3HKEB

Tubulin-t138067: rb3 stathmin-like domain complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 128
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkeB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkeB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkeB01
5LA6B 4WBNB 2VXYA 4TV9A 4X1IB 3RYHA 3V3TA 5LYJB 1TUBA 1JFFB 4X1YB 3VOAA 4TUYB 3WGJA 5LXTB 4YJ2A 3UT5B 5EIBC 5J2TA 1W5EA 5M7EA 4O4LA 5FNVA 5JQGB 4F6RB 1FFXB 3N2GB 5J2UA 4HNAA 3HKBA 5LP6B 5IYZA 4TV8B 2BTOA 4I55B 4FFBB 4O4IA 2RHLA 4EI9A 3JAWA 4O2BB 5ITZB 1W5AA 2VAWA 5EZYA 3HKCB 3VPAA 4DRXB 4LNUB 3JALA 5IJ9A 5KMGB 3HKEB 4X1KA 4I50B 3JASB 5BMVA 4I4TA 3E22A 1Z5VA 4IIJA 4O2AB 3RYCA 3HKDB 3ZBPA 4O4HA 3WGKA 4ZI7A 4ZHQB 5KX5A 3WGNA 4TV9B 2VAMA 3RYHB 3VO9A 3ZIDA 5JVDB 5C8YA 4X20A 3R4VA 2Q1XA 4ZOLA 3RYIB 1TVKA 5EYPA 4YJ2B 5LA6A 1W5FA 4B46A 3JATB 5JH7B 2R6R1 4X1IA 5J2TB 3C8LA 4KWEA 4O4LB 4U39A 3JAKA 5FNVB 1JFFA 5J2UB 5MN4A 2XKAA 3HKBB 3ZBQA 5IYZB 4O4JB 4O4IB 5CA0A 5IJ0A 3JAWB 4EB6A 4IHJA 5CB4A 4YJ3A 2XKBA 4DXDA 5JQGA 3JARA 5EZYB 4F6RA 1FFXA 5LOVB 1SA0A 5LP6A 3JALB 5IJ9B 1Z5WA 4TV8A 1RQ7A 2BTQA 4FFBA 5BMVB 2R751 3WGLA 3E22B 3RYFA 2RHOA 3VO8A 5CA1A 1TUBB 3N2KA 4U3JA 3RYCB 4O4HB 2Q1YA 5KX5B 5GONA 3HKEA 4I50A 4WBNA 1W59A 3VOBA 3CB2A 5C8YB 1W5BA 1RQ2A 5LYJA 1W581 5MN5A 3RB8A 4ZHQA 1TVKB 4X1YA 5EYPB 5EIBD 5LP6C 4HNAB 3WGMA 4TUYA 4B45A 5JCOC 5LXTA 5JVDA 3UT5A 1FSZA 3JAKB 2GVIA 2RHHA 5MN6A 3M89A 3RYIA 3N2GA 1OFUA 1RLUA 5IJ0B 3JATA 5CA0B 5JH7A 2VAPA 4I55A 4EB6B 4X1KB 5JCOA 4IHJB 5CB4B 4EI8A 4YJ3B 4O2BA 3JARB 4I4TB 4XCQA 5ITZA 1SA0B 4IIJB 4E6EA 3HKCA 4ZI7B 2BTQB 4O4JA 4DRXA 4LNUA 5KMGA 4EI7A 3M8KA 3JASA 3RYFB 5CA1B 3N2KB 4X20B 4U3JB 5LOVA 4M8IA 2RHJA 4O2AA 4ZOLB 3HKDA 5GONB
chains in the Genus database with same CATH superfamily
3OTFA 3AUFA 2K1SA 4BN4A 3UT5B 2IDKA 3FCEA 3ABIA 1ZMXA 4CTNA 1QH9A 4FHDA 4AUMA 4QNHB 4FXOA 4WK0B 1QYRA 3HVIA 2HXGA 1LBQA 4RIHA 1ZQ1A 1E0SA 4FILA 3IFSA 1P4JA 2DY0A 5L3DA 2B0CA 1F4LA 5JC8A 2ZT9B 4UEOA 4A1OA 4FM9A 3KCYA 2AWNA 5LL6Y 4J9YB 2N05A 3ZE9A 3T4XA 4IVPA 1SR8A 2O20A 1H9BA 4XGRA 4DHWA 3L6RA 2IPXA 5D5HA 2DQZA 3QFTA 3TSAA 4KL8S 1L7BA 4DDHA 2Q2OA 5DEDA 2YJ6A 2GDSA 1CFZA 2O0JA 2VC2B 4RK6A 4BEVA 2GZ2A 4PRKA 5IBPA 2WPNA 1UAAA 1QP8A 5I51A 1P9NA 1SZDA 5JNTA 3B6EA 5K0TA 1PR3A 1HDJA 3CLUD 2GETA 4LISA 1USKA 3ZYCA 2Z9CA 3PC8A 4QG7A 3QHDA 3SS9X 5GTIZ 2XZLA 4IFEA 4UARA 1NW4A 3C43A 3I32A 5IM4F 1GZ6A 1SQQH 2VKQA 2G7MC 5KVVA 1P9RA 2CLSA 4BT5A 2RI0A 4DR1O 1SZJG 5M04A 1BS3A 4CQMB 3C1UA 4ZOBA 3BFVA 3N8DA 4GI1A 5EUMA 5KOJA 3R7NA 4X61A 1U43A 1RWOA 1UOEA 5KWIA 4HZGA 4DLLA 1JXAA 3UPTA 3RFVA 5DYTA 3LHDA 3OT1B 3OH8A 4HDSA 5CNJA 3U7QA 2R1ZA 5KTOA 4TTVA 2IWHA 2GEDA 4EG7A 1NY6A 3NTUA 2B61A 4PQFA 4Y1EA 2WRZA 4ESVA 4KO1S 3IBGA 2PMWB 2BH2A 2N04A 1D3AA 5FWYB 2OZVA 5JECA 2QTHA 1Z88A 4OB6A 4M0DA 5EKUA 1YASA 5AXDA 4H18A 4QPDA 2ACEA 3G0CA 1XSEA 4Y98A 2ZR9A 2ZD9A 2FZVA 2PSSA 3UAYA 4Q03A 1JQ5A 5AM2A 2J3KA 3DTUB 1MABA 3AG5A 1UMBA 4LF7B 4H77A 1WQ1R 1ZJ4A 1IG3A 3FBWA 3OPQA 4MAMA 4HY3A 1VE6A 1IHXA 4IHAA 1QHHA 3BFPA 1X8JA 5NULA 1X0XA 1XN4A 3PWSA 4KCGA 5JD4A 3DG9A 3RVDA 2NUTA 2XIJA 4ZYYA 3DTVA 3U0BA 3KEQA 5IXJA 4J10A 1TPYA 2JVJA 1LLFA 2OP1A 1OLUB 4NYKA 3H4IA 3DWGA 1XL0A 2AFIA 1J8DA 1RQRA 4BP3A 4KR3A 4WMLA 1DOAA 3KB8A 1DXHA 1JXMA 2CNWD 2EJTA 1L9XA 2ZIFA 4QFBA 4ZCQA 5H3CA 1IEVA 1KIAA 5JD6A 4QPKA 4IRUB 2WU1A 3WJPA 2DE0X 1Z6AA 4DCUA 3FR7A 1SOWA 4J0EA 4EBBA 4YBZA 2O7NA 1QO0D 4HWSA 3ZZ1A 3EPJA 1Z34A 5AVUA 4GR5A 4Z99A 3M1IA 1G5QA 4QUBA 2HF7A 2D2IA 3QKRA 1N8NA 1ZVKA 2VHQA 2FOIA 5AKGA 1RKXA 2XOXA 4MVQA 1NJSA 1XI2A 2IS4A 5LZ7A 2F17A 5I5GA 3HWUA 5HBRA 3HB5X 3A9WA 3JALB 4D3YA 1W88B 2IYEA 4P83A 1FAFA 2P3QA 3MMSA 2J9RA 4QREA 4O02B 1K33A 1GGVA 2B8TA 2ZBRA 2ECQA 1FB5A 4RH3A 1KD1H 3MQFA 5LHIA 2CSLA 1QU2A 4RMIA 2XOEA 4FFDA 3MS7A 4I55A 3KTOA 3B1WA 1FKAO 3KDSE 4TYYA 4F71A 1EA7A 3WRYC 5CN0A 1HL7A 4UU8A 5DIFA 3CX8A 3UXYA 1C8VB 4MVJP 3KD3A 1J95A 4ALMA 1IFXA 1SOAA 2YI9A 3BZWA 3KJNA 1NZJA 5DWVA 2VG8A 2VUIB 5AESA 1NIPA 3R3HA 2V9CA 5FBZA 2WP0A 1S5PA 4ZA2A 4CBVA 3AEYA 5A4JA 4FFBB 4P7BA 2QRJA 1PXWA 4PONA 4F4JA 1QCCA 4OAPA 2POCA 1D2GA 4LXTA 1IPFA 3WLMA 3ODPA 1WBJB 4V24A 1RFLA 3HJWC 4R41A 3MJTA 2J09A 1EX9A 1XXLA 1VSBA 4EQ6A 1YQQA 2XMCA 1IMOA 4NYMR 3TSYA 3LKZA 1MAAA 2VDWB 3FZNA 3LQQA 1NNUA 1H1LA 2G6TA 2B69A 3M5CA 3DC5A 4W5WA 5BQPA 4BNXA 2DWCA 2CV1A 2IAFA 3MJ4A 2WDZA 4IHJB 1YZQA 4O2BA 3AFMA 4MS4B 3H4VA 5BVGA 4OG2A 1I36A 1QGUA 3OIVA 3K1AB 4Z8YA 1Z33A 2EZ9A 1MSWD 2W70A 2RCVA 1GO1A 2QRQA 4DW0A 2PJDA 2B1JA 1W5EA 3DXRA 3HA3A 3WFZA 1H6DA 2PQ2A 4MR8B 4ZYUA 1G291 3C3KA 4NEHB 4Q7QA 4MITA 1V1MB 3A4IA 3PR1A 3S03A 3URKA 4BAUA 5THXA 1DLJA 3IIEA 2FVYA 2XDQA 3I9OA 1SERA 1XEWY 1ZMTA 3GLGA 4FU0A 4I9NA 4CRWB 2VHYA 2A33A 4GLBA 4N0EA 1BWQA 3EY4A 2CK3D 3TW8B 3G2IA 3KJEA 5JASA 1UJ5A 4MW7A 2KQXA 1ZG3A 5LQCA 4GQIA 3RAJA 1YIAA 3IT3A 3U1VA 2D2EA 3VMMA 5BNTA 2Z56A 3Q10A 2XVAA 4H59A 4UCFA 4PG8A 2A0XA 1QVGU 3R5JA 3WY9A 1SZTA 4HTAA 4RO2A 1RYFA 2IH2A 3RBZA 3GFTA 2ARHA 1HE8B 4JNKA 4NMLA 3DHNA 2XUPA 4P7KA 3BKWA 3OX3A 1G6OA 3QA3E 1JLLA 1J7JA 1RABA 5B7NA 3QX9A 1SDSA 1AZSC 3SYNA 2ZJZA 4MYRA 3CA8A 2ETXA 2RGWA 1RM4A 1IN4A 4Y2XA 2JHPA 2W5UA 3AHCA 2FWRA 1LPMA 1QYIA 3I01A 3INRA 2E4YA 4UHHA 2BJHA 2V1XA 2JAXA 3PPVA 1WP8A 2PU7A 3UT0A 2ZJ3A 1GQSA 3D4OA 2PHZA 4AJKA 2VUSA 3PDIA 3WS7A 3DCJA 1GCIA 2WKSA 1KO5A 2FWBA 1UIRA 5EFZA 5TS2A 3EZ2A 2GTIA 3QKSB 3L5OA 1HE5A 2R8YA 1Y5RA 1XMQO 2HHJA 2BEVA 2IC5A 1WB6A 4RMHA 2M1ZA 1MOZA 4WY2A 4A1FA 2QSAA 3CEHA 5IT4A 3SWWA 3GHYA 3SICE 3ORSA 2Y1GA 4HLQB 2QOEA 4D5EA 4R3NA 1YZNA 2F3PA 4J4BA 1HDXA 2KW5A 1TLTA 1XZKA 2PT6A 3ZJTA 3BCCH 3V4OA 2O3UA 3TOXA 1SZXA 3K0HA 3C6KA 3NHRA 4G2TA 3B85A 2P3SA 3USES 3NFRA 4JGGA 4REQA 2WHEA 5CT6A 1XL4A 3VNVA 2VK4A 3KAPA 4EZBA 1T9CA 2AX3A 4PV7A 3C6QA 3LPNA 2XJ4A 2ZFUA 3LUFA 4MT8A 1DUSA 3RC9A 1M8KA 1XRRA 1B14A 1J99A 2Q5FA 4BWFB 4E07A 1C7RA 5L6MB 3RU3A 1I0ZA 1FVHA 2M1XA 3DV9A 2FPLA 2R86A 4OU4A 1ORDA 2VTBA 4D8XA 4XB6B 2FMTA 3OOSA 3N07A 3GGCA 4A6PA 3GUZA 4OHUA 3GRUA 4BCBA 1LNZA 5BXZA 3UK1A 4ENTA 1BEZA 3MCQA 4QU8A 3UWPA 1SC6A 4G67A 2REXB 3OQBA 4LF8B 3VOSA 3BT7A 1QK4A 3WZMA 4XCVA 1TD9A 1CY7A 3DXYA 4CETA 3UO8B 1MF7A 2VXOA 4F5ZA 4P3OA 2HBZA 1GNPA 1SVWA 4Q4LA 5JCPA 1ID8A 3JRNA 3GO4A 4QXAA 5K05A 1JSXA 3L40A 3PR3A 2J9FA 5B1BB 1V71A 4MQEA 4ZVKA 3KOMA 1O5TA 5JTTA 3FZEA 1RPZA 4R2KA 1NNEA 1UPXA 1LWNA 4O1IA 1ODEA 4D8TA 3UJ8A 1MUUA 2C4WA 3GYQA 2GN8A 5HFMA 2GNPA 4BJ5A 1L5WA 3GT4A 1EFRD 2Z5FA 4TWKA 1E1QD 1D0IA 1WG8A 4F3YA 3PJFA 3CB2A 4CV3A 4WBNF 1RTTA 4B43A 3T9EA 5ALXA 2BGUA 3GGSA 5A7FA 6CHYA 1TYEB 4CU5A 3BD7A 2RG1A 1RPAA 2X3YA 4D8YA 2NUPB 4FEAA 1EUDA 3VSAA 4ZICA 4XUDA 2PGAA 3T7AA 4AS3A 3PQ7A 3C90A 3EHEA 1R0SA 4D57A 3Q40A 1PL0A 4QA9A 4IOLA 2DHEA 3FWKA 5JH7F 3KS9A 4FDLA 1S3FA 2QI9C 5B58C 2TMDA 1EXNA 5JAQA 2WU0A 4DJTA 2JI8A 3ANYB 3RYCA 1OX6A 2A1UA 3P27A 3SJUA 3UXEA 3GGGA 2CD7A 4C14A 3G1UA 1NJGA 3WXMB 1KO8A 5B1YA 1NVPB 4PG7A 4ENRA 2V1DA 3UYLA 2R70A 3DZBA 9LDTA 1JBKA 3HSSA 2QZ4A 4DOMA 1M6VB 1W36D 1D6MA 2I1WA 3VDRA 4HSEA 3MD9A 2CTRA 1GU1A 5AI6A 4GT1A 3H5VA 2XB9A 2HB6A 3CCMV 2FFAA 3F5DA 1SXGA 3G9QA 2NU6A 4LF9B 2H9IA 3GDGA 4F72A 2UZ1B 5JS2A 2R5FA 3RFUA 3RNLA 5DCLA 2WKPA 4CS4A 4W5NA 1B2LA 3KEFA 3RSHA 5IVIA 1UDAA 1R0YA 4FZ1A 4XWYA 3ZWVA 1O58A 1GUYA 4D3FA 1SK8A 5A9SB 3DL0A 2CVLA 3QI2A 2JHFA 1RA4A 2BUAA 4NDNE 3T7CA 5KDOA 3RDPA 1S8OA 4PBRA 1JHRA 2Z5GA 1CVRA 1N2OA 2JFYA 4OIMA 3AQ4A 1OCZC 5KNCA 4Y2UA 5FFMA 1IBKO 4W7IA 2QMYA 3OP4A 4X63A 3GFOA 3IQEA 4JLOA 2P4SA 3F7OA 1GM5A 2AN4A 2PUAA 1QH0A 1AI6A 4LJ6A 3C3SA 3MWLA 1JU3A 4DV5O 2PHNA 2VHJA 5B57C 1UPGA 5LMZA 1JDVA 1R4NB 4K3VA 5DK4A 1Y9AA 4UVCA 1HGXA 2Y2VA 4IJVA 1T35A 4RANA 4IGKA 4AJLA 1HDCA 2QG9A 3I30X 2F00A 1BQEA 2G9RA 2FSSA 2H2WA 3OTHA 4B6FA 4O3FA 2H5LA 3RU9A 2OXTA 2B7CA 4X93A 4RVCA 4GOOD 3TVYA 4BNYA 4TV8B 2HU2A 3MWEA 3WWCA 4ZQBA 4GQBA 2O2CA 1WXEA 2XWJI 3FOWA 5ICCA 1ZN2A 3BIXA 3R5KA 3QV2A 4Y2SA 4FZJA 1Y1TA 1IM8A 3WGTA 4HGOA 5AMXA 3LHSA 4FYPA 2FNAA 4BNNA 1XHLA 3AFOA 2VTDA 5ENZA 3QPWA 1Q1NA 2P4QA 3PSHA 1QNFA 4D3DA 5EZYF 3T4PA 3C3EA 1FDRA 1XTIA 3WLRA 1GNSA 2V0NA 4NZ9A 1LQ2A 2FEMA 4ZYLA 3EGDB 1HURA 3ILYA 2X6AA 3E8MA 1PJZA 4N3GA 2M6KA 4DSOA 3O03A 2A94A 2QU7A 2EFEB 1FFWA 2ZS9A 2EF1A 1E3LA 3NYWA 3AUSA 1NUAA 4KYUA 2HVYD 4FMBB 5ITZA 1DTOA 1QR6A 1OV4A 1A9XA 1GO2A 2B37A 2Q7DA 4Z1MA 3FWPA 4RKYA 4YMSA 4XVQA 3OCJA 3HNPA 3EDQA 2NVUA 4KPGA 1N2BA 1YITF 5JANA 5CVCA 3EORA 3QP9A 3L8MA 4LYAA 2VHUA 4G37A 4YYEA 3PEUA 4NZZA 4Y9UA 2DM6A 4JL5A 4N4AA 4L0CA 1F3LA 1XZ8A 1IBRA 2CHSA 3G67A 1EVEA 3IXQA 1Z5VA 3EWIA 1ZX1A 5ECWA 1MMFB 4Q1AA 2HXSA 1M5IA 1MABG 3NGXA 4CDRA 4H7EA 4RV9A 1R9GA 2OECA 4I9WA 1TKCA 1NYRA 4GYKA 3JQGB 3U3DA 5FLXN 4CCAA 3KO8A 1ONOA 3TUIC 2ZJ7A 4IIBA 2CUZA 5JATA 2PGDA 2DHDA 2Q3DA 2EX4A 2IUUA 4IFTA 3OMLA 3E81A 1CG6A 5HGXA 1G7CA 2UDPA 1NMXA 2R5WA 4LDRA 3HDQA 4F6EA 4BGEA 1KYYA 4P53A 1MJNA 2F9LA 1E58A 3EAGA 1P1RA 4ILEA 3BF8A 3D6JA 3FAVA 5EI5A 1YQDA 4FJCC 4DSUA 3A3YA 3HU5A 3MT8A 3IQGX 5DX8A 2WT9A 5EBWC 2R6FA 5JAPA 4CFSA 4LIPD 2G07A 2OQVA 2O50A 4JOQA 3WZ2A 4JQSA 2ZRIA 1X52A 1Y3CE 1WPBA 4F96A 3DVQX 4PI2A 4M1OA 3WGNA 1JE1A 2PIAA 1Q21A 5AOBA 3ZN0A 4EFBA 1ZUD1 1T2AA 1K8RA 3IEVA 2GRJA 4IUYA 4JLKA 3SZ3A 5BY2A 1H2YA 2Y1XA 3U60B 3EZFA 1KRXA 3UN1A 5ALLA 1ILWA 4EJSC 2HWYA 5DYWA 3B1FA 1IZYA 5H80A 1M2GA 5CEFA 3D54A 1ECGA 3KQLA 1VLVA 2D2CB 3CCLF 1UBHS 4Q34A 3U1BA 4DLUA 4C6HA 3WLAA 4K87A 4NF2A 5LP6C 1PD3A 4F85A 4V0RA 2O2XA 5FOVA 2ENWA 1ZC4A 1XRPA 2WT8A 3H6GA 1NW9B 5C46F 5B1EA 3E8HA 3L79A 4C8IA 3Q7IA 3Q6MA 5ICGA 5FUBA 1PDWA 3I5UA 3ZRWA 4KDRA 3OQJA 1G4YB 1T4MA 1GVNB 4FGSA 3IJ5A 3MCWA 1QZTA 3R9IA 4UUOA 4HWOA 4OHZA 3BL5A 1G42A 4WXHA 4I08A 3QU4A 1LPAB 3ZO8A 7REQB 2EAUA 1KH3A 3JYNA 3H83A 1EUQA 3JSXA 1OI4A 5D84A 2X5KO 2DYRB 3F74A 4M8NE 2H2DA 1C8LA 2QR4A 1PP4A 5AJZA 1SZCA 2GQ0A 3GLVA 3DF9A 3C8LA 4RVFA 2FI1A 4ZAVA 1P5ZB 1SQSA 4GZ3A 2JF0A 3KV1A 4CIDA 4EGFA 3P2JA 4PYQA 2AK3A 3M5DA 3QXJA 3WA7A 3B3AA 1RSZA 4D97A 4GBJA 3OE7D 4N03A 4CKEA 2PUDA 2XAHA 3IMCA 4G5FA 4JT9A 4ZAXA 3QXCA 3IP5A 4WKBA 3EPHA 5IDXA 4PLGA 1ZDMA 1FFGA 1SEVA 2FEWB 2X86A 5DHAA 3J81N 1YULA 1EA5A 2P40A 5EMHA 4E94A 1U7OA 2A9FA 4B6PA 2Q4OA 2CXOA 3PQDA 2YTZA 3AFNA 4LQDA 4NFHA 1KWGA 1B23P 3K5LA 3DJFA 2QN6A 1QOZA 2RGXA 1RC1A 3Q41A 5ESWA 4O8ZA 2ONJA 3V4VB 2QL9A 3LS2A 1T8PA 3TZQA 8OHMA 3BERA 1GQFA 1W9MA 5ALHA 3F5SA 1ZOSA 1WXIA 2ZCUA 3OOEA 1U40A 3AYZB 1T9GR 2V6GA 3OZGA 2CTPA 4DW1A 4MJXA 1FFEA 2J48A 2I91A 1HNWO 2QXYA 1W5TA 4GKVA 4PGGA 3S0WA 1G5PA 3P9QA 3IPCA 1I2CA 3MCVA 4ZCTA 4CM9A 1DAMA 3KZCA 5JNVA 2GPJA 3ESYA 5CGZA 2VP3A 3WSWA 5WRFA 2QMHA 3ZX5A 2HWUA 3K9QO 4GWKA 2HJWA 4JASB 2W0FC 3M3PA 4UCXA 2WICA 4HYEA 1AD2A 4I0XB 2GHQA 1TZCA 3EHBB 1WZ2A 1Z0IA 3WFVA 1JQEA 1SC5B 4EGAA 2TMKA 2ORVA 2PX4A 3WLEA 3Q7RA 3SG0A 2ZJ2A 5CLIA 5EQDA 2Y48A 5AVZA 1P0PA 4UASA 5JXJA 1WE2A 4BLSA 3OQIB 1RAEA 5E2BA 1H8HA 1EXVA 1EWRA 1I4OA 1EBUA 3I83A 4WWHA 3HTXA 4FWBA 3NIWA 4NAUA 5B37A 1SZQA 1MMMA 3S02A 3AI7A 3L8GA 2JLQA 1CZRA 5I7SA 3NRJA 1GA4A 5EIEA 1JQKA 4N48A 3KVRA 3D0KA 4C4RA 2LR0A 3HZZA 5EIXA 2R11A 2E85A 1B6SA 4Z9AA 2GD0A 3MPOA 1UPAA 3GP8A 1XQXA 4BEBA 3IAYA 1RWKA 3HE3A 2NZVG 2CHUA 4HBZA 1SHUX 1XTVA 4J7ZA 4IINA 2IV2X 1UINA 4LH6A 1QYWA 4QXMA 4DUGA 2ODEA 3U4AA 5T3UA 2JI4A 2WHQA 4ND1A 5JJKA 1L3CA 3WK9A 2EJ7A 5HZGA 2FSIA 4EDHA 4KQ2A 3THWB 4XRRA 1OROA 3T9BA 1WW3A 3GP3A 2BP7A 4P58A 5CTAA 3H04A 3TZBA 5KHAA 5IW8A 3GRCA 1JHOA 1A8IA 3GFFA 1BVUA 2ZIXA 3CVWA 5A3QA 1QPZA 1KZ7B 4TS4A 2CHFA 3U7FB 4P4LA 2BFBA 1SXIA 2OCHA 4M53A 3IT0A 4JUCA 4MV9A 4BWVA 4ND2A 2Q6IA 3I2YX 2C0PA 1K7SN 4MEAA 5J59A 2ZSJA 1KPHA 1CUFA 2C9OA 5BT9A 1HT1E 1OYOA 4KBFA 2QPOA 4HUQA 5HG0A 2HRBA 1KDRA 2O0KA 1UJWB 3CLRC 3TQQA 3KKMA 2DFPA 5C1BA 2AS0A 1E0KA 2ID8A 3RAEC 1V37A 1H2EA 1QVFU 5G0SA 3W7AA 4IXMA 3S2IA 2IE0A 2P30A 1X70A 2BSKA 2PQ6A 1Q7GA 3OTWA 5KJ6A 1FY2A 2RAVA 5C2JB 4BZZA 3HK2A 4AO6A 1TTHA 3P4EA 5JLAA 1J2TA 3F71A 1OFTA 4ONEA 4E5PA 1JF8A 1WA8A 2HH9A 3G0DA 1ZH2A 3DLTA 5L95A 1NJIH 3A10A 1P1CA 2FR1A 2DHQA 1R6BX 1FRZA 4R3WA 5KB3A 2FK8A 3IAFA 3LHFA 5A5EA 1SRYA 4TV9F 2HUNA 2V58A 3FFTA 2RMKA 1DCKA 4XYGA 5JNRA 1AG9A 4HS4A 2KTUA 4KQHA 3DKRA 1V25A 3C3DA 4G2KA 2CL6X 3OPYI 5IF9A 2HLDD 2F1MA 4UFZA 1ATIA 4DIDA 1WNFA 3M81A 3AKDA 3HSKA 3NM6B 1V16B 3TX2A 3QF4B 3GQVA 3QZUA 1T4GA 2K7FA 1EINA 5IC6A 3CF4A 1OI7A 4HNHA 4RMJA 2AG6A 1MQ8B 3RFCA 3TYXA 1BROA 3WBKA 2VWQA 4UZFA 1R1DA 4KYIB 1E6LA 1SQ5A 1HWYA 2ISCA 1DEHA 3QO5A 1IONA 2WV7A 1TE2A 4BIZA 4Y30A 4D0LB 1YK1A 2IT1A 2C92A 3KETA 3W5UA 1Q86W 1RJGA 3HI6A 2I6TA 1NP7A 4X62O 1M5TA 3EFBA 4YJKA 3CRQA 4HZUA 2GEUA 2OYRA 1TAUA 1N5IA 3L7OA 1DC4A 1H47A 1NYLA 1Z36A 1LEHA 1YTUA 3VVBA 3BORA 4F8YA 1ID1A 4OBEA 3MCTA 1ZN7A 2OWEA 4G5QA 3N6XA 2ZPUA 4RTOA 3H1EA 4ENQA 4HDAA 5L3EA 4H4CA 3NOQA 1U97A 1ZCZA 3CZ9A 3TG2A 2ZR3A 3F4LA 1BEUB 5CH5A 4AKTA 4ZIBA 4QHTA 2O59A 1DAPA 4B45A 5D2CA 1XCJA 4B0OA 3ML0A 1HORA 4LFAB 5ITSA 3G49A 3K3WA 4O4JA 1P8AA 1J7HA 1YMQA 5TX7A 4L28A 1BJTA 2XBMA 3WG7B 5ICEA 3AH8A 2QQGA 4F6RB 5KYVA 1CRLA 3H2HA 4KPEC 2JA2A 3HM2A 3ZY3A 4NBKA 3GEPA 5GJWC 4B48A 3PUIA 2ZR2A 3GLRA 2IEYA 2V6FA 1BAPA 3N2EA 3FHOA 5EO3A 4R16A 2BBSA 2YXNA 2NO9A 4C3UA 3EPPA 2Q9CA 1VG8A 1FLAA 3NBFA 4ZGGA 1FXVA 2HK7A 2XZPA 4PPGA 4H3KB 4ZFNA 1S1CA 2OLKA 5I47A 1JKIA 3BDAA 3QJGA 3H1LH 1Y6QA 3UGTA 3R0PA 2VL7A 1B0UA 2O2IA 1H6BA 2GVIA 1NASA 4GVPA 5H02A 1KK3A 3A0UA 2XNSA 3FCXA 4KFUA 1B1AA 4ARCA 3KNZA 1V3TA 1AQ6A 2VATA 1T5TA 2ANBA 2YS6A 2W42A 1EVLA 1GN6A 3D6UA 4YR9A 5C7LO 2DYSC 3ITNA 3CCQF 1K66A 1V48A 1CEQA 4U7HA 3OAAA 3VAYA 4FMCF 1Q0PA 1WU7A 3EZGA 2JLCA 4PCVA 3BA8A 1YH3A 3KYDA 4FKZA 1J0AA 4CKWA 1AUXA 3L0PA 2ID4A 1W4LA 2ZAOA 4K86A 3HKEA 4MJLA 3K0EA 4NQZA 3P52A 5JALA 1ZN9A 4WIAA 1VOTA 3QPBA 5FUVA 2IHVA 3RHFA 3E8FA 4D3XA 3PXCX 5K0SA 3U3ZA 3LXRA 3R5SA 1DINA 5ALDA 1RLGA 4N5MA 4P93A 4XDHA 1U2PA 2KBFA 3OWXA 5KTMA 3PQ3A 1UFIA 4G4SP 4L3WA 5JARA 1J24A 2CLLB 4K03A 3FA2A 2V6JA 4PXYA 2VK8A 4CGYA 4Z1MG 4XTRA 3C70A 2WYUA 3QXXA 5DX0A 2XJ9A 3PN1A 1M6NA 5JMWA 2IYAA 3DV0A 5LZ5A 4GUDA 3WBJA 3TQSA 4W5QA 3LCCA 4NBSA 2Y1FA 3Q2IA 2GTPA 5JCZA 1Z63A 3CNLA 1GILA 3D6NB 1KKMA 1PS0A 3Q7EA 3BQNB 5FQOA 4JI0B 2O7VA 4O4LB 3L4SO 5BSUA 4JWKA 1T5HX 3ELUA 4G0QA 4YRAA 4YIPA 4KFMA 1NTOA 5ADUS 4G1BA 4LEIA 1R15A 5EWMB 2FG7C 1JQAA 2O23A 2JLWA 4HMPA 1Q7EA 2GBLC 4L22A 1JPVA 4QAJA 4DDMA 1VL0A 1K4YA 3DL7A 3ACDA 1N8TA 4BJ1A 2DT5A 4PW0A 1CUJA 4F12A 4HQKA 4BPBA 3TRHA 4GU5A 1LC3A 1JIVA 5FFFA 1GCUA 3GN1A 3MS4A 2HJVA 3LZ6A 4WDRA 5CFQA 3WRXC 3DP7A 5DHPA 4JR1A 3G59A 1OGJA 4Z4CA 1KPGA 3T1HB 4RZHA 2EKQA 3IHLA 3VI4B 4E5YA 5E1BA 3MJDA 1E79D 3K3PA 3QGMA 1GRRA 3ZP7A 2EWMA 4JI5B 1XQ1A 4LNUB 2X42A 5FOQA 5B3JC 3N58A 3IJPA 4ETIA 2ZAUA 1A8SA 4CHTA 4FEEA 2VAMA 3L6CA 3P9PA 1JV2B 4QJFB 1XCMA 4RFSB 3R3SA 5BSVA 2QV7A 3KT8A 3MDOA 1GM8A 2YY7A 1ISFA 2FQQA 4DWOA 4YAWA 4YAOA 3ZKAA 1YR6A 2ZWOA 3QU5A 1VQ4V 2UYGA 4BV8A 3HB7A 1XNJA 2XQJA 4OHWA 1QIKA 4MRMB 2FMKA 3NIFB 5P21A 5MFPA 4CMHA 3KQMA 4LW8A 1GRCA 4B7AA 4CQJA 3PR2B 4LE1A 1O95A 4V1CB 7MHTA 1VF6C 3ELYA 2NAPA 5KNLA 1FUIA 4G4WA 4QTYA 4YP0A 2RGNA 4LBYA 4HX2A 3P4UA 2ODPA 2F93B 2B4YA 3CW9A 1LA2A 3T7SA 1D4FA 5B3KA 3ZNQA 3FNEA 4BVQA 1QGAA 1W30A 1XTZA 3ND8A 4L4SA 5HIIA 3RAGA 2C42A 5IWAB 2VRWA 3KLOA 3EULA 3H9QA 3TLJA 1C41A 3H1FA 3CLUC 3T7DA 1XB2A 5GGYA 1BDIA 1R27A 4BN5A 4YWHA 3VISA 4JVMA 3EFOB 4OBBA 4QPNA 1F20A 3PQ4A 2BGWA 3NVMB 1T3GA 4B6JA 3LDHA 1QHEA 4IEEA 4BJHB 1SWWA 2QA4F 2GF0A 1UOOA 4CQMD 4WA8A 2CEAA 1AN9A 3GU3A 3AHHA 1OLSA 1ZRMA 2F3RA 4YQZA 3L8CA 1NVTA 3CUKA 4GO1A 3MPUA 3TD2A 2EF0A 1I7FA 3NCHA 4FFRA 5LWHA 2BI7A 3C3JA 4MVZA 1P39A 5H6QA 3TXQA 3V3TA 2PZGA 4HQNA 5COBA 5FEUA 2AZ4A 4XB2A 3AG1B 1JEYB 4LSZA 3SX4A 1XZHA 2NYRA 5BR8B 2OTMA 4UXNA 3EW9A 3JQEA 4CMIB 5J4HA 5KYKA 1BEEA 3M5PA 3OPYA 3SGIA 2JKVA 4BV3A 1G20A 1CRZA 3N6VA 1O96A 1W5FA 4KXUA 4F5YA 1IZ7A 3AM3A 1JHQA 4YWJA 2HLHA 3CPSA 1A9ZA 1LTHR 2BFCA 3M2PA 3HCAA 4D80A 3W8DA 1MJFA 4EABA 5HX7A 3CKYA 3HCPA 3O75A 4QPPA 2RHRA 5GWXA 1YR2A 1V9PA 1YF2A 5ES4B 3FFMA 2BONA 1K63A 2AF3C 3AIOA 3NR2A 4A5SA 3DM5A 1OJLA 4HMOA 4MQLA 2EU8A 4TN5A 2CYAA 4WW0A 4YRJA 1MVOA 3ZZUA 4ER5A 1A5TA 1DKPA 1H8HG 3M49A 3OBBA 3WJ2A 5CLLA 1Y4SA 2N1MA 2C00A 3WNVA 1MO6A 2AKAB 3TLYA 5AKYA 4GKKB 3ANXA 1T2UA 4DARA 5BQ3A 2QTWB 2WMYA 1VI6A 4B6GA 3P0EA 4N5IX 3G0HA 2RIRA 4DLBA 2VT7A 2X1VA 3OJEA 3HUUA 1N5LA 4HQOA 4R1NA 4DW8A 5HIKA 4JXXA 4N23A 5IJ9B 1SD1A 1X2EA 4B84A 1ULHA 2O7QA 4PAQA 2Z1EA 1FEZA 1T6BY 4X3MA 4TPKA 2BKXA 5M29A 3VH1A 3FKSA 4TXNA 6GPBA 4FVTA 1L4GA 3FMGA 1UMDA 3GJ7A 2O05A 2XT9A 3ESBA 1U0NA 1QWSA 4H15A 5K8UA 2VPXA 1OYVA 3NTLA 1YBMA 3FYUC 1L7PA 2GTAA 3BFRA 4K9QA 1GT6A 4CLEA 1OLXB 3EOBI 2HFKA 1GQ2A 4XGIA 3A1WA 1U8XX 1EX7A 2IPOA 3THSA 4N0DA 1MENA 1QCYA 1TW2A 4F5WA 1W87A 3Q1KA 1GD1O 4ZZIA 2HS4A 5KVSA 2Z8XA 4R8KA 4TL7A 3UJ9A 1UBCA 1AR1B 2AL7A 4GC9A 1DKMA 3FE2A 4HLDA 2IU4A 4D96A 5JISA 2R7LA 2W6ZA 2G82A 1B0PA 3R6TA 5F12A 1C9EA 3VSCA 3UHJA 3AGPA 5EP3A 5D87A 4P6VF 3OZVA 1U9JA 4C7XA 4NHOA 3DLHA 2QUAA 1QVZA 3DM9B 4HDRB 1JKJA 4JI6B 4IKPA 4BX3A 3TLGB 3C48A 4FCWA 1DB3A 1KK2A 2NTYC 2AVNA 3BGOS 1T6NA 3A36A 3Q7PA 1Z5NA 3CUWA 1XO1A 4ON9A 5U1PA 2DAPA 1XNRO 1OV9A 2R66A 5HUHA 1V3UA 1Y5IA 1C4XA 2DECA 4J4HA 5B1BC 1Q84A 1I4LD 1CRWG 3MQWA 1HE1C 4N76A 3N74A 1X87A 1FMFA 2Q7OE 3UB2A 2GNAA 1ECPA 2AGAA 4KLAA 4NYIQ 1UJNA 1XPUA 3TI9A 2OD9A 3C9SA 3G1TA 2GKGA 2ZKLA 3OY2A 4XJSA 1XP8A 2HDWA 1J25A 1P33A 2JAOA 2GFIA 4CL3A 1TIPA 1D2AA 2LDBA 1QQ6A 4NY1A 3RT9A 4FYHA 1VI2A 2XIQA 5HGJA 1M1XB 4E3ZA 1FFXA 2XYRA 2XCOA 4OI2A 4LVUA 4GXNA 2QX8A 2YVUA 4EHHA 3HZHA 1DJQA 5L4SA 4B7CA 1F1JA 1K6XA 1ISSA 5AVSA 4PCUA 3UY4A 4KXQA 5EMMA 1NVMB 1M90W 3IKVA 1GR0A 3B12A 3TRFA 3CRZA 1J5EO 2ZRAA 5IVKA 1IN8A 2FRDA 1KNKA 3CF4G 3V8NA 3OZDA 3GLIA 1NKTA 4AWBA 3T7EA 2Q46A 5DHRA 3D2CA 1OFUX 4Y6QA 4BO4A 3EIFA 1N6OA 4L9RA 4TQDA 6NULA 5KTTA 2DBRA 2HSJA 1NFFA 3FMVA 2PMFA 1JI3A 3BREA 4LHEA 4TVBA 1YQXA 1I1NA 2H3EA 5MGNA 1T8TA 5TNXA 2OOKA 2X0RA 3NTRA 1A27A 1YQ9A 1OREA 3VI3B 1KOLA 2R9IA 4EO7A 1A5BB 3OQMA 1D1QA 2VDPB 2XQVA 4D7AA 4EW6A 3CXUA 1L5OA 2UUCO 4ZVUA 4DV3B 3HACA 2VSFA 1ZI8A 1J2RA 4TWZA 4TS9A 4Q7JB 1MEJA 4LYHA 5ALFA 3K6JA 1J33A 3UAOA 3FYTA 1AKVA 1YJWF 2AQKA 1GFSA 4CEIA 4C4XA 3IALA 2H7YA 4G4GA 3OO1A 3A6DA 1ODTC 1KJIA 4K9PA 1KKUA 2Z4SA 4G09A 1VK3A 3T41A 3LLMA 1XAIA 2FR8C 1DCFA 5ECDA 5CA1B 3N2KB 3WE7A 1JAZA 5ALTA 4JBNA 2WBLC 3GVXA 3V8RA 4JR2A 4D4IA 3AUKA 5LFAA 4R6ZA 2XHBA 2C31A 1RWPA 3HRIA 5AJUA 1Z18A 3V8BA 4WNCA 1Y4MA 1PGJA 1RVV1 4D26A 1N0HA 1XDSA 4R3UC 5EEGA 1KXJA 4AROA 4ZVMA 2FZ4A 2P9BA 3K2IA 3DYBA 2R6R1 3ZDCA 3E9NA 3OECA 1KVRA 2XMGA 1GCOA 4AP6A 2R9RB 5JRDS 4ZHYB 1G8MA 3WSTA 1XNHA 2Z6VA 4J03A 3TEFA 3ASZA 2A78A 1O4WA 2NLJC 1BOFA 2IKQA 4EPYA 1G5RA 1GQOA 5IYBO 2QN3A 3LTEA 4A8TA 2F23A 1SUDA 4OBXA 1TFUA 1UBNA 1W1IA 1WNTA 3IL2A 1I0HA 1K5DA 2LJ2A 1HG1A 3JASA 4NARA 4L0QA 4O2AA 1LGYA 1TK9A 2RKOA 5KHLB 4Q20A 4DUPA 2DYYA 2MYTA 2YXYA 2JLBA 3E2PA 3LSSA 3P2EA 3KKZA 5HKKA 4YV0A 4BJ6A 1QS0B 2FKAA 2UYNB 3F8TA 4LS3A 1N6LA 5CT4A 2PS0A 5JCJD 5CPFA 3DE3X 4OP1A 5IFKA 3UAVA 1XZGA 1J8MF 5FV4A 1NVVQ 2CFCA 2QTCA 3VR2D 3MUEA 3K6SB 1EEXB 3OAAG 1LW6E 4BTLA 4L50A 3HY6A 2OD2A 3Q9UA 2HA7A 3CPHA 1M57B 3LL4A 3I9JA 3TL3A 1SCDA 3I56F 3F49S 1YKGA 1KC1A 4MQFB 4Z9FA 3O92A 4GOMD 4RVUA 2I4IA 3BRWD 4G8CA 5ALGA 3IAUA 1YOVB 3PNLA 3DBHA 4J49A 2WA1A 1AX9A 1A8QA 4E5NA 4UXIA 2YZNA 3TD4A 1EN5A 3KJGA 3F2IA 4Q82A 3CB4A 5DLPA 4AJHA 4DV7O 4X1YB 3CJTA 4DQ0A 3A4VA 4GOLD 5IFLA 4II3A 2JNWA 4OHCA 1AHPA 1EFPA 2X5JO 1PZGA 1L5MA 5B7PA 2XNDA 3FTDA 1JFRA 3HCCA 4M1SA 4QODA 4X44A 1QG0A 2AFHA 3BEOA 2R1VB 2X9GA 1KMQA 4R0VA 3U7RA 5KNDD 1K9VF 4MYTA 4Q12A 5AW0A 2F1KA 4J7JA 3PUWA 3KKQA 4UOEA 2QN1A 1T25A 2FF7A 2O1EA 2WD7B 4OGKA 2NTVA 4FDMA 4KNWA 1H2KA 2CUTA 4JN6B 1X1SA 3BN3A 2YIBD 2D06A 3BWCA 1K4KA 1CDOA 1EWKA 2GDJA 1KYOF 1NVPD 3P2MA 2EULA 1XELA 2P9FA 2Z83A 4JJ8A 1K7EB 2EW1A 5EMNA 2W6OA 3GRAA 2WOJA 2I34A 3OU2A 3BIOA 3D8SA 4LF5B 2J3QA 3AFGA 1U02A 5F51A 4TS1A 5K45A 1W36C 3FAKA 5LHHA 1E3QA 3QBEA 3EZLA 2CBZA 2ZULA 3MCUA 1G0OA 1QLEB 4RELA 4FKMA 5P8WA 1UC9A 4NB5A 3RK0A 4KLCA 2F48A 1N2GA 1OC4A 2ZTHA 1T24A 2FHPA 2AG1A 1AZLA 3CNHA 1DQNA 3E9RA 2CC2A 2J3HA 4JVOA 4DR7O 3M8AA 2C2BA 3SC2A 2QTOA 4ZREA 1CZUA 3BHMA 2KSQA 4R7GA 1ZWKA 4BV2A 1QPBA 4I50A 2WFLB 1WQ3A 1WRBA 4NV1A 4W5OA 2YUIA 4P33A 2H1IA 1I2AA 3AZOA 1XPJA 3KQPA 4RDHA 2UZ3A 2AQHA 1ORIA 721PA 3CCJF 5E9QA 3R5XA 5GONB 4E70A 4BNZA 3WU2Z 4MW9A 4XTCS 4IGGA 2Z1UA 3VR0A 1WPXA 4PLVA 4HRYA 4UOZA 3TS1A 5K0LA 4UW9A 1MHPA 4IKEA 5AXAA 2VJOA 3A37A 4C06A 2A58A 3ABOB 1M1ZA 4EHFA 3BL6A 4UFPA 4EIWA 1SCQA 1EGMB 5D5QA 4RBNA 3U5ZB 2PG3A 5I9IA 1Q5OA 4RO0A 1E77A 2IBMA 2VLIA 5DI3B 3MRSA 4MIKA 2X41A 1DARA 2I7XA 4IZOA 4LBZA 4N0QA 3M4ZA 2OK7A 2R96A 4P3KA 1C3LA 2Z9DA 2DEUA 1VQ7F 2AN5A 2X8JB 2HEIA 4RJ2A 4D6YA 3O8OB 2YZMA 3OHPA 4BMDA 3FVQA 4ZVPA 3GX1A 4HGYA 2IEGA 1BGWA 1V11B 3TXXA 2KYRA 2ZTMA 5FNZA 1JI0A 1U3LA 1VLZA 3H5TA 4ZVRA 3HPRA 1NBMA 3GEDA 1UXOA 3AVYA 3EFHA 2CLDX 4ZBMA 2QMUA 1R9MA 2WYHA 1CWUA 3PCRB 4OIFA 1G3MA 2WK1A 1OWNA 3LC2O 4MAFA 4MUEA 2BMWA 3GOHA 4B3FX 3T7TA 4GNRA 2OBYA 5FWXB 4O0LA 2QNIA 1VA5A 1SU8A 4EHAA 5IYDO 1TGOA 4B09A 2QYOA 4EHLA 2QVZX 4FMDF 1E2IA 5HS4A 1Q0RA 4I8XA 4QNNA 4PG4A 1ZNQO 2PPVA 4A4DA 2IH5A 1U0EA 2ARKA 4YONB 1GN3A 5A02A 4KREA 2EZOA 3O82A 5EP4A 1TRHA 1D8AA 3C8UA 1SGWA 5AVQA 3RJMA 2HA6A 1MB0A 3WNCA 3ZBUA 3LYUA 1YHYA 2OCAA 2JJ2A 1WOYA 3J7AR 3OSZA 3MTAA 3PU6A 4JI8B 5BSWA 3A6ZA 3LCRA 1GPWB 1YS2X 4C4TA 3LY5A 2A2ZA 3NAMA 3G5UA 4TTPA 1CT9A 5KYYA 4F5DA 4QBKA 4YMWA 5T6MA 4LOAA 3O8DA 4WCFB 3MYRA 4XDLA 1GPYA 4YUWA 4R1SA 1Y6FA 4NZMA 2FZEA 3ZNNA 5J2UF 2OXEA 3OUTA 4BVKA 2VDLB 3OLZA 4BNDA 1CZKA 3ROPA 3AU8A 4AC9A 1ZM7A 4Y2TA 4DLXA 1C3VA 3EG9B 2AXQA 4US2R 2QM0A 3ZIUA 2O8VA 2RB4A 3RC1A 2QRNA 3FPEA 5C3UA 3FKSG 3B1YA 1NP6A 4HL6A 3VC1A 3ABTA 3V4ZA 3T5BA 1U0GA 3ASNB 3MQ4A 1U9YA 3ESJA 1X7DA 4C6SA 3W9SA 5DI9A 4KXYA 1QNLA 3FDFA 1SRQA 3STVA 3C1OA 3PX3A 2AXNA 2L35A 5CH8A 1ONBA 4NYJR 1E66A 3CFYA 2PUHA 1TKAA 4K6FA 1A5AB 5H3LA 3MGCA 2G88A 4RQUA 3JY6A 1KQ3A 3FLAA 2UXDB 3DMTA 4JC5A 4NDAA 3U4DA 5DW3A 4FYMA 4KR6A 3AR7A 2FSPA 2J8ZA 2AT1A 1FXWF 1NVFA 1GV0A 4RMNA 1PD1A 4NEGA 4ZXPA 1ENYA 2PUVA 4XLZA 4YDQA 1IAQA 4GZLA 1UK7A 4MR7B 4PZAA 4JXKA 2YWGA 1IN6A 3OGCC 1NY5A 1TJPB 4YAJA 4QU0A 1JYFA 2WM9B 1I94B 2XSZA 2ZI9A 3Q8KA 2TSYB 2NZWA 3BRCA 4G5HA 3G3EA 3HBNA 4HQ0A 4DAOA 4B6SA 4YY3B 3A2KA 1X1CA 1BJKA 2VJMA 2Z1DA 4M7OA 4QVIA 3PRHA 2W0MA 1Z83A 3HA5A 1Y7TA 1G66A 1HEUA 3BA1A 1ZR2A 4CM1A 3Q72A 5K03A 3VU9B 3EC2A 2XTAA 4JF3A 4H0FA 4WZBB 1F2UA 1N3LA 4BLRA 4IDBA 4J8PA 4U7WA 2GV9A 5KMGB 1IXSB 3VNBA 2VTKA 5BVHA 3A6KA 4MI9A 3X1DA 2IUTA 4LGCA 4IV0A 5BQFA 3FIJA 3ZOZA 1U2RA 4C87A 2FMXA 1PV4A 2FN4A 4R5MA 3QLVC 3RADC 1GZHB 4YLYA 3N39C 1X15A 2HA3A 2Q3BA 4NOMA 1N57A 1X1QA 3AKCA 5JROA 5TEVA 1WABA 3DD5A 4CTMA 3LAWA 1V8BA 2A5DA 1OXSC 3KHNA 4X60A 2VTEA 1XTSA 3W7TA 1QR8A 4DZTA 3DVAA 3J7AU 5BN5A 1TCBA 2DQYA 1Y3IA 3SY8A 1RC8A 1ZYUA 4DL9A 1D03A 4KR2A 4ALLA 1CFJA 1KECA 1E2GA 1MH1A 2BBOA 3K8ZA 4ITUA 4OMUA 1QONA 3X2EA 1XRGA 2BSQA 3FXAA 4TKVB 4EUKA 4TT3D 4FFKA 4CLHA 1RXEA 4EF6A 1PJQA 2GJ9A 1VKHA 3K0AB 3E83A 3BBPA 2PGOA 2FR0A 4AZ0B 2VF2A 4DR3B 4LZOA 5K3DA 1MO2A 2GBFA 3TTWA 5KYXB 1H3EA 2NIPA 1A76A 1SXHA 2HQOA 2JCSA 1I1HA 2JFNA 2OT3B 4QPCA 2ALEA 3FDXA 5KHHA 4WY8A 2FE1A 3A0RB 4F9TA 3EGXA 5TEWA 2ZYDA 3OPNA 4RZQA 1SCBA 2LFSA 4F11A 3ENWA 2XYPA 4IHQA 1E2LA 1Z6XA 2QORA 2RK6A 3DXFA 2GFHA 3O8CA 4DB4A 1GFZA 3NDPA 3FCYA 3WG7C 3SYLA 2DUNA 3S8MA 4NP6A 2J6CA 4DPMA 4W7HA 2DPHA 2DCMA 2YW2A 2J31A 4AY3A 1E9RA 5KKCA 1W6UA 3DVSX 3OU6A 1NV9A 1BFDA 1VPDA 3PS9A 3V1NA 4J9ZB 4KSYA 5K4GA 4MRSA 1QH1A 5HE8A 3ADPA 1VQOV 2X2PA 1L7AA 3KELA 1AGPA 5AM4A 4UVIA 2BFFB 5K01A 3OQ6A 1M6EX 2FWJA 5FWNA 2O8BA 1UKBA 3VQYA 4X6YA 1F14A 4CKBB 3RSCA 4WOKA 2Z6UA 5HQ3A 3ZHUA 1CJCA 4IOJA 4WUVA 4RAOA 3AFIA 1WB5A 1S7CA 4NOLA 4KWIA 4GF5A 2C54A 3UBTA 5I7VA 3FAZA 4AO8A 4U9UA 3N0RA 1MNQA 3ME5A 2ATVA 4PZYA 4HATA 3PEVA 1FDSA 4ZJYA 1MQAA 1VM6A 3ZGOA 1VQ5F 2QJTA 5IY5B 4FSDA 2MIIA 4KQ6A 3VM6A 4M8SA 1VHJA 2E5FA 4HH3C 4DS3A 2OFXA 4KOEC 2FZWA 4CM4B 1W9HA 3ICXA 1PNQA 2Y0BA 4C21A 1VE3A 3SJQC 2FPKA 4F3NA 3GBPA 3EE6A 2XASA 2WD9A 1ODLA 5EHZA 2AZMA 4EGQA 3WGQA 5A04A 2FG6C 2C4MA 1UXHA 3JQ7B 1K4DC 1YIJV 3RLFA 5K7SA 5C7IO 3MINB 5F33A 4CFZA 1SD2A 1MOSA 3JX9A 3UJ7A 2OXRA 3B3JA 4FE4A 5IANA 1XT6A 2EFJA 1QBKC 4EFLA 2PTGA 3OU7A 1X7PA 2VHCA 2EDAA 1EFAA 2QW0X 3K0CC 4P4GA 3QBVA 3SLGA 2QB5A 1OHHA 3VYUB 4ARSA 4Q05A 2C77A 4PDRA 1S2LA 4BUZA 4LR3A 3AERB 5LDGA 2ZSUA 4YUZA 5CDSA 2CYBA 4NE9A 3U0VA 1SCAA 3ET5A 4W1PA 1D5AA 2A6PA 4JROA 3JD0A 2VSOA 4NWIA 1JB9A 2Q3HA 4PNHA 3I42A 4CMBA 1O6ZA 2XNDG 2P9CA 1UFVA 4UCOA 4JT2A 3I52A 3K32A 5IK2A 3FCCA 3ILHA 2DTXA 1K75A 3KPWA 3I9MA 4Q1DA 1YR1A 4KH1A 2G09A 2O7SA 4G27B 5C4MA 1M34B 5BR1A 3E35A 1S5LZ 2CXSA 2YUTA 5ERXA 1GYRA 4XPIB 3SC4A 1HSZA 1LPOA 3UAWA 2AR0A 1P81A 3L43A 3O21A 2ZPAA 1RJ9A 1DX6A 1Z06A 2RHHA 2K4MA 1OKKD 4HN9A 5K0EA 3I9FA 2PD6A 3QX7A 5JJJB 2WF6A 5JZOA 3H7AA 3I2KA 5HY2A 3OW2F 2OZKA 2F43A 2B21A 1P1KA 3O4VA 3ZE0B 4J43A 4H27A 1NQ5A 3G7UA 1COMA 4AUEA 1GPNA 3ELWA 3JWIA 2OGSA 4DRXB 1JOYA 1F9EA 4I1VA 3ZXXA 5LOVF 1TT7A 2ZIEA 5K99A 1XPRA 4NPAA 2VK2A 3ABMC 4L78A 1EFDN 1EK6A 4RZ3A 2CNNA 1ZXLA 2D0DA 2FW0A 4MYHA 4CVNA 4C0WA 5SZIA 1M0SA 3GLHA 1VMKA 3W5DA 1XG5A 3DOJA 4EO9A 3VQWA 1FXHA 1G59A 1XZPA 4ZYTA 4LXXA 3WK6A 4OM7A 1KEKA 1SKMA 3FNIA 3MNFA 4NXMO 2JGKA 1RQ2A 1EVIA 3EMKA 2VQSA 2G06A 2Z2XA 1ZM2A 2P0AA 4M0PA 3DFFA 3TTYA 1H66A 2G70A 4LXYA 3EUFA 2H1WA 3L7KA 3U9LA 2IW1A 1RPOA 2GXUA 3P4XA 4JSTA 1G8SA 4TMYA 1KQOA 2BE3A 4JZ2A 1EYZA 1RYDA 5K3CA 5JAZA 1G2OA 3GPCA 3EA5A 2QUZA 1OCCB 3KAJA 3TLCA 3U7GA 3L46A 2VJNA 1B8VA 2XA2A 3ZDDA 4JI1B 1FVFA 4NBVA 2O0HA 3F0FA 2PZFA 1JQ0A 4X9XA 4TQ9A 1P80A 1C30A 2VHVA 2RHMA 2YZ7A 1I4WA 1ONIA 4ZJZA 5E1OA 1DC8A 1JFFA 2QN7A 1XRMA 5FADA 4S1PA 2O8NA 5DGDA 4MUXA 5CB4A 1Z13A 1E0JA 1V8PA 2ZWMA 4EHDA 2Q5CA 4MH0R 3A6JA 4J75A 4WASA 3PPWA 3ENKA 3FVTA 3SPHA 2GPNA 1P3DA 4M1YA 1A9YA 2XB2A 1NQAO 3BMNB 1Y63A 3R3JA 1NM5C 4G5OA 1R37A 4D9GA 2OHGA 3J7TA 4LZZA 3AG1C 1NNLA 1CXZA 3GJ6A 4CCWA 1W73A 1NBMG 3EVEA 2E0IA 4QM7A 3CEAA 4WLOA 1NW6A 1CLUA 4NZNA 5AHRA 1NBAA 2NXNA 5DXJA 5BUQA 2CDRA 2GD1O 4E1BA 1Q6ZA 2J4DA 3THXB 3CEJA 2CNLA 4CLDA 1ZH8A 1U5BA 1WMSA 3JAWB 4QQ8A 5EXDA 1SVUA 1IAVA 1VQPF 3QLTA 2QRVA 1TEZA 5DN6D 4JI2B 1HFJA 4IT5A 2ZJ4A 5GVRA 1L5LA 1MJHA 5DM1A 2AV6A 3W06A 2APJA 1XGKA 3UKOA 1ES9A 4I2VA 1WF3A 2BWJA 1IN7A 1I08A 3CV3A 4UNPA 5G3YA 2GT1A 4AILC 2FWAA 1TAHA 3RD5A 3ZGLA 2JJ2G 5AVMA 2E5LO 3WRYA 4PYJA 4QPJC 1TO1E 4DCCA 4MQ6A 2E6KA 3KXKA 4JSYA 3SCZA 4KR7A 1X38A 2X77A 1PJLA 3TBFA 1GN8A 3U31A 4CH6A 3LDAA 1H2MA 4LX8A 5A0TA 3VTZA 2CTWA 1E4EB 2A7QA 3W5IA 4IRMA 2O5RA 4NZOA 4CFYA 4GECA 4RM2A 1E8DA 4C76A 4BFXA 4GZMA 4IYIA 1RXWA 2Q68A 1Z4MA 3AZPA 4GYCB 1T9BA 4MGYR 2DOSA 1YMUA 2IIPA 3SLKA 4KFRA 1E7MA 1JBEA 1SO8A 2NNLD 4KQCA 3W6OA 4C78A 2VPYA 4OLHA 1YI2F 1R00A 2E4UA 3HYLA 3PUKA 5G4UC 1LQTA 1TMYA 2W6IA 2O6HA 1SBTA 1FDOA 3F4KA 4YRIA 1KTIA 5B30A 4OU5A 3T1OA 3DT8A 2X4IA 3D5QA 4F8JA 4D4MA 4UHBA 4IUCS 3Q7QA 5H59A 3ELBA 1I0IA 3SPGA 3SIPA 1UDCA 1S2DA 4MS1A 3T6KA 1V1JA 2WWFA 1OTHA 2QZZA 1JZSA 3TJZA 6LDHA 1ZUNA 1OR8A 2HFJA 1F12A 3ZVLA 3Q5DA 1M93A 3RYTC 4BQNA 1F9AA 4IJMA 2ZIWB 4EUEA 4I4TF 2R4UA 3NAGA 2Q1YA 5F1PA 1PDOA 1KWKA 1NPTO 4DIUA 4A73A 2VQEB 5B7QA 2HDNB 2XDWA 4QOIA 1U8YA 3GJXC 3RANA 3EH2A 2PUJA 1KFJB 3B51X 2O19A 1IEXA 2W6MA 1Q92A 1DOHA 4XLTA 4DQVA 4HAXA 3I8OA 3VJMA 1RQPA 4P9PA 2AXEA 4JYAO 3PXDA 4FONA 3OA2A 2Y9MB 1BRMA 1PNRA 2Y76A 1XDZA 1U31A 1YDGA 2COKA 3IRUA 2GLZA 4KXXA 3ESZA 2Z1MA 4LYFA 5AM3A 4BLVA 4X71A 3LQ2A 1NNI1 4YHHO 2WZQA 2NSLA 5KSYA 4X1IA 2GZ1A 4RGQA 2F8LA 2C7RA 4L85A 4F46A 2OCLA 5HEKA 3GLFA 4RHXA 4IGEA 1FNBA 3B70A 2HMYB 2EW8A 3M6FA 2MDTA 2BHNA 3L2OB 3O93A 4HNRA 2HWWA 1BKYA 4LZNA 4M9CA 4I1OA 3V1MA 4GM1A 3NP9A 3QWAA 1USVA 5CXUA 2BEWB 1WS6A 2FGJA 2HLPA 2PZ8A 2VT3A 2PYJA 4EAQA 3FDZA 4KK4A 3CX7A 3L9XA 1K08A 4J2OA 1YJ9F 1XMVA 3NAQA 4UCTA 4A6DA 2Q8NA 3O9VA 2WHRA 1Z35A 2IZ0A 4IQGA 3HKBA 5JNUA 4H7HA 3EMDA 1JFSA 1RQGA 3THYB 3IJ4A 2HF9A 2QE7A 4AZ3A 1X7WA 1KOGA 2FPXA 4UMDA 1L5QA 2GAJA 2WSSA 1MO4A 4B75A 2CGOA 3LWRC 2ILMA 4KUHA 3VPDA 2O7RA 3B5IA 3VYSB 2HD4A 1DGQA 5LA6A 3FZQA 4AIRA 5ICSA 2QG6A 1L7NA 3Q9LA 2JCGA 3TQCA 3VO2A 4A5UB 1CUWA 1Y98A 5E4FA 3OEED 1I2ZA 2EV9A 3OFSA 2IHTA 4CMKA 4WD3A 4TWIA 9LDBA 5JJCA 4NL4H 5KX5B 1ULTA 1TJNA 2E7ZA 4RKEA 3UH1A 5BYAA 1LU9A 1H0RA 2GCIA 2RSLA 3EDYA 2VDJA 4LAFA 3GJYA 3LNNA 4Y6PA 1A72A 3T2MA 5EPUA 5B55A 4DR2B 4BLOA 2VWPA 3N76A 3GVMA 3W7SA 3LNTA 2JZCA 1U8ZA 3P94A 3NNNA 3MTIA 1FNKA 3IPXA 3HCFA 1JHXA 2A3NA 5HUJA 4MGKR 3NH6A 5L7TA 4Q1EA 2G0NA 5LXTF 4WK4B 1ZISA 1XNGA 4Q1CA 4YGXB 1IY8A 3MLEA 4RK7A 3OMIB 2GERA 4K0KB 3ZXUB 1VP3A 5LDHA 2OCXA 4OB7A 4EHNA 1L7QA 1AA9A 5IPFA 3H1AA 1U5AA 4ARZB 3RG2A 1RXVA 5JSZA 5BSKA 1VECA 1KAEA 3FPCA 3IOMA 3VQTA 1OWMA 1SCNE 5EJEA 1G5TA 2GD2A 1COWD 1GFWA 4YRNA 1M9NA 4K9RA 3K06A 5CX4A 3LSTA 3MD0A 2QLBA 2DN9A 4JOCA 4QRIA 2N0SA 3IFXA 1WLYA 4GXTA 4TWAA 1FUYB 5M3BA 3UM9A 4M38A 3EX7C 3KT0A 5A71A 2GN1A 1JJAA 2Q49A 3KB1A 3SHTA 1NW3A 3RYHA 1N2CB 4J0FA 1R5OA 5AUNB 4MTOA 3RM3A 3FYDA 3AR8A 1NULA 5B3SB 1Q7TA 1F7UA 2I62A 3QG5A 3FOAA 2AGVA 3L7YA 5JVDB 3JCZA 4HYQA 1IOZA 3RSFA 3A4YA 3BJMA 2WF5A 3PC3A 2YXDA 1OBFO 5SZJA 2GEFA 3PJRA 5KSWB 3OR6C 1ZIDA 4YK7A 5CBGA 2VRNA 4XWKA 2IXAA 2XMPA 4E6PA 5HMLA 5G3ZA 2IV3A 1Q3EA 1QZ3A 3C3YA 3CRNA 4JVSB 1BH2A 3DBVO 1QHGA 3NVKI 1SHTX 3RQSA 3UWOA 1PGPA 3MWKA 2YWDA 1E6CA 5CPBA 2QENA 2OTJF 4HK4A 1OHHG 3GDWA 2ZI3A 3PQEA 3RS2A 2QWNB 4C2TA 1M83A 3R75A 4D0NA 3FLMA 3K0GA 2BI8A 5CT9A 3GLTA 3FGOA 3W6UA 2PH1A 3UF0A 1RZVA 5T4FA 1II8A 2CMDA 4DEXA 4URHA 2B2CA 3B1VA 4OQLA 3FLEA 3TKLA 2QQ0A 3L02A 4FFSA 1TZJA 1KKCA 4P84A 3OESA 2FUCA 1N8RH 3GDOA 1XTKA 4LYGA 3GUHA 1HTTA 3JQ8B 3E23A 5AW4A 4DV0B 2RFLA 3R3XA 3RNOA 4RZ2A 2BO1A 5AI9A 4W8OA 4H3VA 2I8AA 2C82A 3EGIA 2QVCA 1NJ2A 3JAKB 2A1IA 3DQQA 1NPDA 3PJDA 3L0DA 3C3AA 4EI8A 2Z08A 2ZB8A 1QKIA 2DR3A 2XUMA 2I4TA 4DYDA 2M6YA 4PR3A 3BK7A 3E0XA 1IJKA 1I7LA 2SECE 3ZS8C 3LPMA 2Y4NA 4DLKA 1RHKA 1QO7A 1QLEC 3C7CB 5JADA 5GQSA 3L8HA 3IVMA 5DOZA 1KI9A 4AZTA 3LWQC 3T5CA 4P7JA 5ETJA 3D6AA 1DC7A 2R7MA 2XGGA 4OHYA 1MPTA 1M1KW 4O4IF 4R2WA 2DX7A 4KXFB 2CW5A 4PZPA 1RNLA 3MHTA 3IHKA 4M0UA 3MJFA 2XQGA 3SZMA 4CEJB 4L8FA 2FLVA 2BYTA 5D3MB 1BFUA 2WT4A 4YRSA 1FNSA 2CFIA 3HR7A 4RIGA 2VJDA 1G2IA 4QTTB 4LWPA 4KRXA 2BFEB 1NF8A 1A8UA 1YZGA 4BMSA 3C9TA 5IF3A 1X8KA 2RH4A 3EWSA 4B3IA 3QIAA 3F7MA 1W6RA 1WHSB 2FW8A 1Y8RB 5DSXA 5K5EA 5L3FA 1YA6A 3G1WA 4B3XA 2ZZMA 3S1LA 4QATA 5FWAA 3R3WA 3KXLA 4DBVO 2AFIE 1JJFA 4GFDA 3OZTA 4GYWA 4E1VA 4AD8A 2QDOA 5EHQA 1HYBA 4HKTA 5JXIA 2N3ZA 2WLSA 4FOSA 3VMFA 5LQSA 3SE0A 1EP1B 1VQKV 5EXXA 3FOFC 1JAHA 2BM0A 3ONFA 4PN3A 1A4XA 3ICPA 2NGRA 3GT3A 3H3XA 2FJUA 3VTKA 1XZMA 3AESB 3SQWA 3Q0IA 3P0ZA 3S2SA 1NT4A 1Q57A 5HKOA 2VQ6A 3GB9A 1ZEMA 2DHCA 4HFMA 3A9RA 1TF2A 3V7NA 1PJBA 4TRJA 3WNBA 4J4TA 3T1YB 1N5KA 4TMZA 3K0TA 1YR8A 1SIOA 1WBDA 4YPOA 3E1SA 4Q9LA 4K8XA 3WL8A 5K4AA 1OZGA 3VTIC 2H4ZA 5I7AA 2I3AA 1EFKA 3LW8A 1NN5A 1KA9H 4L1KA 4P4SA 5HM8A 1HT2E 3IURA 3T80A 4FX2A 2V4MA 1O9GA 4K6OA 2EBHX 3SPIA 3TKYA 1I9GA 2VUHB 1F38A 4QLBA 2Z8ZA 3LBAA 1O4VA 1NRXA 5IVDA 4LV5B 2V0CA 3SVZA 4J1TC 3BCSA 2IDZA 5J47A 1FYEA 3BMXA 1RZUA 3ZWDA 1GTJ1 2BHRA 5D3KA 3SDBA 3FNGA 2W7TA 1TZBA 1HZJA 2BGRA 3SNKA 3G6WA 1ZMOA 3G71F 5JO0A 4HH4A 4HVTA 3WGYA 5F1YA 3SYQA 4MNTA 3BMCB 3SIWA 5DPMA 2BUBA 3OZ7A 4JAAA 2CY0A 5FB3A 1QGOA 2ZUUA 3O4GA 4YT4A 2F1OA 1D7AA 4F84A 1VLLA 5EJFA 4A8JB 3RIHA 4DV4O 5EBLC 3F7YC 1MA1A 4DV2B 2FX2A 1NLYA 2EVWX 1BGXT 4KACA 4F04A 2XDYA 1FYWA 1Z45A 4N3CA 4WDQA 4U2DA 4EVIA 3GZJA 1RYHA 2QTMA 2B7BA 2Z5VA 4RDCA 2PRKA 5M7EA 1KC8W 4U8GA 4BXOB 2P4UA 2ZT7A 1QNMA 2WOOA 2OA0A 2EW2A 1MX3A 3RBAA 5H82A 2H94A 1J42A 1JPXA 3UENA 2RHBA 2P65A 2J9YB 3FOEC 3I5DA 2BF7A 3L8ZA 4TRRA 1JPJA 4AZVA 3DUFA 3KJIA 3H13A 3GLGE 2WLKA 4IHKA 3BF7A 5IDYA 4N9WA 4C1BA 2YHIB 2XPCA 3SQLA 2XAQA 4ZZ3A 1U5CA 5GTHZ 1FMLA 1B8PA 2G1UA 5IYCO 3A4LA 4YECA 1QGED 3M0EA 2VSQA 1POXA 4L15A 2O0LA 1PR9A 5LLTA 5CU7A 3CCSF 2HRDA 1KI2A 4BU1A 3L7LA 4YT5A 4MIEA 3WMWA 3OVMA 5BSGA 3C9RA 4B32A 5EESA 3VQXA 2W6IG 4JQOA 3BB3A 1U6KA 1ZNXA 3E53A 1R0LA 1EI9A 1ZXBA 1GL7A 5CNMA 1L4LA 1C0IA 3Q4GA 2XNJA 3C7DB 2XF8A 4O2BF 3ADBA 3OSUA 3HKCB 3OKAA 3I1YA 1VJDA 4TLMB 3R5HA 4RHUA 1ZEJA 4DUYO 4B7KA 1J22A 3WIBA 1RYYA 4CWAA 3U3XA 3J81k 2EQBA 5A5VA 1JLKA 3GEBA 2QNBA 1EUCA 4KQ9A 3OIWA 1T2FA 1VKNA 3GR6A 5M2QA 2C8VA 4WLEA 4LJLA 4WFJA 3C6MA 3FWHA 3HEMA 1PZMA 1KI7A 4BVAA 3TSWA 3RSGA 2JGDA 3IV6A 1LUAA 4G26A 4CE6A 1S2NA 5ILOA 1E59A 3P7MA 4C2AA 4RUFA 2XEDA 3VYRB 1FF9A 3ZJZA 1S89A 3U3OA 3MAGA 5DYNA 5G1NA 1FW8A 3B78A 4AJ1A 1O94D 2W98A 3HJBA 4BR6A 5EXEA 4L6IA 2Z4RA 2GYYA 2VDQB 2QW1A 2YV4A 5BYBA 4Z53A 3IEUA 4D0SA 4D9CA 1ZK0A 1RMQA 3U26A 4W6ZA 5IJ0A 2F6RA 4ENSA 5TT1A 3D2AA 3E27A 4R31A 2WMNB 4IICA 1RQ7A 3UWMA 2XW6A 2PUWA 2BFDA 3QE0A 3H1IH 4KHPB 2EZ4A 4U6QA 4DUZB 2VRCA 4G41A 4KDCA 2NUBA 2YYEA 3OOJA 4LOLA 2VRBA 2R48A 1E8NA 5KWEA 5AK6A 4WLVA 2IUSA 1XFDA 1VMIA 1SCUB 3PT9A 3ETCA 4QUHA 1GG2A 2RHJA 1MG5A 5FDFA 1PS8A 2ZR0A 4RAQA 3W9UA 1OFGA 2W2KB 3ZHSA 2ZJ8A 1NVBA 3G82C 4M87A 3TQTA 5ESRA 2IXEA 5IT0A 1Q44A 2E55A 1N8SA 3OBYA 1W3EX 1FBTA 1L8OA 3T5DA 3D8BA 5GY7A 3K71B 2RN9A 1P2UA 2QE7G 3CUSA 2WSSG 2XOKA 2OO3A 3Q8WA 2XX3A 2LE0A 2VP0A 2GXSA 3GFRA 2JFZA 4DY4A 4W9MC 1N0VC 2QMQA 2R84A 5DTIA 1SKQA 2GBCA 1RWBA 4PX9A 4LMAA 1JFTA 3IDAA 3DKVA 5ALKA 4IMPA 4IEIA 1KZ6A 1CQJA 2BVNA 1KYVA 1KXZA 2QWQB 2GI4A 3LCJA 2FZCA 3QE3A 1Q2UA 1PVDA 3EN0A 3NB0A 5C5IA 2Y0EA 5L3RA 3DHWC 3LUAA 4QX6A 1ND5A 1UP7A 3OT4A 4TL9A 1G8YA 3GWKC 4ED9A 3ER9A 2DZDA 3IAXA 2QUJA 3KZNA 5LBIA 2WWRA 3O1HB 1V8FA 3CMEV 1O6GA 5KOYA 4UHEA 3K16A 2B5UA 1R0WA 3PNYA 4RK0A 4B8WA 5EIOA 1ZL2A 1FVOA 3LCMA 2ZXUA 1UQUA 5F1KA 3AINA 4L02A 3RSOA 2C2AA 2PS3A 1B6TA 1AKUA 4GMKA 5ESDA 4KXWA 2QX9A 5LZ2A 4X3CA 1XLVA 4U6NA 6REQB 3G4SV 2IPLA 3ORHA 4PC6A 3FFAA 3OZSA 2HGZA 4LECA 4WBXC 4QICA 4GXQA 4B08A 4ENVA 2V7VA 3PV0A 1R3DA 3R7WB 3TINA 1FK8A 1CK2A 4WL0A 3UOWA 3SFVA 1T3HA 2HCRA 3NEJA 3CMCO 1CUSA 3A8TA 4W5RA 5IY5C 1NX9A 2DYRC 1C14A 3HFRA 4Q4CA 3CPEA 3PHBE 5GINC 1XE3A 1HNXB 3FMIA 2JCYA 4W1QA 1WAMA 4M6WB 3GHHA 1CVIA 4FYJA 2EBUA 2R72A 3F78A 1NWHA 1MNAA 3M70A 4H0CA 1TCAA 3WMRA 1ZA2A 4YR7A 2DG2A 5B2ZA 3H86A 1M7HA 5BO5A 2NOAA 3QLUC 2P9HA 3G80A 2WC1A 3UMGA 1UBMS 2O8DA 3GBSA 4A2CA 1NV8A 1FNMA 4WN9B 1XQWA 3BEDA 4FLWA 4RDXA 2Z2YA 3DHVA 4RF5A 4DJ5X 4NULA 3U4MA 2VDOB 3KLPX 2P78A 2JK1A 3FOBA 3VYUC 1OH5A 1QZXA 1AUVA 4X3OA 3ZHVA 1MV8A 1D2CA 3GFPA 5DW0A 3C24A 5C8ZA 3A1FA 2R25B 1IY1A 1OCOB 5FAXA 1YS9A 3UKDA 1A2OA 1YO6A 3QLEA 4N6GA 5HIAA 4AECA 1WMDA 2QXUA 3KSUA 5FL7A 4M8IA 3B20A 5FEMA 4FCCA 3RROA 3ONNA 3NZEA 4QQRA 1MG1A 1TMGE 1Y67A 3KQOA 4KKXB 1E9BA 1KO7A 5HXZA 1NQWA 4E7OA 3F6RA 3IP1A 1MN6A 1YOBA 4D43A 2RAFA 3NYQA 5G0WA 4TVSA 4G9EA 3LC7O 4IDAA 3E22A 3M1XA 1E4OA 4C04A 4PHCA 1AS2A 4BNFA 3ZU4A 5I6DA 3M6WA 4NV0A 1AKTA 5FNVB 2BY4A 5KYUA 1ZBDA 3K96A 3D1LA 5DSZA 4FR5A 2DFVA 3TK1A 1Y76A 1ARZA 2H5EA 4IYRA 1CJBA 4D9KA 2KG7A 2YFHA 4PIMA 1CYDA 4XUCA 1RXYA 3HUTA 3FCAA 4JK3A 3ZE1B 4M9RA 2O8EB 3VR3D 2Q3LA 4BFCA 4BO6A 3LG2A 1PQYA 2BHTA 2CVHA 4UKDA 5GZ1A 4G5SA 1NN3A 1O6FA 3M6XA 4NTYA 5M5BA 1ZQ9A 5HA5A 3T34A 4PPQA 1S2MA 3ADKA 3WISA 1U8AA 3L8DA 5EVJA 1MX1A 4EA9A 4MLCA 1U9CA 4UQOA 2REBA 1SU6A 4UBOA 2OQIA 1CQIB 3SZGA 1Q7YH 1R16A 1AQNA 2PGLA 1Z2AA 3SHQA 3ZW9A 5AK3A 3CLTD 2BMDA 1QB7A 1XMXA 3QPUA 3SC3A 2EYQA 4QJBA 3VNRA 3AGKA 3WYDA 1QYXA 3RF7A 3E4DA 2VPZA 3L1VA 1L8XA 2MQEA 5BRAA 5AKLA 2P6YA 2PMPA 2L6LA 2J3EA 4IJ5A 2JFOA 1DS6A 2XGJA 1VSUA 3NX4A 4TUYF 3V1UA 2Z57A 4FT4A 3TZHA 3R9XA 2NVBA 4TWRA 5LP1A 4RH1A 5IS2A 4K8ZA 3OQ1A 3TGWA 3TKAA 4ZOLB 2G72A 2MMGA 1QK5A 1GAJA 1OB2A 3CPWF 1EAYA 2OE2A 4TQUS 1ORWA 1W47A 4Y9SA 3H3FA 2AJ8A 5J2TA 1SS3A 4GVLA 1QDUA 3X3HA 4GPTA 5TLSA 3ILVA 3K94A 5IYZF 2Q8QA 3ONWA 4H35A 1XA0A 2O1XA 4MW1A 2KJQA 4NZYA 2RCYA 3NMUF 5AOVA 4OK5A 1H2XA 1GAEO 1QCDA 2QUKA 3UJDA 5A0FA 4OQXA 2Z3ZA 3WL7A 1X1BA 1N6IA 2GR9A 4Q9AA 1DQPA 3AF5A 1TO2E 3GG2A 3ZI4A 2J7PA 2WIJA 2C99A 3VC2A 3LXXA 1FNDA 3DMHA 2I78A 1PT6A 2PXAA 1XEFA 1KQSU 1K2VN 5LQJA 2HYIC 1G9SA 4MWBA 4TSRA 1EP2B 1S8NA 4YCMA 4M83A 2DBYA 4MLPA 2A59A 1G21B 2WLJA 3C0KA 2XQFA 5ENDA 3HCBA 4R2XA 3FMFA 4HAOA 3UXMA 2E1PA 5T8KA 3H84A 3GH1A 3F5WC 3PRJA 1UDBA 2MYPA 5C93A 2B33A 4OI1A 2PWAA 3IEXA 3R77A 4QOGA 1U1GA 1YTLA 5DHUA 4AQYO 1IY2A 1T6ZA 3CUYA 5AXCA 4UEJA 3TL6A 5FO0A 2H48A 3B1ZA 2OYQA 3RVBA 2RJZA 4P0QB 3A3NA 1OI2A 5B3JA 3TOSA 2FN7A 3RT1A 2GA9A 2KX7A 3M4YA 1UPCA 3CC4V 1G60A 1THGA 3H2BA 1OLOA 3AL0C 4DCMA 5F4ZA 5DTJA 5TB5A 3ZOPA 1LVHA 4R69A 1M2KA 5EB1B 5I7FA 2WU3A 1RHMA 4UUPA 1JHVA 3R1IA 2D2VA 3RT3C 3ZTYA 1OH8A 2KWIA 3W4KA 2F8TA 2E3JA 1V2HE 1ISGA 4Y2QA 4HRAA 4K88A 3WYFA 4WSOA 2EWWA 1Z6TA 1QKJA 1E2DA 5I3ZA 2HPVA 1ZM9A 2ZW9A 1NLUA 3VQVA 3JQRA 1VQMF 4I6EA 1B0AA 3AWIA 2HADA 4GOJA 5LLSA 1VF6A 3VHXA 3CSXA 1Z5PA 3VNUA 4F6LA 3WA6A 4E3WA 3GJSA 1NUSA 4HNAA 1W48A 4NICA 2OM2A 3PI6A 2QWXA 4IIDA 4Q3OA 4R01A 4CIAA 1VSQA 1XYVA 5LMCA 1GRJA 9MHTA 2XYGA 4B46A 1ZITA 2O07A 4G4JA 1STOA 1T1IA 3ANNA 4XIGS 3SSNA 4L4YA 2X7RB 2X0NA 5EJAA 1QIDA 1M1YA 1O9HA 4LV8B 2IODA 3K35A 2X7HA 3L05A 4LWOA 4OGLA 1V41E 4WX2B 1HEYA 1WUJS 1PZEA 1IPHA 3GFSA 3NXKA 2AFRA 1C4OA 1IN1A 5F73A 3JWEA 4ETNA 4PQEA 2A92A 2Q4PA 3GJ3A 4F5EA 1CS0A 3EIQA 5DLQC 3JAMM 1JLHA 1Y4AE 1OAOC 2QN9A 2H1LA 1VG9B 1W2HA 3GGDA 1MZFA 5EZ6B 1X13A 4AI8A 1PHRA 1ECFA 4ND8A 3OE1A 2Z5UA 5KO2A 4V0KA 4O4HA 3P45A 1P74A 2E9SA 2CHQA 3ZHQA 1QC5B 1Q17A 3HU3A 4O3MA 4E5SA 2UAGA 1H3FA 4NE7A 4LK2A 3OJXA 1WO8A 5JC1A 1GWNA 2D5BA 4I3GA 2IPAB 3GGJA 3A0HZ 3COZA 1XL6A 3I7TA 1HDRA 2PUBA 2FEKA 2JIDA 2ES4A 4M46A 3IKFA 3DO6A 4Q1VA 4ETWA 2WWYA 2HHHB 3GLHE 1MB3A 4BO3A 1YD7A 5H3HA 3S3XA 3K08A 3K5PA 5GIPC 4XQGA 2VYVD 1KQNA 2AQ8A 4CS2A 1W19A 4J9UE 2UUAO 4NX2A 1JXOA 5EA2A 4G8DA 4XUGB 4RQBA 1AY0A 2DR0A 2ATCA 2H59A 2YVAA 5FLKA 3CVXA 4C7JA 4X8OA 2IY8A 4CV1A 5FPOA 2F4NA 2WB4A 1UR5A 2RHCA 5CYOA 2ZANA 3CH4B 1FLNA 3ESQA 1G41A 5DXAA 2YMQA 3T99A 3ZD7A 5BMVB 3PXXA 3CE9A 1KRHA 3I9KA 5KAIZ 3NETA 1CK4A 4MZDA 3FFWA 3NYRA 4OQQA 1LK5A 2MSEB 2YN4A 1LF5A 4FI3F 3LH5A 5EGSA 1OFHA 2JAQA 1JJIA 4LA4A 4RXTA 2J0EA 4RTMA 4B87A 4YP1A 3NGLA 3SJAC 3V7EA 4X20B 4E14A 1GG5A 3F6YA 4JP8A 3FYUA 1AQUA 1NVXQ 2AE1A 3R40A 1OYWA 5K0JA 4C5BA 3I9NA 3NTOA 3PXUA 2YZGA 5A03A 4CLOA 3JPWA 1IZZA 2XODA 1ZH4A 1C7ZA 4JEHA 4EY8A 3UA3A 4ALNA 4U2BA 1QX4A 4B3CA 2CW4A 1JG1A 3CBQA 3HXMA 3CE2A 2A9JA 4Q18A 4AKEA 3HB4X 4K8OA 5AK4A 3OKPA 1Z38A 5JJBA 4YJ3A 2DKFA 4RA9B 2XOKG 4L5CA 3X43A 1PL8A 3E8GA 1E96A 4C7OA 1N75A 2CLFB 1H4TA 2L2QA 4HDKA 1PG5A 3RARA 4P4UA 3TL2A 1BWSA 3MC1A 3N0VA 4Y1RA 4MKGA 3OZAA 1AJQA 3P5BA 2Z0AA 3EVZA 4KP4A 3DEYX 2EATA 5DK6A 3ZU2A 4HAVA 4JLVA 1VCOA 1YA4A 4BO9A 5CX1A 3KJJA 1E5QA 3H9UA 4RJKA 3AEKB 3JD1A 3FMPB 3FPSA 4TRNA 4HT3B 1LVGA 3L6OO 1GKLA 5K6TA 3BH0A 3VHLB 2XUAA 1YCHA 1PEDA 4QT4A 4DSNA 1FZQA 1IRIA 5JWHA 2SCUA 3BGIA 1YRWA 2Z04A 1XZQA 5SZHB 4XASA 4KMOA 3UBMA 4D45A 3SBDA 2V96A 1GQRA 3OTOB 4EARA 4YQEA 1I5OA 4UTNA 1OOEA 2YHUA 4RPHA 4G1FA 3GMSA 4RTKA 2VT2A 4CM8B 5EE1A 1UBTS 4WQMA 1PNOA 2R7NA 3DGEC 4U7DA 4KQXA 3RO7A 1D6NA 4BIUA 5DBIA 3QE2A 4H0LB 1J2YA 3Q3VA 5CG1A 3MK31 2NVWA 1XYGA 2FP4B 2ZYVX 3QXGA 3IVAA 3BXHA 1PKEA 4TM8A 1E5LA 4FNMA 1UM9A 4JD5A 2CNDA 3LK7A 4L8GA 3ONDA 1X6VA 2H4FA 1G2PA 1SMKA 2GO1A 1R73A 3MYYA 1CIPA 4XA8A 5IJZA 4K3AA 5FCDA 2VP4A 3BL8A 1N34B 5DJ5A 1FU7A 2PX0A 4INAA 3ROZA 4EKGA 5A2QM 5C8YA 1G5HA 3CR8A 3SEFA 3GFVA 4W99A 2PSDA 3WKEA 4K05A 4EG4A 3AOGA 2OENG 2J32A 3E1YA 3ED5A 2J08A 3TQFA 3G23A 1U04A 1P77A 1P6QA 1QFZA 4NJMB 2JGAA 2ZVQX 5FBHA 2PMEA 1LV7A 4LRTB 4UTRA 5CJPA 1YB1A 4JZGA 3QOWA 3ZE7A 4FN4A 1S3GA 7MDHA 2H2FA 4J0CA 3S1AB 4PO3X 1ZJZA 4YMLA 4L9SA 4JYYA 1LTKA 1SC4A 1DFIA 1V7QA 2QKSA 1JVBA 5E7MA 4EKYA 4XOUA 1EAMA 1EDZA 4EUSA 3Q2KA 2FR8A 1N9ZA 4C7VA 2WA2A 4F4UA 4GRAA 4QL3A 1NX6A 5FL7G 2HREA 2ZSAA 2JLVA 3FPLA 2Q07A 3KLNA 1F7VA 3VPSA 4DHEA 4G07A 1T9DA 4O4JF 5AW1A 3B3QA 2ODMA 4BAZA 4X00A 3E3OA 4WFQA 1WXFA 5FTWA 2MSLA 5CW2A 2HKOA 2PO5A 3RYIB 1S6YA 3QELA 2Q0XA 1H05A 3GNTA 1KMHA 1W0JD 2OG2A 3HYCA 5F2OA 1YEWA 1ZUQA 2HSZA 2I6RA 1W85B 1QU3A 1JEOA 2OBNA 1GM9A 3Q6NA 4R7TA 5B66Z 1C1YA 1NUQA 3N1UA 2UXCO 3GD5A 4JBXA 3D8CA 4B9AA 4IM7A 4Q4HB 2VEOA 1HQDA 2NXEA 1TO6A 2HQRA 4DJJA 3ID6C 2CD9A 4AZWA 1PJTA 2UZHA 1Z5OA 4RFLA 3KBBA 3V80A 3KR2A 3NUQA 3NC0C 4KRGA 1BE6A 2PLRA 4TRMA 2ZSFA 3HBAA 1CIJA 1XMOB 4ZQEA 2OMKA 4M1ZA 5LDDC 3RUFA 4CG0A 1HW7A 4UB6Z 3PUHA 1DBSA 2B35A 2GRUA 1BHBA 1JIKA 1U65A 1RKBA 4MTGA 2H92A 2H2GA 5ELMA 1U3TA 4R68A 4EEZA 2HTEA 4OX9B 2WIFA 2P79A 4FFLA 1P5JA 1WPRA 1LJLA 1OB5A 4HAUA 3ZWKA 4I3FA 4NH0A 2J87A 3NBUA 4AG6A 4P1ZA 3JWPA 2YOFA 1FS5A 1ESDA 5KNBD 2I6XA 3KB2A 2VUTA 1S7GA 3F3KA 3KSRA