1TVKA 3HKEB 3RYCA 5J2TB 4EI9A 1OFUA 4YJ3A 5EYPB 4X1KB 4X1YA 4XCQA 5IYZB 4DRXB 1RLUA 3HKEA 3JALA 5LYJB 5EYPA 5LA6A 4O4LA 5IJ0B 1Z5WA 3V3TA 5CB4A 3ZBQA 4HNAB 4EB6A 4YJ2A 3HKDA 5C8YB 4ZOLA 4O4HA 3N2KA 5BMVA 4KWEA 3HKCA 3RYHA 5EZYA 5LP6C 3JATB 3HKBB 4X20A 4I4TB 4WBNB 1JFFA 4LNUB 3C8LA 4O4IA 5CA1A 1TVKB 3RYCB 5IJ9A 1RQ7A 2RHHA 4YJ3B 5FNVA 5KX5A 4X1YB 3JASA 3JARA 3RB8A 3ZBPA 4I55A 3JALB 3M89A 5LA6B 5LXTA 4O4LB 3JAKA 2R751 4IHJA 5CB4B 4YJ2B 4EB6B 5ITZA 3HKDB 1W5EA 2VAMA 4ZOLB 4O4HB 3N2KB 5BMVB 5M7EA 3CB2A 3HKCB 1SA0A 3RYHB 5EZYB 4DXDA 5JVDA 2BTQA 5CA0A 3N2GA 3E22A 4X20B 1JFFB 3UT5A 2RHJA 1W581 4O4IB 5CA1B 2XKAA 3VOBA 5IJ9B 2RHLA 5FNVB 5KX5B 2VXYA 3WGLA 5J2UA 3JASB 3JARB 1FFXA 4I55B 4TV8B 5LXTB 4TUYA 2XKBA 3M8KA 1W5BA 3JAKB 3VOAA 3VO9A 4IHJB 3RYFA 5ITZB 1W5FA 5MN4A 5LP6A 4TV8A 1SA0B 4IIJA 4EI7A 4FFBA 1FSZA 4O2AA 4ZHQA 5JVDB 3RYIA 2BTQB 4TV9A 5EIBD 5CA0B 3N2GB 3E22B 3JAWA 4O2BA 3UT5B 1TUBA 5MN6A 5JCOA 5JQGA 4O4JA 4F6RA
chains in the Genus database with same CATH superfamily
1W0KA 1PW7A 2GJKA 3NHLA 1KAHA 4HS9A 4M8SA 1N32B 2R00C 2WTEA 4OO3A 3H16A 1UPGA 3DBLA 1W42A 3JVEA 4KVGA 2HZBA 2VSNA 4LF7O 2P4EA 4LGMA 3BJRA 5TQ0B 2I6SA 4DABA 1E4EB 3E15A 5ALKA 4P3KA 3PU6A 5IYZB 3NYRA 4MEJA 2AYZA 2JFGA 1AQ6A 4MQUA 4JKIA 4H33A 1WXIA 3C3TA 3ZZTA 1A72A 1V6AA 5FPSA 4BYGA 5AI4A 4BO7A 1HZJA 4H3SA 3ZIAD 4I1RA 1N7GA 3PE3A 1HM5A 4D42A 3CX4A 1N2HA 3KTFA 4UM8B 1XDUA 3CZCA 2Q6AA 4NXMB 4QDTA 2WA3A 1HOXA 3S28A 1FSFA 2J0UA 2RC5A 4MZXA 4Q05A 2C5HA 4FR5A 3HL4A 5DGDA 2R7LA 2X0JA 3FCCA 2XOEA 2APJA 2FN8A 3QW4B 2CXHA 1HW7A 3D31A 3B5EA 4CMKA 3AEQA 1X7GA 5FL7A 3LT5A 2GJ4A 3W2HA 1NKDA 2OFOA 4BX8A 3ZI0A 1NW9B 4MLPA 1Y4ZA 2R6ZA 4JP1A 5E1DA 5CFQA 5IE9A 3JARA 4DUGD 1KKDA 2IOYA 3A9TA 5J5CA 3STZC 4BZXA 2V9YA 4J42A 2GT1A 2O7QA 1CHNA 1L3CA 4NARA 3BB4A 3H2SA 2YDYA 2Q2WA 2FOLA 3RVJA 2D7DA 4FK8A 3WKDA 3OQBA 4BVFA 2PMFA 1AMUA 4WV3A 2IJGX 5DX8A 1KRWA 1CR1A 1ABBA 1PQ4A 5A6VA 5DO9A 1S7CA 4NCJA 1RZRD 1EM8B 3EG9A 4MB0A 1VARA 3ZG6A 3C8ZA 3I0NA 4IIUA 4AJKA 3RV3A 2ZIVB 4X7MA 4L5CA 4HDRA 4LRSB 8OHMA 1K4DC 2WM3A 1MO2A 1IBKO 1YJBA 4JNCA 3ZPXA 4GOKA 2J3MA 1N1DA 5IY5C 5JSFA 1XO1A 5CT6A 1KMMA 5AICA 5ANRB 4ENVA 4Z0NA 4D5GA 2NMVA 1ZKDA 1V9LA 2QWQB 4IGKA 2IV7A 2HA5A 1QHFA 3RU3A 3ZX5A 1B6RA 5ILQA 1HFWA 3HNPA 3R6TA 1K7CA 4O2RA 4B35A 1OVGA 1H38A 3KT8A 1E6EA 1YI1A 2PVPA 2YKGA 4IDOA 1PWXA 2X9LA 4IOJA 2FEKA 3DZJA 4ND5A 1U8YA 3H1HH 3GHHA 4NVRA 3A4TA 1QIMA 2IH4A 4OI0A 4KUGA 4YAEA 1LNSA 2QQ5A 2BSKB 3GNTA 1HH4A 3ORYA 5I3ZA 1U81A 2Q1UA 1Y81A 4PLCA 4Z2WA 1G41A 4HDOB 1KC8H 2UVPB 1W4ZA 4G4YA 5DSZA 3OE7G 3TLAA 2W2KB 4ECAA 2IXEA 1HNNA 4QNMA 4KN5A 4IDFA 1T0HB 2ONJA 3WKAA 1U0OC 2HVJC 1H3FA 2O07A 1HE1C 2VK2A 3TQSA 1COZA 3OCZA 1PL4A 3K20A 4P4SB 1XTTA 3R5JA 5KKAA 2AFRA 4NCNA 3OE1A 4YAFA 2A14A 3RK0A 4R9UC 1M2VA 2CLDX 4JGGA 2C4TA 3FX7A 1MSWD 4F45A 2HP3A 1RPOA 4LCKA 3WDKA 5KYYA 3P94A 2BKAA 4RZHA 2YRFA 3L4BC 1N0JA 3UT5B 1PJ4A 3FYDA 4XSVA 1JLKA 4CJXA 1MHPA 2M98A 5JE8A 3IC5A 3LF2A 1U8TA 3TSZA 1I33A 2UXBB 3EWIA 2WEKA 5BXQC 1LZLA 2HFJA 1RRCA 1QS0B 2CW5A 4INPA 3BTUA 3FTQA 2NUBA 3TMKA 1JDZA 1AO0A 4CLOA 2JGJA 3GI1A 1WXQA 1O4VA 2Q07A 1LA2A 3VR4D 3MJVA 2OORC 3DXRB 1DDOA 4FS3A 3CRMA 3IBYA 5L3CA 1NJGA 821PA 2C7RA 2RHMA 1SQXH 4XWAA 2QMHA 5AOCA 4GZ5A 4RHTA 4IJ5A 5JZOA 4XUEA 1U8UA 4TM8A 4NICA 4I66A 3L7CA 4FS8A 4FZVA 3WFIA 5AVXA 2PANA 5DHTA 2G4VA 3ESJA 4IR7A 1HNZB 5CEFA 4PA3A 2HAEA 4Q15A 1EFPB 5IU6A 1SPXA 1I2BA 3W9UA 4J90A 4CLRA 4QKQA 1GT6A 5CH5A 2O2CA 3CZ5A 4IDAA 4LXTA 4G4WA 5LP6A 4X91A 4IXNA 1P4SA 2WUWE 1U5CA 2PMPA 1CRPA 1V5EA 3N0XA 3KO8A 3G6BA 2NPIA 3LC1O 2BZGA 2RGRA 4RCYA 4L9AA 5F9FA 3F0TA 1ZUQA 4BZZA 4PG7A 4EHAA 1V5WA 2QRMA 1U98A 1F1BA 2F1OA 3F0DA 5IWCA 1B1CA 3F98A 2JLZA 4WGFA 2O8CA 2WD8A 4Q4CA 3HJCA 3FNHA 4LJ6A 3OTFA 2HNBA 3UENA 5F7ZA 1NXOA 4E07A 1T5LA 4OX9O 4FLTA 4O4HF 3ZX6A 4AVYA 4PDMA 3HBLA 3HB4X 4OQLA 2QTVB 4U00A 4A0GA 3E8BA 2P6YA 4FFLA 4B4WA 2I78A 4G9EA 3N0TA 4WCVA 1UBGA 3SR4A 3SX4A 1L7OA 3X43A 2IY7A 3O8LA 5H83A 4FXPA 2VR1A 1EFRD 2BBWA 3MCQA 1NVXQ 4RZIA 4ITUA 7MDHA 2ZJYA 3F7TA 4ZGGA 3BUSA 4MSWC 1OLXB 1YB6A 2R62A 2IYZA 3B1FA 3OOYA 2QP4A 2C4VA 5DYIA 3W8FA 3UHPA 3K8OE 4URUR 5E9WA 3RYFB 1HLDA 2WAMA 3TW0A 3VI3B 2VXOA 2PYLA 1HE4A 4BYMA 5JEEA 4YASA 1ZESA 1DX9A 4C0WA 1W85B 1W0CA 3B2QA 3LC0A 3UJNA 3AMVA 2V6JA 3ORHA 4GBGA 2CVZA 3CRAA 3KB1A 1BCSA 3K96A 2Z6VA 1WB5A 5JJ5A 1JQLB 4ERNA 1NKTA 2Y1KA 3PICA 5IMSA 3RF6A 3DSQA 1L7AA 3WR5A 1VIYA 1R4ZA 4Q37A 3DGEA 3HEBA 5SYNA 2N05A 1TB4A 3GNSA 3RA6A 3Q72A 5KAFZ 2W11A 1YDXA 4C6TB 2A9HA 1D9ZA 4GYJA 3GZ4A 1E4OA 1AROP 1ETHA 2EOAA 4X64O 1YR8A 3PGA1 3FIJA 3J80N 4QPZA 2YXEA 4R05A 5CN0A 5CJ2A 5MN6A 3DEHA 2HV8A 3QTYA 2D13A 3K32A 4EYEA 5B2FA 4ZAZA 1KNKA 4F2GA 2C9CA 2IHTA 5BR4A 2FH5B 1EGAA 3I1IA 4I19A 1NVDA 1Z36A 4D8VA 4BMOB 3ZTTA 4WFBV 1YVDA 4MI9A 1X1RA 3L0IB 4I1IA 2Q1WA 2AKYA 1YBFA 2R47A 2I87A 1UANA 2JASA 1QCEA 1KI9A 1YDEA 3K72B 4AD8A 4V0RA 3ZDCA 4WL0A 1MRNA 1YE8A 5FBLB 4CFYA 5AJZA 4B6RA 3CCMF 4UMEA 2IITA 5JVDF 5D00A 4FSHA 1JVMA 3A14A 1NU6A 4Z0HO 3BK7A 3OZGA 4KUEA 4OA8A 3PUWA 2ZT5A 3QNUA 4ZJYA 1N2ZA 4EQZA 3ZJVA 2EEZA 4MS4A 2ZTSA 3MOSA 1N2JA 4AMBA 4KNWA 5JRZA 3ETCA 4DFDA 1F2UB 4B3SB 5ALZA 2CUNA 3OZDA 2OSBA 3ADBA 2OCGA 2FGJA 3GRVA 3ZWPA 1EDEA 4BHTA 3M0EA 4XGKA 1FXWF 3PVSA 3QVSA 1HLPA 4IJWA 2CKDA 2XXJA 2EP5A 4NV0A 3LH5A 4XGNA 1VF6C 3RS3A 3GEBA 5LM3A 5IJ0A 1QFYA 4YJHB 4M22A 2OB1A 3MILA 1RD4A 3R0ZA 2ZWIA 4GECA 1DT9A 2HIAA 1J8YF 1XHZA 1XRJA 1Q8RA 1YWGO 2HX1A 3RI3A 3KCYA 3F71A 3NGLA 2UAGA 5KTPA 4P5PA 3NRJA 2X2EA 2DWPA 3SBXA 2BKLA 4XUDA 1I2CA 5LMUB 3T1OA 5HJEA 3RH0A 1I7DA 5IM4A 4D98A 1HPLA 4I46A 4RPCA 5KC9A 4RNCA 1XZAA 4XJVA 1T4MA 1U8FO 2R44A 3CRQA 2O06A 2EIKC 4WFHA 1IHUA 4XCVA 4WCEV 1H2HA 1P5ZB 3AUTA 3CKMA 5AXAA 5LL6Y 5K3AA 4JA0A 2XDQB 4WBSA 3EGXB 4MCJA 3DBOB 1JLLA 5EP4A 4A8JC 2PL3A 1ZOSA 1NJ5A 3PA8A 2VPZA 1UDXA 3BM5A 3GBSA 3WX0A 3U7QA 1YQTA 3B7GA 2J0VA 3IPLA 4XLZA 4YJ3A 3LPNA 1J0XO 1PFUA 1CQPA 4GG1A 3RG8A 3V97A 3OQ6A 1B8PA 1ZISA 5EFOA 1NBWB 1GUAA 4UPEA 2W6CX 3K8QA 3BMCA 2YJTD 2L6LA 2H1IA 4JEIA 2GCPA 3GLRA 1VPVA 1E92A 2QZ4A 4JLBA 1VCNA 3GR6A 1Z18A 4NEQA 1NE2A 3L7YA 4O4HB 2X0DA 4DSZA 4BT5A 2XA9A 1XCGB 1VSQA 3TXXA 3TGWA 3MWGA 3CF6R 4YRJA 5HIKA 4I6GA 3L3BA 1Z6GA 1FQKA 1ODSA 1T43A 1H2MA 2RI6A 3BPSA 3TETA 4AKSA 3LQKA 1K9SA 1XZMA 1Z26A 1DEAA 1JKIA 1VP9A 5HY2A 4Z9AA 4UE6A 4RUFA 1XVTA 2HSWA 3IYLW 1XLUA 5C0OE 2I7TA 1M33A 1B15A 3NNNA 4IFIA 1NH2D 4PNZA 3N28A 1ZU4A 3I5DA 4UATA 2FY8A 4HWTA 1QF7A 3LSTA 5JHGB 2Q8PA 3T15A 1B8NA 3ASOC 1WUHS 5CCEA 4IHKA 4LBVA 1YHQV 3HCPA 3I9V1 5HF9A 3TD9A 2UZ1B 1UWKA 3L0CA 1CP3A 1IJBA 5AT1A 3AVTA 3D8HA 4MVWA 4NC9A 2CFOA 4Z7QB 1D7AA 2ISQA 5K1ZA 3B3GA 1WSBA 5JSZA 4MRMA 3A6PC 2A78A 2GRAA 5DTJA 2FPPB 2ZATA 3PRYA 2LKCA 1UK6A 2J46A 2X6AA 3T41A 3BMOB 4QGGA 2DC1A 2C42A 4IDPA 3G2JA 4EEQA 3ANLA 1Q7CA 2HLDD 1XF9A 1DQPA 1QJ4A 5C52B 5GZ6A 5YASA 3WHLA 4FLXA 2IEAA 1YJNF 3TTSA 2ZAYA 4JENA 1IWOA 1AN9A 2PI4A 4XQGA 1QK5A 3LMEA 1XLWA 4QXQA 3VDMA 1Q2UA 4YH1A 1KO5A 4X5OA 4G5OA 3W1EA 4TXLA 3ETLA 4NU8X 3AU8A 4R3UC 4B73A 1LDMA 4MVJA 1XCPA 4DQKA 1ULTA 3S2YA 3FR7A 4X8OA 3RHTA 5AHKA 2MR6A 4B74A 4CM5A 3SDLA 4CM4B 4TS1A 2E5WA 1WX1A 1O58A 1M5UA 1S8NA 1W5EA 4Y9TA 3R7SA 4R84A 3PC3A 2HQSC 3EXHC 3OBBA 3R6WA 3PFNA 4BJ1A 2GXSA 3GLHA 3T3DA 2UYCA 1SVSA 4EB0A 1DGQA 1L7NA 2EILC 5JVDB 2EJBA 1E20A 5CVUA 1X6VA 3KLPX 3IESA 2YQ4A 4YYZA 1POWA 2BL4A 2GSMB 1P7YA 3O85A 5BWOA 4MV6A 4LXUA 5A4IS 2XOKA 3N07A 1NURA 3B9RA 4BLSA 1ADBA 2YV3A 3O5AA 4JFRA 3G1TA 3QHPA 4EY4A 4NULA 1N57A 3ZHXA 2J0EA 1VK3A 4HTFA 4N0MA 2G17A 4F85A 3WFJA 2X5JO 3O3CA 4S3MA 4WCDA 4RESA 4GKJB 4AP6A 2IYRA 1AKRA 2AK3A 3M1IA 3NWPA 4J0JA 4AKHA 5HBRA 2HU2A 4G24A 3VHRA 1W0JG 4IO0A 3AEYA 4P36A 4KPEC 1TZ2A 4UXHA 2ZYGA 4XW2A 1HETA 4CS4A 3R3UA 1C3LA 2H63A 4RYDA 1W5FA 3RS4A 5L53A 2GCNA 3K04A 2GPWA 2V3CC 3W6OA 3E9YA 2W6ZA 5JPDA 4WESB 2Z1MA 3QE3A 3D36A 4AK9A 2ACWA 1FKAO 1E2EA 2V45A 4S04A 2HSDA 2YZMA 4R7CA 2LR0A 4RA9A 3SC6A 4DV4B 5EB1B 3ADCA 5KPDA 2O7NA 2ZCJA 2H7CA 3DPSA 2WE8A 1IUNA 1IM8A 1M90H 2OV1A 4IKOA 4AYXA 1IVSA 4P8RA 4B7EA 3UFXB 3K0BA 4Q4DA 3UHFA 1JEYB 3FD8A 1OH5A 3S27A 5GOZA 1XR3A 1Z4JA 5K3CA 1KFKB 3K8ZA 4PCVA 2YHIB 1T34A 2R84A 5HUHA 1CJTC 3GAFA 3FYUC 3DV0B 3EA4A 3PFFA 2ZTUA 1XTJA 3PVZA 4RCVA 3LWDA 1DTEA 5PNTA 2IEDA 3BMXA 5D84A 1S8AA 3NWEA 2JRLA 2K6GA 3RRFA 1ORDA 1CUWA 1DLIA 3SZRA 3TB4A 1CS0A 4IT5A 2HMVA 2Q3LA 1H6DA 3HV2A 3S1AA 1KC1A 4O4JA 3R5KA 3H4MA 2YV1A 3RK4A 4B82A 3O73A 2ZJ2A 1SUBA 1UL1X 2WWGA 2GZ1A 1LI5A 2HZ7A 3DB1A 4DLUA 1E0KA 1G3MA 4NK5A 4D3YA 4G1BA 3ICOA 4GKAA 2HFEC 1TECE 1OT5A 1YVEI 3OD5A 3IFSA 1KEEA 5I4BA 4JLOA 4RIHA 3KZNA 2FWJA 1C0KA 2X41A 3PPIA 1ZHHA 3FWZA 4M7PA 3DBHB 2PGXA 5AIAA 1ZICA 1KY3A 1U1CA 5JO9A 4PTZA 2RHHA 3FN4A 3KLOA 4HH4A 4LY6A 4UFPA 4ARCA 4DV6O 2IDMA 1R8QA 4ND8B 1I3NA 1UPXA 3IVAA 1N2CB 2A5GA 4HJXA 3WJPA 2XE8A 4IFEA 2OD9A 1JHVA 1I51A 1VJGA 1K5PA 1M1XB 5ALQA 2IUTA 4A82A 3MCZA 3A0HZ 3ZXXA 3EG5A 5JCJA 1P7GA 3V34A 4LN1A 5T8KA 4Z1MD 1ZJ6A 4BVAA 3V9AA 2Y27A 3I0MA 1KI6B 1QYXA 2QZSA 2XUKA 1SZQA 1K06A 4BUZA 3MINB 4OH7A 3FZEA 2V5AA 1A8UA 1DBFA 2PX6A 1LPMA 1VLMA 2ZWAA 3QVXA 4QICA 4DXWA 3OZIA 2VC2B 1K0FA 2WU8A 1XC7A 3BTOA 3LBIA 4ZTBA 4CBVA 3AB3A 3F3SA 5EXPA 3MS4A 5C7LO 1HYEA 4ZGBA 5CX1A 3U62A 1IV4A 3MWFA 1XD2A 2YMPA 2BTUA 1OQAA 1F0PA 2RGNC 3MTQA 2P4KA 4RQEA 3LYAA 3EC7A 1HDOA 3VVLA 4CKEA 3NASA 3FTCA 1RC8A 3TSOA 2NU9A 4AM8A 4NKGB 1EQ2A 5FTLA 4OFXA 1VIBA 2QYSA 2ZRKA 4WNAB 2GFIA 1JLMA 4HZUA 3AV0B 2QD4A 2GZMA 4D99A 3HCRA 5DNEA 3SEZA 2PGGA 4LHWA 3K9AA 2ZFUA 4N6NA 2YIBA 7ADHA 4G1EB 2HC9A 1ZRSA 4BVBA 2A9KA 1JJ7A 3R0JA 1W93A 1YCDA 3NHZA 2A9QA 3QLVC 2H5LA 1SKQA 3K09C 4KDEA 4TXNA 1Q0UA 5LGNA 2CCGA 2XUOA 2VJYA 1E69A 1BEEA 1J20A 4WMLA 3TO5A 1H0RA 3H9UA 1QFMA 2E48A 4FD3A 4IOLA 2XXBA 3TI9A 4ZDKA 4GH5A 4RS4A 1DG1G 2WF7A 1TFUA 4DJFC 4FMDB 1JKFA 2ZNIA 2PUHA 5SY9A 2Y1LA 4IDQA 3AEUB 5HF6A 3VKFA 2EG5A 2VDNB 1JFFB 2XKAA 3ZE6A 1C7FA 1NAIA 1EE2A 1Z4LA 3RGBA 3WJ2A 2C2AA 1UBKS 1ZW6A 3PQ5A 4ALIA 4JITA 2QTRA 4B81A 1XLTA 2I6UA 2RMKB 4RDIA 2ZQMA 3G2IA 2C4HA 1XZEA 3FUCA 4ZEVA 2DHRA 2BFFA 3LDFA 1L7EA 5BV1A 2ZJ3A 3MTBA 4PFQA 2G28A 4KQ1A 1U2PA 2WAOA 3U5TA 3CA8A 1PNLA 2OCYC 2VHVA 4MJ7A 3N6XA 1SUDA 4CT4B 2WAAA 1XDDA 1BCRA 3AR9A 4A3SA 4O4LF 5JAHA 2Q0QA 2UZIR 4OHKA 1F9EA 5T6MA 3X1KA 2ERYA 1EESA 4NFYA 1FPMA 2JGNA 3PGJA 4I5EA 2ETNA 3PQ2A 2BFEA 1KD1W 5AM2A 2OYRA 4YJFA 1XN4A 2WLIB 2VO1A 1DRWA 3FM9A 1NDUA 3ETQA 2CLIB 3ST7A 4ZOCA 3I2IA 3CLUC 4IQ8A 4XWTA 5HFJA 1J42A 1NA5A 4C0SA 5EHXA 3ZOPA 1P7WA 4G23A 2PN1A 3PKJA 2XSZD 3AL2A 1SNYA 4QSMA 3CNQS 4F91B 1AUXA 4GOXA 5HY1A 1TM1E 4EA7A 3D81A 2KHZA 5KAIZ 3ECSA 2IOHA 1CKEA 4B3RO 1HTWA 4KDCA 3EGVA 1T3ZA 4R1TA 1M1KW 3THSA 4ASUA 4EF6A 4LCBA 1EPUA 3PFKA 3ZTYA 3ZY4A 5K51A 1L6RA 2YL2A 3OTOB 1IN8A 3ZGYA 2YV5A 3QX7A 3L8DA 2ZU0C 4FT4A 3KHNA 3GGJA 1NR7A 5BRJA 3S7TA 2QW8A 2ZSFA 5CP8A 5L8VA 2ZULA 1SBYA 1NQVA 4R3NA 3BREA 3TNDA 1WRBA 3GH3A 3SN6A 1OGJA 2B7CA 4Y2GA 4GZMA 4REMA 2ZR7A 2YWFA 3I2YX 4R8CA 2V0NA 2XAUA 1GPKA 3KLNA 1ENZA 4BVJA 1Z68A 4V0MA 5C8DA 3JD1A 3ZHVA 4O2BA 3P30A 5D51S 3UXMA 4MWDA 3CD6V 5A4AA 5CT4A 2FB9A 4ZI7A 1RM0A 5TDHA 3KYDA 2ZQYA 2ZCVA 1DC8A 1QRAA 2VJAA 4B6GA 1QNFA 3CW2A 1M73E 2DECA 1Z6YA 1ZKMA 1XXLA 5L3SA 5LQSA 2WMDA 3PDJA 2C82A 4LC9A 3VPHA 3VSDA 1UI9A 3BAFA 2UUAO 3FVRA 4K0RA 3G02A 1ZGAA 1QGDA 4M87A 2EVWX 3EZ6A 1S2IA 3QYPA 1T2VA 1KR2A 3KXLA 3QXHA 4P4GA 1HT0A 3UJ9A 2WV9A 3L7NA 1GN6A 3MB5A 3VZSA 1O94A 2Y92A 3AX6A 2XE6A 3EEFA 3UHAA 5IT9N 1WZIA 5JPIA 2V3VA 4K8ZA 2W2VA 1M76A 3F9RA 1ZX3A 3ZXUB 2ZB2A 2AOXA 5H3LA 4AIRA 1SA0B 3AF4A 2DJVA 1E2DA 2JCYA 2QUAA 3LPAA 1ZNWA 5AW5A 3T38A 4PG8A 2F8LA 4L0MA 1C9MA 3IP8A 1PJ3A 1KU9A 1XNRB 3ZYZA 4ZI3A 3U4QA 3DLPX 8LDHA 3NFYA 2POCA 2BE9A 3AR4A 4QYIA 5SYAA 1HYQA 4F46A 3ELUA 1GL6A 3KUXA 4DV5B 4M7WA 2X5NA 4R2XA 4JBXA 3K1AB 4KQ2A 3H84A 4QWWA 4GMKA 1P1BA 3OQPA 1XDWA 4ARVA 5HZMA 1O1YA 1EU1A 4EDHA 2GZAA 4M9QA 2A79B 1PJQA 3RGGA 4KHPB 3D9QX 1Y4UA 4BP3A 4UHDA 1IRIA 3G0HA 2C7QA 1Q6UA 2FKNA 1JDBC 3UAOA 2D54A 2WT4A 5TMBA 4QPNA 1GCGA 3VNAA 3URMA 4D8YA 4EENA 2XGJA 5FBWB 2K5UA 3SHQA 3I01M 4LWPA 1I5RA 1TO6A 4FFNA 4U7OA 3NTVA 3FI9A 1ZCJA 2OP1A 3AESA 3DTVA 3HA5A 3ZE7A 1SOMA 3UWMA 4B87A 3MHTA 1JR3E 1DV2A 2O6HA 1EXDA 1DBQA 2P65A 4KPUA 1KA9H 1RADA 6ADHA 1RXVA 2FSUA 1SUIA 1WMDA 2G6TA 4WCFA 1WCWA 2FR8A 4X9XA 2FX2A 1UXOA 2Z2IA 3IV6A 1EFKA 3PWSA 5LQKA 5DNDA 1BXZA 1GL9B 1AS2A 4AXXA 1AK9A 4G1UC 5L95A 1RLOA 5M29A 1YCHA 3JASA 4K35A 5KA6A 621PA 3KAQA 3GVCA 4O4LB 1KETA 2BOCC 2KQUA 1LTKA 1IJFA 1N5LA 2FHPA 3X1XA 1GFWA 3RCBA 2EJUA 3L1UA 2ATXA 1DVRA 1U3CA 3GEHA 4H77A 3N2ZB 2ALEA 4B7UA 1WBBA 1BDIA 5HKKA 1MAVA 1OFHA 1J2EA 1OPXA 4KTTE 2QLMA 1YZ3A 5F7XA 1AT1A 4RD0A 2VQEB 1NVWQ 4RIFA 4B45A 1V25A 5FWXA 4OJKA 4XX0B 4EHIA 1AE1A 3P0RA 5CU7A 4DR1B 4PICA 4F72A 2B4YA 3N2IA 1VGQA 1RWOA 1YFLA 1U5BA 2XD4A 1CU1A 3UA3A 1JBKA 2JJ1A 2WYHA 4DR7B 3PEFA 2YHBA 5IMBA 2HT1A 5IAGA 2I91A 1LPSA 3FAVA 3GWOA 3T1NA 4K87A 1SXIA 1R1MA 3JYOA 2V6FA 4QUAA 4ZAFA 1JQ3A 4PZEA 3ETJA 5IBPA 3FMIA 4PPYA 3U39A 3G0CA 3VBEA 2J4CA 4J1TA 5ITSA 3CB2A 2YS8A 3T3GA 1IY1A 1TAGA 2WU3A 4BL5A 3A1CA 1X7XA 2C3YA 1FFWA 5A9GA 2UZHA 1QGUB 2V1XA 5G3YA 1SKMA 1PZMA 3EQ2A 4NH0A 1CE8A 1GHTA 1TI7A 1SB9A 1UBOS 4JWKA 5JNUA 5G4VC 1L7MA 3DZFA 4HXGA 1UT5A 1MSDA 2QTTA 1Y1KE 4B48A 1UPBA 2VI5A 1D2NA 1YZVA 2W2LD 1NVVR 4XPIB 1XL1A 2DH5A 3EXIB 3SXPA 1QQ6A 4JB3A 2RBEA 4B6SA 4BC1A 3W7TA 4DW1A 3ACBA 3B6NA 5HKBA 4TMFA 4UUNA 4MRSA 1WIWA 4UHKA 4EG1A 4AN0A 4NNJA 2WE7A 1P1RA 1UMCA 4R8RA 1DG9A 1E2NA 1XXHB 1YBAA 5CLQA 1Z25A 3CE6A 2DBVO 4OB8A 1IN7A 4EKWA 4FBMA 1G38A 4NOLA 3NVAA 5E1BA 3OPYI 2PL1A 3NWOA 4CDMA 2V4UA 2WSBA 4OJNA 5AJHA 3ZVRA 2P62A 1RWMA 1SKUA 2F7SA 2X8JA 1EINA 3WNDA 2G5TA 2GDJA 5CW1A 3WTCA 2VKQA 3Q6IA 2O3TA 1Y4MA 1NYQA 1ZK2A 1VKHA 4FLFA 5TMDA 3DMTC 4PLGA 5A6SB 3KQUA 4OJYA 3UC5A 4JI5B 3I37X 3EJ6A 2QT0A 5LQUA 3QE0A 3GJXC 1M75A 1CQJA 1H2SB 1KTIA 1Z08A 3PRHA 4JQZA 4L75A 3IJPA 1YNSA 4NR1A 4KXVA 3JQ7B 3K6JA 3PGKA 3H2ZA 3UPUA 2XXAB 4RZSA 1VQPF 1L5FA 1UWLA 4I5SA 4U02A 3JR3A 3A32A 2VJLA 1A9OA 2XAAA 4PTYA 5FBKA 2HEGA 3UNXA 3BVOA 1GFIA 2OMEA 5FA5A 3EA5A 4YQZA 3SC3A 3TLJA 4CBCA 1DK1A 3PAFA 1FMCA 2MYPA 2MSWA 4BQOA 4FR2A 5CCDA 1ZD2P 4F4CA 3HNOA 2ATVA 3J81k 1MGPA 1BL8A 3KQMA 2PF4E 4O8CA 4ALNA 3X2EA 3MMNA 1NVVQ 1HEUA 3E89A 3LQYA 1YEWA 4BT3A 2KJQA 4N18A 2DKOA 3PUKA 4QNHB 4R40A 1MD9A 1H2XA 2Y4OA 3NVKI 1O96A 4XQ0A 2O2DA 1NNI1 2ZQZA 4QZVA 3ZDRA 2D2VA 3M5CA 4EHNA 4BQEA 4HF7A 3CIOA 3HUDA 1UJ6A 4NCBA 4YT4A 4ZPXA 4TKUA 3PI6A 3PXGA 5E4TA 4KBYA 4JLSA 1YCFA 4PXYA 1S2NA 1VLLA 3DULA 1LJ8A 2FTKE 5KDLA 4ZDJA 3FZGA 3UO8B 1S2LA 4DMMA 2J7PD 3E82A 3HKCB 4GMDA 4ND3A 2AKEA 2QQ0A 1XYGA 4PLPA 1SQ6A 4J7ZA 3W7UA 2J85A 1ILWA 2XT0A 4MWSA 4PA9A 2XAGA 1OI2A 4XPZA 1DIOB 4EJSC 2FPGA 1OV4A 3IKFA 3EZ2A 1A9YA 4BV2A 5E7MA 3QZUA 2FSPA 3BFJA 4L8VA 1G16A 1VLJA 2CC2A 3EZNA 1G5PA 4H35A 1TEVA 3AYZB 4U6NA 5CDHA 1RABA 1VKJA 1T1IA 3PTLA 3OZRA 3HLYA 2FKXA 3ESZA 1JH8A 1NTOA 1S72F 3G82C 2QZPA 3C15C 3OQ1A 1NL3A 4D57A 3IKVA 4DA9A 3TN7A 5BV7A 3C97A 3GW8A 2DWDC 4GPEA 5B3SB 1M8PA 1I3LA 3E9NA 1I6KA 1KXZA 3SJ7A 4TMXA 5CAEB 3HU3A 4R1PA 4IICA 4QFDA 1E79G 4G5YA 2FJ0A 3AF3A 4UZFA 1E3LA 3B6EA 5J5AA 4KO8A 2R7MA 4N5MA 3CWCA 3TTYA 3Q9SA 4DUPA 3S29A 2BO1A 4X88A 5ED0A 1X8XA 2VT3A 4RIIA 6LDHA 1IWBB 4MMYB 1XKLA 4QLOA 2D1SA 1C29B 3G67A 1JR6A 4IF6A 3A3PA 1M2HA 4AY3A 4BLTA 2GD2A 5CD9A 4FDUA 5ICFA 5LBUA 3H3JA 1QVGU 1IZ8A 1P45A 5EVJA 1CV2A 4FSDA 1PNRA 4JB2A 2IBMA 4URYR 5HFMA 2VHTA 3OFKA 1U96A 2Z08A 1HDXA 1KEVA 5LUAA 2QA4F 2RHTA 2OEPA 3R8FA 4DPLA 1Q91A 5LB2A 4BO9A 4CCAA 4YAKA 2PGAA 3R09A 4NXNB 1RQXA 5TGTA 5C9ZA 3IEPA 4TLEA 1N7JA 4A8PA 2MMGA 1BZKA 1VQ7V 5HXUA 1RWVA 1Y8RB 5MDHA 1CZRA 2H0AA 3RVBA 1Q12A 4DDVA 1OIVA 1G4YB 4I9HA 3I30X 4HYQA 3V1YA 4G63A 3DS8A 4FZJA 5AW1A 4B3MO 2AC4A 4RJ2A 2VSOA 1K4YA 3FOWA 1F4LA 5CTAA 3KSUA 3AK2A 5FLXM 4MVMA 1G6OA 1KEPA 3Q0EA 3FOAA 4MROA 3CPQA 1A71A 4UUPA 5U4QA 4UVBA 2NX2A 3QGMA 3HACA 1O97D 3K0CC 3OIDA 3ZEIA 3WQHA 2EDAA 1RFYA 3KQYA 3HVIA 3O9OA 2CWJA 2PBRA 3VZPA 4GPBA 1HR0O 3SS9X 3LVQE 2BFPA 1GYPA 2H0RA 3CCCA 4AURA 4CG1A 3IXMA 2QN6A 2QWPB 2CUGA 2OFPA 4A0SA 2OCCB 4Y30A 3HY6A 3LQ4A 5GW7A 1R18A 4P32A 3GUHA 4MHTA 2DTXA 2CF5A 5I8ZA 2ODWA 3BSSA 4XD7A 1UXJA 3TVTA 3KPWA 5SV2A 4X00A 4EWLA 1VQPV 3QEKA 2GVDC 1B3QA 4N6GA 4Z3DA 4C87A 3O38A 3RVNA 4C8EA 3B60A 3GPCA 2J3EA 1TA9A 3GZNA 4HBGA 3LCUA 4KIFA 2FSSA 1I0HA 4QAJA 4A26A 1UEXC 3SDBA 1N6NA 2CTRA 4BEVA 2MINB 2YX1A 4JYBA 4QNRA 2HYIC 4LC1A 4CVNA 2WM9B 3O8QB 1ATZA 1LF0A 1JT2A 3GLGA 1LUVA 4RVOA 1Z83A 5F64A 4D96A 4Y9SA 3BIWA 3M2PA 2QGZA 1CEEA 3SJUA 4L8WB 2FVYA 1XVLA 3T4EA 1PJRA 3R74A 2R96A 1UFYA 1BWQA 5IZCA 2IHBA 1Z6ZA 2BI8A 1ID8A 4R2HA 5B1SA 1OILA 3OA2A 1OGYA 4GBJA 2FQWA 4ZODA 3DKPA 2N0SA 3OSZA 4F4FA 1G8HA 3MOIA 1KZ7B 3AK3A 1FXHA 4Q0MA 1R1BA 5BN5A 4QE3A 3V7QA 4GZRB 1OAOA 3KZ1E 5BVGA 1TMKA 2H1RA 1LFDB 3OQVA 2D74A 4EPWA 3DHVA 1F2DA 4I4TA 4PXAA 4L6CA 2YBEA 2YWDA 2YN4A 3X1MA 3C3WA 1Z38A 2WYVA 2K4MA 1XI1A 4DDMA 2B9VA 2QUZA 5B55A 1MRZA 1OPRA 3C3SA 1U9IA 3WKEA 1GTZA 4O8ZA 1PNTA 1ONBA 4KQMA 2GM5A 3G2NA 3VYVA 2B2XA 1OZAA 2HF9A 3DP7A 3L0BA 3W5DA 1DBVO 1I7NA 3E7WA 2EQAA 4IGIA 3PWKA 4BECA 1J5XA 5KOJA 3LZCA 3SC2A 5J4LA 3OFVA 5J3JA 2V7XA 2PQ2A 5IARA 2OTMA 4U7NA 1KMIY 2TECE 2FSFA 4A73A 3CT6A 2C5LA 1ZU5A 3STWA 4DLTA 2R3SA 3OC6A 4GPTA 3KQPA 4RUKA 1YZUA 3ZWKA 3H8SA 3W9YA 3SC4A 2E87A 2HJ9A 4ZHSA 4ABYA 4DG8A 2JGLA 3NK7A 1I7PA 2V7VA 121PA 1AURA 4NPCA 2HX0A 2MIIA 5EK0A 2IS6A 4Q00A 1JEJA 3CCEF 5EL0A 2FSVA 4JDPA 1VQMF 3CW9A 3PNVA 1MO6A 1UXIA 3G0GA 4MITA 1BHQ1 2I1QA 1Z8FA 3BJEA 1EGMB 4MUMA 4MV8A 4EB6B 4D92A 3IBGA 2C9YA 5JDIC 1Y5RA 2JGDA 1G8GA 1XZDA 1AKWA 1VIDA 4Z3OA 1KI3A 2NU7A 2QUKA 4KQWA 5DM60 1TRHA 1TCVA 1AHIA 4UCOA 3AHHA 2ZPTX 4Y9RA 5BQ3A 2KX7A 1WA5A 4ALMA 5I9IA 1IHYA 3A1TA 3V46A 4EABA 2C9OA 1RXIA 1CZKA 4C30A 4MTGA 3DBIA 2PPVA 2OZBA 1CJVC 4BDSA 2NQ8A 4P7BA 5TIIA 1MVLA 3EN0A 4HEA1 4WBNF 1GGVA 5ADUS 1RZUA 2XAJA 4BT6A 3SJBA 1NC3A 4X1YA 5CBPA 4HFNA 1N5IA 4U9IS 3I92A 2EINB 1COWG 1OHHA 3N7TA 3H5VA 3PA6A 2AG0A 1R9NA 1VL0A 3M83A 4JEMA 4ZCTA 1E5XA 4YECA 3STVA 2PZMA 3EIOA 1J0AA 4MQ6A 1KDYA 2I54A 4KQIA 1GZSA 4LBWA 4MVCA 4RTQA 3WG7C 4B44A 2X0RA 4LKOA 1RWPA 3CZAA 4BV8A 3W5VA 2CXPA 1UZAA 2GD6A 4Q4HA 4FYJA 3HY3A 2D7CA 4QYSA 4RWZA 4I9FA 4ER5A 5JAUA 2P9QA 1FVHA 3BSWA 1YDGA 1FXVA 3DT6A 4Q4JA 3HI4A 4BJ3A 1NP3A 1WXDA 3D7MA 5HUJA 2I2BA 1FF9A 1FFTB 4HDCA 3U7IA 3LS2A 5JCXA 2IS2A 2PJZA 2Z56A 2J6IA 1MMMA 3ZN0A 4L3WA 1LU9A 4X93A 3PFWO 1A82A 3CKYA 1P31A 3WWCA 3O7WA 4RE5A 2O2JA 1O6BA 2FUCA 4CMCA 1O54A 5B1AC 4DDHA 3MCAA 4IWXA 3CC8A 2HTEA 3KE8A 1XTKA 1QVZA 5F3RA 1EZ4A 3GEGA 3CGGA 1M57C 1MXFA 1J8VA 4KGZA 3LXRA 2GEKA 4UARA 3U3MA 4HAWA 4ACBA 3FFXA 1AVMA 2QTMA 2JLAA 4X8HA 3LSUA 4P7KA 2ZB7A 2C59A 2Z01A 3ZCUA 2OZKA 5CUQA 4RQTA 4P7GA 4V0OA 4BFTA 1JUDA 2I4TA 1L4FA 5FUWA 1YQ9A 4TWKA 1CF2O 1Z5PA 3D0KA 1P17A 4GRDA 2YNMC 4ZOAA 1N0VC 1MJFA 1JNXX 1WP4A 2WIAA 3GRUA 3T5MA 2B4RO 1I1NA 1FYVA 5DKFA 2TRSB 1JE0A 2WWHA 3KQQA 4WASA 3SIXA 4OHWA 2LRHA 2EX4A 5C2JB 4HLDA 3UKJA 2A35A 1RYYA 5EWJA 3IV7A 1WOYA 4JXZA 1U2DA 3WGQA 1L4UA 4WXHA 3N8IA 4FGUA 1TVCA 2KS6A 2ZUFA 1V11A 4ESHA 5JI3E 4HWOA 1ISJA 2Y3IA 4B3TB 3BAZA 2KI5A 1MCZA 1A8PA 1Z29A 1JAIA 3RRBA 4N5DA 5IBRA 4P83A 4INAA 2Z2JA 3G85A 1CZHA 1NSFA 1YV9A 5ES3A 3I1FA 5KJCA 2F4VO 2ORED 2RFLA 5KTMA 4MPDA 1KP3A 3TEJA 1CZUA 3I2KA 2OHVA 3VU8A 2WINI 3B3AA 1SCKA 3S5JA 1C3JA 3CZ9A 2B92A 4PIVA 1SXJD 4UM9D 1OH6A 1RZVA 3VH3A 4MUAA 4TYPA 2PIAA 1GRVA 3DWFA 4KVAA 5FAXA 2FW9A 1GGNA 1GO2A 1NW3A 3ABMC 1I2MA 2OXCA 1VFPA 4D46A 2WRZA 2P79A 3ESRA 4S1TA 1GTG1 4RXMA 3PD0A 5IDVA 2QP3A 3KLBA 4HEJA 4HFJA 5EZSA 3PC8C 1C1YA 3S55A 2ZDIC 4TMZA 4YMWA 3MJ4A 4PANA 4LHSA 3HVJA 1OROA 2BOVA 4MARA 3I58A 3TPFA 1N0IA 4DIFA 3IEKA 1G18A 1FK8A 5BV8A 5A06A 3G1WA 4XUCA 1EK6A 5IS2A 1AA6A 4MYSA 5DP2A 1TRKA 5DCUA 2CD7A 4B4OA 2IPMA 2H57A 1M66A 5JTTA 3N74A 1TM5E 3MTAA 2WKRA 3W1VA 2C95A 4JCOA 1C1DB 4Z1OA 4I3FA 1FX1A 1YFZA 1JHUA 5E6RB 2VRCA 5C37A 1QCDA 1VQMV 4NE9A 3T7RA 3RC8A 2J3KA 1W5AA 4X1KA 5HKLA 3VDNB 3AI2A 2JK5C 1Q0ZA 3PLNA 3D0OA 1DXHA 3KQNA 1NNLA 3D4BA 2QL6A 4XRRA 1X92A 5HGXA 1R0WA 4WBNB 2XNDG 2WHQA 5I8WA 5EXDA 2FCAA 3P19A 4HRAA 1T8UA 3TCUA 1G20A 1JSZA 4QRIA 2QVZX 3AKYA 5EUMA 3BFKA 1HDYA 2JRIA 1YAHA 4R1MA 1VG9B 1GUDA 4PHGA 1OZGA 3D4OA 3OD1A 2ZI6A 3CX7A 1BMFD 1N3BA 1IZ0A 3DAOA 1EX9A 1DP4A 1OFUX 2QX4A 3FUTA 3PHHA 3KB8A 2ERCA 4YY3O 5FA8A 4GF5A 4U7TB 3K0GA 1CXZB 1RKVA 2XUIA 1W5SA 5JWRA 1T2UA 4LKRA 2NW6A 2CJPA 3L1VA 5EUBA 3WYAA 4TLMB 3K9SA 2I1WA 3WWZA 3ZKWB 2DXIA 1QXSA 3A4NA 1Y98A 1PNOA 2TMDA 2R1TB 1L0LH 5IJXA 1TVMA 3MAGA 4QQ8A 1A5SB 4AQYB 2XMGA 3JQQA 3F7NA 3D7RA 1XDCA 2V9ZA 3BMQA 3ZUPA 1WZ2A 1DAEA 3K0DA 4FWIB 4G25A 3P20A 1QDEA 4K2HA 1TQ6A 1Z0SA 4M0UA 2IYYA 1YR3A 4UUBA 3K79A 1MDBA 1R4MB 4WFFA 3N75A 2NPOA 3EE6A 3E81A 3VYSC 1FSZA 5ALOA 3ZRWB 4NEHB 4DV3B 1GITA 3EXEB 2A5YB 3PS9A 1NBMG 1E1QG 4G27B 2DH6A 1V45E 2OMKA 3LCRA 3GLUA 4NWIA 3U44A 2JAUA 5EGNA 1JCHA 2X0LA 3H11B 4C4OA 3ZY6A 4FM2A 4M0DA 3FLMA 1R6NA 1PR4A 1S5PA 2HDHA 3FOBA 1DT5A 1FY2A 3JQCA 2QUIA 4BNMA 1EEXB 1H7MA 2WLJA 4WN9A 1PE0A 2JIQA 3CNHA 3WWOA 3FF1A 1U04A 1YS2X 1H9CA 3E9RA 1JU9A 2XUFA 1KK2A 3BEDA 3TJRA 3UJ3X 2P9YA 2IJHA 5CA1A 3BX1A 5KX5A 1SU4A 1J97A 3IQFA 1N5KA 4RENA 5AKXA 3T4XA 4KYVA 3C9SA 4RFSB 4JUFA 4E2LA 4IQ4A 3A2FA 4J1QA 1GN4A 1NYTA 5IVIA 3JWPA 1P60A 2ZRAA 4B9EA 4BMCA 3G71F 3ZZ1A 1A4XA 5CEJA 1GEEA 5DISB 2FV8A 3DSRA 4P3OA 1FNKA 3CCMV 2COKA 5CCXA 2AI2A 2G9VA 3PEVA 4FMDF 4PLZA 4WZAA 4RTNA 1P33A 4KAJA 3JQPA 2XIJA 3KOMA 4FLUA 1JFTA 3H9VA 2UUBO 1OXKB 2XMCA 4X3CA 5DTQA 3C9RA 8ABPA 5F21A 3R0PA 4FFMA 5EBWC 1RTTA 4QD3A 5ALJA 4LF8B 4CUJA 3IUMA 1NUUA 2HMUA 2QTGA 1AKMA 4FKZA 3FSJX 4JLAA 4XIYA 2GCOA 1WULS 3UYLA 3SBDA 3IIIA 4UVDA 1PL8A 1A8IA 2QEQA 1V37A 1HDJA 1JN0A 5DCWA 4BGDA 2X22A 3UGTA 1OYVA 2BGJA 3WFVA 2X0EA 4TTPA 3LYLA 4N5NA 1G19A 1IATA 4K9KA 5L3GA 3BB1A 3IVGA 2YTZA 4UREA 3OEHA 5FKJA 5HP8A 2RHBA 3RFFA 5EKDA 1UXGA 5HK9A 3R41A 4GE3A 4BAGA 4DVGA 3AL3A 4ENQA 2EHDA 4I8IA 1OX4A 1N8RW 3F4BA 3FBWA 3G0DA 3E7PA 1IXRC 4FKBA 4HQ0A 2XI4A 2F9FA 4QRDA 3EYAA 5FXMA 2YXZA 3WIDA 3NIFB 2B7BA 2ZKLA 2RE8A 4NYIR 1K6XA 1GCIA 4PBTA 1ZPDA 5B7GA 3VOUA 1IWPB 4LJRA 4EI9A 4JI4O 2QJ1A 4UUQA 1G21E 1M34A 7YASA 2FRDA 4JTDB 1JQBA 2HCJB 1DPGA 3BD8A 1Z0ZA 2QVCA 3A36A 4DK1A 1H1LA 3HR4A 3VTIC 5I5EA 1R0YA 1FXKA 3T1YO 2NZWA 3ACDA 3JQFC 3OTHA 1QCCA 2AOWA 3OPNA 4B08A 5KPJA 4C5AA 2GA8A 4LYAA 3F5MA 4CS2A 2NU6A 3QVVA 1YHNA 1KJNA 3ZK9A 4B75A 1J0BA 3PPXA 1G4UR 4G5HA 4KAXA 3JTEA 5ER6A 4LXXA 2CJWB 1S7GA 4FCWA 3V4PB 2OXIA 1QG2A 2ISSD 1E0JA 4NOKA 3P0ZA 4BU1A 1MUUA 2KTUA 4ND7A 1CEQA 4Q12A 4WT7A 4FGSA 3QKRA 3OONA 1WA8B 3ZQ4A 4CGYA 4CU2A 5I7RA 5I9SA 1BE3H 3WLJA 1A5BB 1W8IA 1JLSA 2GFHA 2W2XA 1DIRA 5JS6A 1H66A 3PF8A 3DR5A 4QXOA 3QVWA 1WJGA 1TT5B 1LJLA 4L8GA 4F3YA 3W3AH 2YXYA 2CVLA 3T9BA 1MAHA 4IIDA 4ADSG 3OUFA 4PF1A 1UM9A 2EFJA 3LQRA 1DWOA 4ZP1A 4R5MA 1QR6A 1KKUA 5IXSA 1T9AA 4LYFA 2ZIFA 2H4HA 4C2AA 2WFMA 3NOXA 1XMQB 2GYYA 2PD3A 1O95C 3MLBA 2A67A 2F64A 1PQUA 3HM9A 4DV1O 3QHQA 2RIRA 1XPOA 1PSDA 16PKA 1TYEB 3E70C 4HQRA 3BXPA 3SS7X 2H3EA 5FV7A 5EEHA 3ZGVA 4NYIQ 3PC2A 4BP8A 2GHYA 1JQAA 4OATA 4ALLA 2IYTA 1T5DX 3QIVA 3LGXA 1QTQA 1UK9A 5E9JA 2HXYA 1TCBA 4YRSA 1U7OA 1UBEA 1D2EA 3AVWA 4URHA 2CXRA 1U1GA 3AUYA 1XPJA 1SELA 2AYYA 4HTAA 3ZCVA 1YJNV 3JYHA 3F96A 4UJ5A 1CUJA 3ICEA 1II9A 4G5GA 4UOQA 1DJLA 4Q9DA 4F9FA 1JHQA 4ZBMA 3ZHYA 3R7WA 2PKQO 4J0FA 1IOZA 3SPJA 5E6UA 4LFBO 3RUDA 5LD2C 1QNLA 3P0FA 3RAGA 4CL3A 2DF8A 4E3ZA 4RGVA 3L07A 3VZRA 3TXQA 2FZ5A 3ENQA 1H85A 2EIJC 3EWSA 4RJKA 4L22A 2WTUA 2I4MA 2E5LB 3OJLA 4R83A 3RIEA 3C3EA 1C3OA 3EPLA 2X4GA 4DYDA 1E2PA 5TB5A 4OHZA 2R7NA 1ORHA 2BR4A 2Q6LA 2VHJA 1II0A 2W43A 2J5XA 4FKMA 3AO0B 2ZI7A 5DNWA 1ZN7A 1DJPA 2CXUA 9GPBA 4YXWG 3ZRVA 4P0PB 2HP0A 3MRXA 1P4AA 2CH7A 4F1KA 2RJOA 1V8ZA 3X2FA 3KKKA 3BS4A 3UWSA 4MEAA 3G71V 1R64A 3MS7A 3JRWA 4WERA 1BD4A 1Y9ZA 3GRCA 1N34O 2C20A 1FDVA 3Q85A 5CFNA 3TGUH 2CNDA 4F5EA 3ZQKA 1X7WB 2ZAUA 4WZBB 3P9PA 2A0UA 4A9AA 1RHRA 3EIHA 1DL5A 2IF2A 1N78A 1B26A 3SOZA 1E66A 2UUCO 3QX9A 3BXZA 2C5AA 3HDVA 3Q8WA 3JAWA 5I9LA 4U7HA 2YFHA 1H9AA 2CYBA 3ENNA 1U28C 4KXUA 4PLHA 4RL6A 4C88A 2XF8A 1ZBQA 2GERA 1YBMA 5M04A 1QR9A 5IANA 4DR4B 1U4OA 1MB9A 1QQAA 2L26A 4X7PA 4JS0A 1FP1D 1TPZA 1R12A 1GQFA 1SZDA 2O7RA 1M0TA 1DTWB 3AONB 4BRWA 3TTVA 3NUQA 1ZINA 4XGQA 5KTNA 2X77A 3A05A 4W9NC 3RJMA 2PUAA 1WCIA 2ZPAA 3UOGA 1T2NA 4JXXA 5GVRA 3RHZA 4CFSA 2NAFA 2GDZA 1K73W 1R0SA 2HQ1A 4B40A 1YJWF 2R2AA 2HADA 5IK2D 4LI3X 2VHXA 2XWBF 1ZXBA 4OGWA 3CRNA 5AW9A 1RQLA 4BEJA 2RAPA 3FGOA 5P8WA 1KYVA 3GRFA 3I28A 2GZRA 2NTEA 3IDSA 2VQFO 3FFTA 1X38A 2XWJI 4Y2XA 4HWGA 3I01A 4B47A 1WSDA 1JDSA 1ZC3A 2GRJA 2RJNA 2VAPA 4ILEA 5KNBA 1T0IA 1CERA 3AWDA 2XYVA 3E8MA 3FZQA 5EPOA 4DEYA 3LFOA 4BVRA 2GN2A 1GNRA 3NW9A 1XJ0A 2Z9BA 1MZFA 3ZCXA 1JD1A 4POAA 1KKLA 3QA9A 2PGOA 4XE5A 2QK4A 2NXWA 4QYTA 3N70A 1PFGA 5DRTA 2SKEA 1Y1TA 3HB7A 4F5ZA 1N9GB 3ZXYA 1UUFA 4RK0A 4HOYA 3OAAG 1PJAA 3ICCA 1PDWA 1L8LA 2B5OA 1NONA 4COOA 4U2EA 4JI8O 4C2UA 2ZVYA 2UKDA 5ETJA 3LT4A 4LRTB 4ZVQA 4B6FA 1O9BA 2QRUA 1OIWA 1TJ5A 5HE8A 3FPIA 2EKBA 3V8MA 2ZVQX 2O0MA 5BN3B 2O5RA 1C30A 5C1OA 2Y4NA 1FFEA 3I9KA 1U1EA 3E0QA 2IJIA 1X1AA 3A9SA 1ATIA 2QR2A 3W04A 3L9WA 3BF7A 1GKIA 1MDFA 4OKIA 3BGDA 4H3VA 4K6HA 4RPGA 3L73H 3PQCA 3CZQA 4ZVVA 3F74A 2IRWA 1ORQC 2FYUH 3FTFA 1QWSA 3CC7F 3FMOB 3RQSA 3KZIZ 4XJXA 3UA4A 2M6LA 3ICVA 3GIDA 1SVKA 2EFYA 4CMHA 4R6ZA 2DYSB 2RAUA 5JXWA 1T4GA 1R6VA 3SCZA 1QB8A 3AHJA 4Q7JB 4U7JA 3H0KA 4OVKA 3F46A 4CUKA 5DM2A 3UZUA 1H2LA 1W4CA 1BDJA 2AGAA 4BGVA 5KU1A 4UV8A 2GEJA 2FPLA 3WK6A 1BHSA 3W6NA 1PIWA 1WDKA 5MHTA 1CP2A 3KVRA 4PHCA 4CIWA 3F67A 2JA2A 2JS7A 4ZZIA 3ROZA 4GXRA 4TSRA 2HA3A 3IEIA 4IDBA 1KB9F 1PF7E 1S77D 1BE1A 1K86A 3B3JA 4HD8A 4XXHA 2X5XA 1ZK0A 3C5EA 4PQGA 2Q9UA 1AH2A 1WDWB 5FO1A 4DLBA 3A1DA 1MB2A 3HXPA 4HMQA 1JJAA 3JV7A 5DBOA 3N4ZA 2V7EA 1D07A 5A05A 1XV5A 2IXGA 3SEQA 2NACA 3VVCA 5JADA 4QATA 1U1IA 4F2WA 3M6IA 3L93A 2DBQA 2VTBA 2XZTA 4ARZB 2PMEA 1C50A 5DT9A 7REQA 3DE4X 1LCIA 1SQQH 2FZKA 2Z2XA 2ZQ5A 3N5KA 3FLEA 1W581 1XHLA 2JFFA 1E7YA 5DJ5A 3NOQA 4BWAA 3DBVO 5LHHA 5D7BA 2C8KA 1Q81H 1C4WA 3L74H 2XQGA 1H8HG 2HS0A 3RVMA 2QKYA 1YI8A 1HT2E 3OIGA 4EPTA 5KJ6A 2ZBPA 3QW2A 1U8AA 3OC0A 1NDQA 4L4RA 9ABPA 5JSUA 2HDWA 1A9TA 1DHRA 2H1FA 4JT9A 3ZMSA 3KJQA 1FFSA 3GU3A 2EQ5A 3VU9B 4JLWA 1SF9A 3NYQA 1XDZA 1YR9A 2P67A 4YDHB 4ZOLF 2QVLA 4V0LA 3MBKA 3RWBA 2YOGA 4OJMX 4ZEWA 3U4GA 3ZWBA 5B4UA 2DPLA 1QP0A 3YASA 4BY9E 4M1ZA 3RYHB 3QLEA 2WVAA 1J5PA 4ZIRA 3VDQA 1Z28A 5TISZ 2PMBA 3HR0A 2Y1CA 4HAMA 1NUSA 3O1HB 4QFCA 4BNHA 4PELA 1Q1EA 4J03A 3ZGLA 4MUHA 4M0FA 1HDCA 1TMGE 3KQLA 3ZBTA 3EGDA 3GFGA 4AJ1A 3DMYA 1I6LA 1DARA 2OBFA 4Z8XA 4JB0A 1C41A 4DIOA 2CBZA 1OJLA 2NVUB 3SZOA 3PDIA 3IEUA 3S3XA 3HV0A 1L5HA 1YJWV 3U81A 1SUFA 2PYIA 2YC2C 3SMQA 3GBPA 2YIAA 2ZJBA 2FB5A 3OCVA 1UBFA 3JU3A 1M83A 1SHTX 5FR1A 2PM8A 3T34A 5HCNA 4LHVA 1X2BA 4JHLA 4Z4FA 1X7HA 2GLZA 2A9OA 1LLCA 4KE6A 1L4LA 2FMTA 3NHBA 2BTQA 4PLYA 1MAWA 3B89A 1UOPA 1SC6A 3NALA 1XLVA 1DAPA 2J87A 1GK9A 5BVHA 4G01B 1C7ZA 1C1HA 1WOMA 2JFWA 4KXNA 1Q16A 2BUAA 4W7HA 1A8QA 1RAFA 2Y1EA 6Q21A 2EZOA 2ADQB 2C84A 3SG0A 1ZUD1 2JIRA 3AZPA 4D4JA 2I2DA 2J59A 4M54A 1EFCA 4J2TA 1EVJA 1LRLA 4IEEA 3ABLB 4F6RB 4KDRA 2QVGA 2R97A 3F3YA 4GBED 3CYQA 3IVMA 4Y7CA 4H6XA 4K6FA 2V6GA 2JJ2G 1F9AA 1M6HA 4XIGS 4PXSA 3UN1A 5LP6C 3SZLA 4DLVA 4BCDA 3SKVA 2PXAA 3ROTA 2Z1TA 1JEOA 4X6YA 2EBOA 4TVKA 2NU8A 1Z0IA 1MC4A 1XMSA 4JYYA 3NXKA 5AESA 1GUFA 4ER7A 2FG7C 3LSSA 3WB2A 5TVGA 4R2MA 3CC7V 3GOHA 5CJJA 4W8GA 2FFAA 1Y5NA 1NQTA 3WYDA 4NAUA 3PXXA 1Y7LA 3T9FA 2ZSKA 2VDPB 1NPYA 2CL6X 3W1WA 4RS3A 2PH3A 1KE2A 1OI7A 4JUAA 5E4JA 2A1UB 2AL7A 5KHGA 3WNQA 5GMOA 1AJQA 3VR6D 1W88B 2GJ8A 1VJ0A 1DS6A 2I4IA 2I0FA 4OXYA 2M9MA 4Q20A 1F8YA 2MYNA 3ZIAA 3H4TA 1HF3A 4B3JA 4BZQA 3GT7A 1STOA 2E4UA 3AUUA 4DZRA 5IKPA 5A4MS 3TQQA 1VC2A 5FADA 2WSSD 5IEBA 3URKA 4E30A 5JS8A 3G5MA 3I05A 3WE7A 1ODFA 4Y0NA 2Q4PA 1B16A 4EZIA 4OB6A 2EJRA 2KG7A 4OXRA 3RBZA 3NT5A 1NBME 4N1AA 1G5IA 2Q46A 1GIAA 1TC1A 4C6SA 1A32A 3GJSA 1GLVA 1B8OA 2PD4A 3GA7A 3VV3A 3AP2A 4PC7A 1AQLA 3DGEC 4Y1RA 3SYKA 1H8EG 2DUJA 4FM1A 4JVMA 1QHIA 5FLXA 4IILA 3QVGB 3R75A 4QU0A 5FYDA 4J94A 1JHOA 2X4IA 1F3OA 4YWJA 4HGOA 3MQFA 4DUGA 5A1TA 3HUFA 4QWMA 4KR9A 3CWQA 4KOAA 4E2XA 4E6PA 3AG7A 4OAPA 2FA9A 1KOJA 2GYWA 4MUIA 4MW0A 2V6BA 3ZI7A 2F95B 5CHYA 1M5TA 3S2SA 5DGXA 3KELA 4TOIA 1XOIA 3WO1A 3O8NA 3QWHA 4ZOLB 4NZOA 1V6SA 5AKHA 1QPGA 1E4YA 1RZRA 1QG6A 1J2RA 2JFYA 2JRCA 1GVNB 1AJPA 5D3QA 4GI1A 3TEMA 3MT9A 1RYNA 1GO1A 2EFHB 5K3SA 2C3OA 2JLVA 4UVEA 1QE0A 5JAQA 5SZJA 5CVJA 3SZ3A 3OZVA 1G3UA 1Z6AA 2BN4A 1GPYA 1NV9A 3UGJA 1T6YA 3AHEA 1EBOA 2LO1A 1XMVA 3OEED 4URVR 5AXCA 3TAXA 4AX4A 1P19A 5HUQA 4W6ZA 2ZTMA 3GT4A 2FGYA 4RKFA 1OB2A 2WUDA 4H7JA 1F12A 1T5EA 1HBJA 3G13A 3N8NA 2W6MA 3DCNA 3V1MA 3FFMA 3AY6A 3G1UA 1XCMA 1MW8X 4ECEA 3ESCA 5FBQB 1EUDA 4TTJA 2OXFA 4K9NA 3GLSA 5K8LA 3M7IA 5LWQA 5CFOA 5K8UA 1AX9A 1E1LA 3SX2A 4WACA 3U26A 1FAFA 3ZWDA 1Q90D 2C5FA 3JRNA 2WPDD 3ROEA 4NPAA 2Q3EA 4K6MA 1VYUA 1V43A 4PX5A 2E7ZA 2RAFA 4WOKA 5CM2Z 1BQ4A 4XR9A 1DUIA 4RMNA 1F4PA 1DBSA 8AT1A 3MAJA 3VO8A 5IULC 4CMBA 1YA4A 2AJTA 3QK7A 4R4JA 1Q17A 3CMEF 3ENVA 4HS4A 4ZK7A 3U3RA 1BVRA 4UNQA 3GNLA 3A8TA 4K6KA 4IGFA 3I2FA 2IYFA 5AM3A 4BMNA 1D2HA 3S2ZA 3K0AA 4XSHA 1WPRA 5DM6V 2FZLA 5JT1A 5JECA 1RP1A 2ZU6A 5FV4A 1BSVA 1JHPA 1T1EA 3ETEA 4EKYA 1Q95A 2H4ZA 4E5VA 1YBHA 5EMJA 1P9RA 1YRYE 4HAZA 5LSAA 5E9AA 3GG9A 3V1KA 5DTIA 1N5OX 3FWPA 4BB6A 1VIMA 1ECJA 4PO8A 3KU1A 2EZPA 3H04A 3OQHA 1WE2A 2PWBA 4HLUA 2BFCA 2YXDA 2HT6A 3Q8LA 2BUBA 4O2AA 5E6SB 3FLAA 3I8OA 4PGAA 3CR7A 1I5OA 3VR4A 4DQDA 4QU8A 4AB1A 3DA8A 1QFZA 2HV9A 3QY0A 1RP3B 3FHTA 5FOTA 3DCJA 4YRFA 3WWEA 2IGBA 5KYTA 1AP6A 2AIRA 4Q3AA 4D74A 3MJFA 3GCDA 3MXOA 3K1YA 4UVHA 3BCCH 1N33O 4RO0A 2WOJA 1UBSB 1D04A 3F6SA 2OWEA 3HLKA 1KY5A 1LC0A 2YV4A 2Q5IA 2HRRA 4UU1A 1WBJB 4IXTA 3UV6A 1Z5GA 1K9MH 4F5DA 4GZ3A 3A1VA 5E7QA 3GH1A 1SCUB 3EHBB 4IYJA 1H2ZA 3VU1A 5LHIA 4PYOA 3ANYB 5K0LA 5IAKA 1I2DA 2CV1A 2ETXA 3OESA 4XFDA 2JCBA 2LP7A 3F47A 3OOSA 3ZE9A 3IB3A 4M36A 3P9QA 4ZAYA 1F4MA 1MT3A 2SKCA 4DCVA 1ISGA 4TKVA 3CR8A 3FG9A 1HDGO 3D5EA 5IXYA 1F20A 2P9HA 1UZUA 1JIKA 1BGVA 2OHJA 1PZHA 5DHPA 3JQRA 5HJ7A 2QUBA 2G1PA 1C4KA 3CONA 4N3AA 2JFHA 7ABPA 1E7MA 1ADGA 4LQLA 3C2QA 2ODAA 4BFUA 3QEBZ 1U94A 2RC6A 4TT3D 4ZREA 4U1RA 1N8SA 3QXJA 4A0FA 4BBPA 4K28A 3FD5A 1DKUA 3C0KA 5F23A 3EHEA 4PEVA 2O2IA 2OUKA 3USES 3ZE2B 5CM8B 2XAQA 1HQCA 4TN5A 4ITRC 4X92A 3E2EA 4JP3A 5FBHA 1OFGA 2P3LA 3ZOKA 4DEVA 4FDTA 3A1UA 4X6UA 5AVMA 1S2GA 1YOVA 1EFRA 1X1SA 3TL2A 4ZEOA 3GCWA 1Y66A 4H7PA 3HEAA 2JHAA 1R5JA 2IIVA 5CA0F 1Y74A 3ETGA 4B8WA 3FDJA 1M8JA 1ZY2A 3OMLA 4NF2A 1L6IA 3VOAA 4Z9BA 3MVEA 3QYAA 5F12A 3D8UA 3TQCA 4DLXA 2VLBA 4HPJB 4YROA 5B58C 1XV2A 2FP3A 2JDID 1IX9A 4ZAGA 3KZXA 1PN3A 2V7BA 2G4CA 5KTOA 1VQ4F 1UBUS 3U5ZB 1Y4AE 3S1LA 5KJEA 1XKTA 1YKSA 3ZWXA 2AMTA 1YU6A 4CS3A 5DBEX 1JZTA 2PGJA 1CT9A 1W4BA 1FP4A 2O48X 3AP3A 3H5WA 4W1SA 5DYYA 3AOEC 4X0EA 3ULKA 2EBUA 3VSAA 2EKQA 1ZJ4A 1J0EA 3JQEA 3ND6A 1XP8A 4QELA 4ZZ1A 5HQ3B 3U7GA 4E1AA 3JQ6A 3AJEA 2P2YA 1EJ2A 3KJGA 2F59A 1DJOA 3L01A 1DKPA 2V8OA 3HE3A 3ZK8A 3MSCA 2Y77A 1S72V 3F4KA 2WZBA 4S1WA 3KKQA 2LCQA 3GWZA 3W7AA 5DK6A 4NBNA 3AJAA 1SUSA 3MUNA 1SQBH 4W1RA 3QSGA 5EJ9A 5B53A 2ZUCA 1I5EA 1T9HA 4HJRA 4OQMA 4HRVA 4PA7A 5FUYA 4N9QA 4ZYWA 2F8TA 5CFPA 5JJCA 2Q5CA 2RK4A 1J6UA 3LUPA 1WXEA 1OLSB 4JLDA 3I3FA 1JA1A 3OETA 1DAOA 3TOVA 4NPHA 2WG2A 3ECCA 5DASA 1WY7A 4KEAA 3JSXA 2G8LA 2P9TA 1JR2A 4Z6KA 3Q9NA 1DO2A 2IOFA 3D36C 4QASA 2W00A 2CDBA 1VE9A 5B1DA 2V6MA 1GKKA 2FMKA 3NHPA 4C7UA 1CR2A 4ZI5A 3OR7C 1DG3A 4RULA 4LZPA 4GM4A 1P7PA 3HPRA 3KOXA 3KJIA 2QA4V 4YT8A 2CVPA 1CCWA 1BHJA 2E5FA 4MYRA 3LBYA 2H4FA 5D3KA 1KDRA 2QW0X 3TD4A 2ODTX 4EW3A 2Y0EA 3BILA 5B7QA 2HCTA 3P2YA 2HJGA 2HCRA 2L0XA 3EMDA 4ZO9A 1W9MA 3R77A 3FCXA 4KTVE 3INYA 2QE6A 4DWVA 3D4LA 4WLFA 2DQ4A 1E9CA 1GQSA 1XA4A 1KGDA 3RS8A 3IDZA 3REQA 1SETA 4KOEC 4AF6A 2YR0A 4WD3A 3IMFA 2F9MA 2DSNA 1H3EA 3LHKA 4CDNA 2Q5QA 1SRQA 1VL5A 2QPAA 4EGQA 2Q4BA 2QDXA 2V58A 2Z09A 2EEPA 1VF7A 2OV2A 5DIZA 2QM3A 3LWOC 2GZ2A 4EEXA 2JAPA 2P0YA 4A2WA 4UKDA 3OIFA 1QSGA 3AWIA 4R6XA 2PMDA 4H7HA 4IFTA 4RH1A 2ZIGA 4DY6A 2C4WA 4G0VA 2C2XA 1U97A 5K6AA 2OTCA 2PAFA 1L5QA 5H5JA 1S3GA 2E2WA 2BJWA 3ER8A 4B3HA 4U7GA 3FJYA 4DT1B 2VSQA 3D00A 1HDRA 2PS1A 4BTVA 1TL7C 4L0CA 3UPTA 2BEUB 3BRWD 1I7FA 2ONKA 2R6HA 1L4YA 2BDTA 5EIBC 4NE7A 1DT3A 1WP7A 3R24A 3RVOA 3ED1A 1OTXA 4AMZA 3OT4A 2IEYA 3SSAA 1Z0DA 1Z5UA 1DHTA 2PJRA 3HDYA 2XBUA 4P98A 2JEUA 5B1YA 3RC9A 2HXSA 4HK4A 1X59A 3VYTB 3C7DB 4UTXA 4AZWA 3CF4G 4AO7A 3EISA 1YTFB 3HWX1 4B8ZA 2IP4A 4JOQA 1IEQA 4KWHA 3CH7A 3EGEA 3M3PA 3A1EA 3P4XA 4QVGA 4ZHQA 2HIGA 5CA0B 5IC6A 4CF4A 5INTA 2VRZA 1HC7A 3DWEX 3WSWA 1W57A 3AUKA 5AR1A 3C5VA 4O3MA 3BC1A 2VQDA 2Z57A 3IUJA 2VJQA 1NBIA 1W49A 2W6QA 4YJKA 3OW2U 2F55A 2CFTA 1QBGA 3G6EF 4OGFA 1E0SA 2NQ2C 3LUGA 5SZKB 3AFNA 4AJLA 1FP7A 4NBSA 2UUOA 4JBWA 1QH8A 1E96A 4UU7A 1IDN1 3IT0A 1RRGA 3ZWOA 5EKTA 5K8TA 1EK0A 3OPYB 4D4MA 1EAYA 1JSCA 3VR2D 1DZIA 4J7JA 2ESRA 2HLDA 2NT3A 3BHJA 2GTIA 2GKOA 4P38A 3CF2A 2A5JA 2QLLA 3G7SA 1VQ4V 3MJTA 2C0QA 3L46A 4JX9A 3EEQA 1L7XA 3OTIA 1KKMA 5GJWC 3EWAA 2Q0XA 3GQVA 4O1IA 2IP1A 3U4IA 2QMQA 1FS6A 2EL9A 1LBSA 1Z5VA 2P4UA 5B2EA 5EQTA 1JNYA 2BMWA 2GBGA 1SC4A 4GM1A 3UQYS 3ZYCA 5EJMA 1W5TA 3L4SO 2OWOA 1NI5A 4DDTA 3ABKC 3PE4A 3E5HA 1P2VA 4K3UA 5AHOA 2I2WA 3GMTA 1M67A 4EUSA 3QUWA 4N12A 3C1AA 3LNMB 2ZP1A 4HNGA 4RY9A 1UKBA 4JAVC 4ZN6A 3H8VA 3G68A 3O75A 5T6BA 3IJ4A 3M9WA 3S06A 2HPAA 2DYRB 1C7RA 3C48A 1ZI8A 4RQBA 5BY1A 3CCEV 1RBQA 3EPPA 3K9CA 3RD5A 1XRSB 1GG2A 2DRIA 2VJBA 4RLFA 4JI2O 5HMLA 3ASNB 4F38A 1D9XA 3ZDQA 2CFCA 2EF0A 5IKXA 4WXYB 3T5GA 1E2MA 3P97A 2WJPA 5ALYA 3DVLA 3S03A 4ISCA 5DXJA 4QUDA 4A1OA 2WWXA 2OYQA 1LPBB 4F9TA 2H52A 2ZS7A 3Q3CA 3EARA 3O47A 4N0QA 4EG5A 2YJ6A 1Q84A 1AZWA 4WOBA 4XIFA 3OT1A 5LC1A 2CLCX 2YYYA 3KVNA 1R4NA 1XDSA 4GOLD 3CCVF 3KYCA 4QJ3A 5TT1A 1JSXA 2JK0A 4DMLA 3QHAA 2XGGA 1N2XA 2C8JA 2B1QA 2IHVA 1YTLA 1HYGA 2GH1A 4UBOA 1PV2A 1JY8A 4AY4A 4YCCA 4GSYA 1P1KA 4Q3BA 4GKKO 4MX8A 1P3Y1 1RAGA 2EERA 4RE6A 1PWZA 4I1VA 2YJ3A 1IAVA 3UAWA 3SIRA 1DELA 5I4IA 3H2BA 1FFXB 1ZGCA 4NMMA 3I52A 4Q7EA 2HU8A 3VC3A 3C74A 4ZZ0A 5A2GA 3BWCA 1RI5A 3U80A 2P9JA 3CZPA 5IY5B 1KAMA 3PWZA 3BD7A 4H15A 4REQA 2Z8XA 4KL8S 3W7VA 3W5BA 4BUCA 2VYCA 1WZUA 3HJRA 2PZBA 3THRA 5JY1A 2ABWA 4ND2A 1E2UA 3OOEA 1W34A 4RTSA 2JLQA 4RVCA 5AK4A 1HL7A 1QAMA 4TM7A 1BC5A 1I3KA 1G291 1JIQA 4RSMA 1N9ZA 5EPEA 4DSOA 4KFMA 2Z5FA 1JHXA 3D4NA 1D1TA 1RDFA 4AX8A 5HF8A 2FEXA 2GN1A 3DLIA 2PKCA 5EWMB 3V8BA 1XEFA 3UCEA 4YHHB 4P0TA 3DHYA 3O21A 2C1ZA 5KSPA 4YQFA 2FYTA 2JIZD 1ZJYA 5KNCD 4OI4A 4FMBB 3P0HA 1KC3A 3C9UA 2OBNA 2PV7A 1LF5A 2OZPA 3SJAC 1AIPA 2GHQA 4K9MA 4DN6A 3GB7C 3BZUA 3ORRA 3S2IA 3BQMB 3K35A 3VHXB 3WZLA 4K0KO 4JMLA 4DM4A 2PZJA 3EMVA 4KXWA 2FFJA 1SU6A 3G88A 1Y9AA 3JS5A 2NXCA 3T1VA 2OBXA 3CURA 3ILYA 1WAMA 3AR6A 3K9LA 3EF1A 1QMPA 2ZD9A 2FWMX 4P4UA 1V4VA 1XL6A 5AKJA 4H37A 3K05A 3DNPA 1BFDA 4XWWA 3AGPA 3NUGA 5KYXA 1O94C 3H0EA 3CBGA 2BEKA 2ZG6A 6REQA 3VNBA 5AJTA 3LPLA 3MN1A 4YCBA 4QNNA 4IYHA 3RF7A 2ZJ0A 3W5HA 3DVRX 3K9HA 2Q99A 2WZDA 1QUFA 2IK8A 1K6JA 2QW1A 1TFRA 3QLTA 1J1ZA 3FNQA 2J4FA 4U0KA 4DNQA 4H1UA 4QGFA 3DWIA 3G6EV 3Q3EA 3HXKA 1XEXB 5H16A 1X7YA 3VX4A 1UOOA 4ZGWA 5ALVA 2G67A 1E1DA 3O8BA 3AI1A 5LOVA 3KC2A 4Z0PA 2OESA 4QUIA 3IFXA 1ISFA 1WXHA 2KB1A 1TO2E 3ISVA 3SM9A 1NUPA 4QOJA 3QU7A 1ND5A 5A4DA 3JD4A 3NTXA 3WLNA 2VT6A 1Q92A 1BS9A 4EZEA 2WNHA 2JFOA 1DF4A 1X52A 4NDAA 5GP1A 5JLAA 1SCJA 4Q1FA 4QC2A 3W4JA 1VMKA 2C5EA 1NVPD 1G60A 4YCNA 2VDQB 5TSDA 2ZREA 3DE1X 4RAQA 1F4NA 4DCGA 4US2R 2FWRA 4DLPA 4G6ZA 4AZ3B 1NF8A 1XAIA 4I5DA 4AY2A 2LCIA 5LXTA 1QGYA 4XDHA 2OIGA 4J4TA 1OD6A 4COKA 4EYGA 2G1KA 2R72A 2R5WA 1Z7GA 4CCSA 1O0CA 1GZ4A 4ENUA 4D97A 3SPXA 1Y6QA 1Q7EA 1E9VA 1U3UA 4WCFC 2DQZA 2FR8C 3CKKA 1KMQA 1BIFA 3O84A 3FGPA 2P0EA 5EQJB 4AZ0A 2Q5FA 5LR6A 2A9VA 1HL3A 2I7VA 3IQXA 4EW1A 5DSXA 3D6UA 2V3WA 3KTAB 4EI8A 4ZVTA 3PRKE 4MPRA 3GRKA 1ZCFA 3DKKA 2QBYA 3HKEB 2GZDA 3UCSC 5DF1A 2FFHA 3TIFA 4ACAA 1XD8A 4UM5A 1E2IA 2Q49A 1PGPA 1ZCAA 3PXCX 4FHDA 3C3CA 1PG5A 2OLKA 4PPFA 1T1JA 2GSWA 3M4ZA 4HX2A 2HMTA 4EGJA 5DM4A 4CODB 3TS1A 2PUDA 3UCXA 1CIJA 1O6ZA 3V5NA 2X1MA 2OV6A 2ODMA 1FSPA 2IS1A 3C1TA 3TZQA 4NUTA 5E2IA 2VZ8A 4MVJG 1P80A 3L04A 3GLFA 2FZWA 4YDQA 3HADA 1YR7A 2EC5A 4HPXB 2VPXA 5JS7A 4TKZA 3LRXA 3AM1A 3IOBA 3SGLA 3CCVV 4LQDA 5CJPA 3H18A 1KFJB 3TB6A 1CY7A 1X1DA 4HT3B 4J1TC 2DUNA 2O4CA 1PI3A 3WA6A 3ZGXA 1UF9A 1JQ0A 4MS1A 3LV8A 5G3ZA 5EZYA 2OV4A 1AHHA 2DHDA 5IJAA 3EFEA 1E5QA 3PTAA 1TW2A 3CWZA 5FI5A 3KWFA 2XOKG 3E5MA 5U4XA 1GZ3A 4FGZA 5DZSA 4OOFA 1XZIA 3TG8A 2X7HA 5E4FA 2XSZA 3IOMA 3Q9UA 4EG0A 1NOKA 1U2GA 1VBNA 1FBNA 3NKVA 2RARA 1Z17A 3IC9A 4NTXA 5ER9A 4ZRDA 2UU9B 4K86A 3GYQA 4PC2A 3QUQA 3KJXA 4V1CI 4EITA 5EGSA 1JF8A 5CGQB 1UJ4A 2ID8A 1GV0A 3SKYA 3Q3IA 5DNAA 4MKRA 4BQNA 2FEAA 1PNMA 1Y48E 4IVNA 4LF4O 5M3BA 4BQSA 1VJDA 4JGBA 1ZJZA 4CKBA 4OI1A 2VRWA 1DUVG 3EZYA 4GLBA 4MKGA 4AG3A 2F43G 1VXOA 2C4KA 3HJNA 3AYXB 1EXMA 2IYPA 5K3EA 3KK0A 4BB9A 5TF0A 2QVBA 4UCTA 1CYEA 2PL9A 5BMVB 1W36D 3UH1A 3H7IA 1MQAA 3CKLA 4DTCA 4CNQA 3EPHA 4BGEA 1T3HA 2GUZA 5AVZA 4LF5O 1H94A 2W22A 4WY2A 1EX1A 2I71A 4EHJA 4IH1A 1ZL2A 3IVRA 1T4DA 1ABEA 2J9YB 2HJWA 3UJDA 3HY4A 1QFSA 5KUMA 3NMUC 1QAQA 3DMPA 3NRBA 5DWVA 2GF0A 3HYTA 2LPMA 1GD1O 1JQEA 4RFVA 2DMRA 1M56C 1NJ8A 3HXTA 4EVSA 1KU6A 2R8ZA 4OU5A 3LY8A 5DCYA 4QAQA 2DT4A 1GO3F 1KEUA 3N9IA 3JATA 2PGIA 4KO1S 1IZYA 3BE6A 1XNQO 2O8EB 1J24A 3UO3A 3FTDA 2V1DA 2G1UA 1FS5A 3FNEA 1CZNA 2VQSA 3JVHA 1KJWA 1MAUA 1OXBB 1E9FA 1ZHOA 3OZTA 5GZ1A 4HXYA 1ZLYA 2AEEA 3F9CA 3AK1A 3OLZA 3CMMA 2YI8A 3KE1A 1BDBA 4DLZA 4NK4A 1O0BA 2FZGA 3AHDA 3E5RA 1KQSF 3MYYA 3DE5X 2GBOA 3UUWA 2EIKB 2OYSA 3SICE 1MA3A 1IXSB 3RIMA 3G5UA 2F66C 4HEA6 3GX1A 2BFDB 1N1MA 3DXXA 4OHCA 4TL8A 1K5GA 4FGKA 4V0SA 1BYIA 4YVFA 1URPA 1GJRA 4UXJA 5ALDA 1JJ2U 3I2HA 1NI4B 3NORA 3N5CA 4LJ9A 1R3LC 1HEYA 4L16A 1IL0A 1NJIW 2QSAA 1QKIA 1UMBA 3RYTC 3PC6A 4EAAA 4KITB 4QDOA 1RHUA 2J8ZA 2NIPA 3KFVA 2AXPA 4QGSA 3BWYA 2SKDA 4HDQB 3PD1A 5U9CA 5B7NA 3INRA 5BZBA 1PV1A 5HFNA 4PCLA 2VF8A 4G8DA 5FOXA 5FIUA 4S05A 3R6GA 2OE2A 4P92A 1I01A 4GC9A 1LQUA 1E7SA 4W5JA 1A4UA 4G0PA 5TT0A 2CLLB 1HSZA 3ELYA 4TKLA 3HG7A 1J8DA 3NHUA 3PQDA 1GPNA 1XBTA 1DX6A 2Z4RA 2VUIB 3LSQA 1XZPA 2DSTA 5C53B 5HQTA 3HRKA 1OBHA 2VWPA 3K5WA 2PRSA 3V7NA 4RTRA 2QEXF 1AS3A 5C1DA 4QSHA 2FSIA 3EVDA 3DHEA 2WJJA 1ZAUA 3T12A 3JQ9C 4FYPA 3IOYA 4JUDX 2RCYA 1AGPA 3EOBI 3QUBA 4F92B 1K2WA 2O8BB 4QJIA 4JY7A 4BCBA 3K70C 3OKPA 3FX2A 3HFJA 4BE9A 4TTSA 3ZDZB 1QONA 2HK6A 1QVVA 3O95A 1B8VA 1TYCA 1MQ8B 4RK1A 4BKRA 3VC2A 4KR7A 1XAGA 3JPWA 1YB7A 1TQ2A 3LC2O 3T4ZA 2G88A 3VRHA 3JQBA 1CRQA 3J80M 3GVIA 4GC5A 1ETUA 5KWVA 1V1MA 1BXRB 4ZU3A 4M60A 3J7AU 4LF6B 4BU0A 3M49A 3TSWA 4Q4AB 5BUSA 3V3KA 4EKIA 1GN9A 2GAJA 2Z58A 4ZT2A 4X66O 4KRXA 2YWGA 2WZCA 3RANA 1RQPA 4M21A 1RI1A 5D87A 4MW3A 2V6IA 3WKBA 2UYHA 4ZA2A 4PBSA 4CUZA 1ADCA 1G9TA 2W2QA 1XVVA 3FKSG 4GEGA 7GPBA 3MIIA 1P7CA 3ZW7A 5JIBA 4TMVA 5LP1A 4Y6OA 2QDKA 3WBKA 4Z4CA 2H2HA 4BNDB 4AMUA 1RSOA 3N3AC 4KVZA 1AXEA 4LSWA 5ERYA 2OQRA 2B1RA 2W0XA 4W5RA 1I2AA 4WKOA 3DLAA 2V7QG 1E3SA 4ND4A 1I7QB 4PPGA 2AMJA 3ONWA 2O1SA 3ESXA 5KTKA 3GFBA 1YGYA 3OMAB 3CPWF 3O0TA 3NO4A 4WA7A 2VWJA 1BE6A 3PRJA 1X4TA 2R8RA 1TJ4A 4I0WB 3A9CA 1RCUA 2ATKC 4M8KA 3O1JC 5K9ZA 2W2LA 1BWSA 4FEEA 4IDCA 1XUOA 3KPYA 1ACMA 4KL1A 4MR9B 4KFUA 1IQ0A 4RNDB 5J58A 2Q7GA 1RACA 1JAYA 2KW5A 4EUFA 1Y4DE 2O1EA 3B6ZA 4FFOA 2VP6A 4A2CA 1CUFA 5KMGB 2IYVA 1BD3A 1LVUA 4F9GA 1E1RD 5KYNA 3K5NA 3K3WA 4X65B 1YTUA 3GJ6A 3WOHA 3MUOA 4OPAA 1YUNA 4FQ7A 1W73A 1XTUA 4N03A 5AUNB 2OILA 3K9WA 3ILSA 3M4SA 3OTQA 1W6RA 3U0ZA 1NXXA 3JALB 1FLDA 4Y2TA 2QXYA 5TMPA 2AEFA 1EWRA 3IO5A 3SR3A 2R8EA 1AGNA 3KHSA 1CUHA 3HJTA