3HKEB

Tubulin-t138067: rb3 stathmin-like domain complex
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 128
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkeB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkeB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkeB01
4X1IB 4EB6B 4TV9B 3VO8A 3UT5A 1W581 5M7EA 5JH7B 2RHLA 3JALA 3N2GB 5JVDA 5CB4A 4F6RA 2BTQB 5J2UA 2Q1XA 5BMVB 5CB4B 3RYFA 4IIJA 3E22B 5JH7A 5IJ9B 3UT5B 5IJ0A 1W5BA 1JFFA 4TV8A 5FNVA 1FFXA 1RLUA 4HNAB 3C8LA 2BTOA 1TUBB 4O2BA 5GONB 5CA1B 5KMGB 3RYCB 3JASB 4M8IA 4DRXA 2R751 4O4JA 3JAKB 4FFBA 4O4HA 4U3JA 4B46A 5IYZA 5EYPA 5C8YA 5LXTA 3JAWB 5EZYB 3HKEA 3HKBB 5LYJB 4ZOLB 5JQGA 1Z5VA 4E6EA 4DRXB 1TVKB 3VO9A 2VXYA 3JAWA 5IYZB 5LA6B 5J2TA 1FFXB 2XKBA 1JFFB 4TV8B 5IJ0B 5CA0A 2VAWA 4WBNA 3N2KA 4O2AB 3JASA 5KMGA 2XKAA 5LP6B 2RHJA 5BMVA 1W5FA 5LA6A 5J2TB 4IIJB 5LP6C 4I4TA 4ZHQB 1OFUA 4EB6A 3ZIDA 4X1IA 5ITZA 4X20B 5JQGB 3HKCB 3JARB 4IHJB 3HKBA 4YJ2B 5LYJA 3HKEB 4ZOLA 3N2GA 4X20A 1SA0A 3V3TA 5LOVA 4X1KA 4O4HB 1SA0B 4U3JB 4FFBB 2RHHA 3JAKA 4O4JB 4YJ2A 4EI7A 3ZBQA 4ZI7A 3HKCA 3HKDB 2VAMA 5ITZB 5JCOA 2RHOA 1W5EA 3M8KA 3N2KB 4O2AA 1TUBA 4O2BB 5CA1A 4HNAA 5KX5B 4YJ3B 3RYIB 1Z5WA 3ZBPA 4EI9A 3CB2A 4DXDA 5MN4A 4EI8A 3RYHA 4F6RB 4LNUB 5CA0B 5EIBC 3RYHB 3JALB 2R6R1 3JARA 3WGMA 3VOBA 5EIBD 3RYIA 4YJ3A 5LOVB 5EYPB 4X1YB 3RB8A 3WGLA 4O4LA 1RQ7A 3VPAA 4I4TB 3HKDA 3RYCA 3JATB 5C8YB 5GONA 4TUYA 4I55A 1RQ2A 3M89A 4X1KB 3WGJA 5IJ9A 5LP6A 3E22A 4O4LB 3RYFB 3WGNA 4WBNB 4LNUA 4O4IB 1W59A 2GVIA 5FNVB 2Q1YA 4ZHQA 5JVDB 3VOAA 5KX5A 1TVKA 2BTQA 5J2UB 4O4IA 3WGKA 3R4VA 1FSZA 5JCOC 4I50A 5EZYA 4ZI7B 5LXTB 4B45A 4TV9A 4XCQA 4TUYB 3JATA 4I55B 5MN5A 5MN6A 4KWEA 4I50B 2VAPA 4U39A 1W5AA 4X1YA 4IHJA
chains in the Genus database with same CATH superfamily
1FRNA 3AEUA 4IV5A 4HDAA 1B93A 3SNKA 4B1FA 4MRMA 4BTVA 1M8PA 5BWCA 5CB4A 3DBHB 4Q1VA 5E9JA 2Y1CA 3KTAB 1U2PA 3LC1O 4QJ4A 5J2TF 1LD3A 1OR8A 2WTBA 2X1MA 4WI1A 1NNEA 3HNPA 3WGUA 1H0KA 3UO8B 2FGYA 3SJBA 5H3LA 5I5GA 5KHLB 2IUFA 1DT3A 4V38A 5K3OA 3S0HA 1B42A 2H63A 1OGJA 1P0PA 2HLNA 1NU8A 2Q3BA 3CEMA 3D4PA 3JYQA 2Z30A 3DE0X 2FXIA 3SVLA 4Z1MA 5F7OA 4QM6A 3Q87B 3NHAA 1DAHA 1GEEA 5EC2C 1JILA 3NIWA 5SYAA 2OCCB 2PUDA 3GLGB 2AI3A 3PQCA 3U3JA 5LMUO 3C6ZA 2IYRA 3TPFA 1YZUA 4WEQA 1PJQA 4NSNA 4B3IA 3VO9A 4YHHB 2WLLA 2ENUA 2IYNA 1JHVA 2XWBF 3MJDA 3QFFA 1G4UR 1W73A 3DAFA 4Y2TA 3RLIA 3VFDA 1QK4A 4HDNA 3QTBA 1UPCA 1EVLA 3LDTA 2X8WA 3K9HA 3EZ9A 2VH1A 4XDHA 3RS9A 1DJLA 3KSUA 5L3RA 3UHAA 2ZRDA 5D5PA 4ZK7A 3ZLVA 2OYCA 4LJ9A 3CSUA 2OV3A 5BQFA 5JZVA 3TUJC 1K33A 3DTUB 1KYOF 2P5OA 1E6EA 1PWEA 4IHJB 4JI0B 1CXZA 2BRUA 3HYRA 3DM9B 1RI5A 1ZIDA 1B6TA 3I3OA 1Q16A 4JI7O 3FN4A 3K4QA 1W2HA 4XPIA 3KTDA 4IIUA 7ABPA 4DA4A 3EFFK 5F1OA 4LQCA 3SYLA 1RBZA 1V25A 2C7BA 2F8MA 3QU9A 3B70A 2WJGA 2M6KA 3TIGA 2WKQA 4NL4H 3ENNA 3NOOA 3OE4A 4MDFA 3R65A 1NVAA 5JMPA 4B7EA 1VRCA 2J5QA 3L1KA 2BELA 4ZPXA 5B3JC 1NQTA 4KTVE 4ZRDA 1Q3EA 3OD1A 6PFKA 1V2GA 1A4RA 4EX6A 4FE3A 1PFQA 3T5BA 2B61A 4BVHA 4HDNB 1LBSA 1SMKA 2OAEA 1JDZA 2RHMA 3H2HA 4H1TA 2O8CB 1RHKA 2QX6A 1EAYA 3LH5A 3HM2A 3LX6A 4FFDA 5B3LA 3JWEA 1KIFA 4XLZA 2QNIA 4M4SA 4PDRA 2ONJA 5F51A 4CH4A 1UFOA 4RY0A 3BAAA 3V1YA 4UB6Z 3JCMM 2CMDA 4UEOA 1PFYA 1ZIYA 2IIPA 3S3WA 1OVMA 2XMGA 3COWA 3M89A 3KV1A 5J4VA 4IJMA 4NYMQ 2XNHA 2ODPA 3KSRA 2YFQA 1GZ4A 1FXHA 3K0GA 4O4IB 1OVGA 1SHZA 3EGXA 3I05A 5IDWA 2JGLA 4DHWA 5EAZA 4A0HA 1NKSA 1FK8A 2ZU0C 3SJUA 1QQBA 1YZQA 3W0LB 1RP3B 3G80A 2C2AA 4W4TA 2XXAA 3ZHVA 1Q7TA 2UYNB 3K9GA 5D3KA 1FFGA 4WZAE 3WLHA 4ZI7B 1ESEA 1QIGA 2R6JA 2J3HA 4P82A 2TSYB 4DCNA 5LJLA 2B8WA 3HUFA 2FWAA 5JCJA 1E66A 3N5CA 4YI3A 1JDTA 1PS8A 2XJ4A 3WWYA 4MYHA 2QRKA 1SOUA 3ZRXA 1GVNB 4NBWA 3W9BA 1J00A 3GCGA 1P5FA 2CK3A 3H99A 4A5SA 3IOBA 4ZQIA 4E7OA 5JY6A 3DB1A 2LBXA 5HY2A 2F1HA 1PDWA 4KB5A 2J45A 3LQQA 1F12A 2R86A 3TW8B 5H3CA 2QA4F 4NV3A 1N7JA 3HI6A 3ISVA 3E1SA 3P71T 1GM7A 3OIVA 2XYHA 1MJ5A 4JKYA 3T1HO 1I4LD 1TCCA 2D1FA 3PIRA 1XN1A 4H13B 2EDAA 3UAGA 5JIBA 5KYYA 5LD2B 1P5ZB 1PN3A 1WCXA 3JAKB 4CG1A 5BNZA 3V4LA 4MVJF 5FTLA 4WN3A 2ZAGA 1PL7A 4NNOA 3VNQA 3AK2A 1RWKA 3OCCA 3L7KA 4DW1A 1KHTA 2VJYA 3LDEA 1JEQB 5ALJA 1M4UA 3RVDA 3N8NA 1FIUA 2JIDA 5AT1A 1RQPA 3ECAA 1PZFA 5F4ZA 3DZJA 2Z1EA 1QLNA 1O5IA 1D0IA 1TKCA 4EH1A 4IV0A 4ZQHA 2O2ZA 3DULA 4C78A 1E4VA 1XOUA 1QBZA 4F4LA 3KOUA 3DLHA 2Q4EA 1I4WA 4CM7A 3CJRA 1E9RA 1CK2A 3VR0A 4TZKA 4OLHA 4MVJA 2ADMA 2RGGA 4Q20A 4OQZA 2GBPA 2Q3FA 4O6VA 2FFJA 4PYOA 3EUEA 5DK4A 3S1AA 4D80A 3U44A 1HRKA 3WBKA 1X7GA 2P7TC 4XUEA 2Y1EA 1DRWA 3JQBC 4RVNA 5AHKA 3OZ7A 3DBLA 1YU9A 1FDTA 3HCPA 1J0EA 3R6DA 1X80B 1VRVA 4TTSA 2C54A 5E8JA 4EL5A 2H6EA 4HUJA 5ALXA 4C3UA 4RMHA 4YCCA 1PFUA 6Q21A 4W9RA 1KK3A 5CFRA 3T1YB 3ITEA 2J5BA 1JJVA 1KI8A 1UXHA 1PZEA 4JDPA 2W37A 4IJWA 1FXKB 2GPJA 4NABA 1Q81W 1XZQA 1K86A 2DFKB 2ZVDA 3R5SA 1KQNA 4MWEA 2WD9A 4F4UA 2Y77A 5CBPA 4C7UA 4JEUA 3CIFA 1ISHA 3K6RA 5DX8A 3RUEA 4L85A 4QICA 4CE6A 4NK4A 4EMTA 4WDQA 1RQ7A 1NGSA 2OO7A 4DMUB 4DE5A 1FRZA 1FLNA 4EENA 2Z2XA 1YRLA 3C39A 4JI2O 2P1ZA 2XQJA 1E0KA 2QRUA 2UZ4A 1SK8A 2EZPA 3K4PA 3OLXA 4XD7A 3S28A 5F7XA 3MAQA 1QBGA 5FUXA 3CCMF 1XZMA 5DLYA 1QJ4A 4ZWNA 5DO9A 3Q3GE 5A2GA 3VAAA 3U6KA 3DG9A 1J9EA 3ZJTA 5KDLA 3WZLA 4QYXA 4BFTA 5AKJA 4DKJA 1ZJ6A 2P4HX 1P72A 5AHRA 4MA4A 5JS8A 2Y4UA 2EHDA 1C80A 2GFQA 1KEWA 4I6GA 3JTEA 1VXRA 2Y48A 4YVFA 2GN6A 2I6UA 2RDMA 3OIDA 5H80A 3DC5A 3VI4B 4PWZA 2WFZA 3L6BA 4TXMA 4QPDA 5L3SB 1EFDN 1Z4QA 3DEFA 3I5AA 2XUMA 2Q7HA 3LUAA 2D59A 2FPGB 3R5XA 4R8MA 1D5CA 1G7TA 4X8HA 3KQQA 5FHQA 3TI7A 4HMQA 1VQPF 1MA0A 1T5OA 2FW0A 3NDPA 2VJAA 4KREA 2KG7A 5EB1B 1NKTA 4BJ1A 4C4SA 5AVZA 1XPOA 3RVRA 4GX0A 3L82B 1K66A 2XMDA 1PGQA 1ZH2A 1T2NA 2VK8A 3NBQA 1GG5A 1RYEA 3VC2A 2EWVA 4WK2B 1QDUA 2EW8A 1XCLA 2V97A 4QJ3A 1YA8A 1ZK3A 3MTGA 1OLUA 5AG2A 2CBGA 4MVJM 1NU6A 3COVA 3BXZA 4YJGA 5E38A 2QQ5A 2IPAB 1QCEA 3EIEA 5EE1A 3DAYA 4ZAWA 2IHTA 3U1VA 1U2SA 3NVMB 1A9XB 1R8SA 3LPDA 3E9YA 4LOLA 2G7ZA 2OTMA 4G4WA 1OIXA 4YCDA 3FZQA 2V1UA 1CVLA 3A4MA 4IFTA 5CT8A 2YV1A 3LMKA 1ZM2A 3H9UA 3M9XA 3CCUF 3DDWA 3PDJA 3WG9A 3FYDA 4Q00A 5C18A 2GLXA 5BQ3A 3TSCA 1FTWA 3BL6A 1H1DA 3P9KA 4HLUA 1LF5A 5A9SB 4M55A 3PC8A 4GKKO 1SBYA 1NFFA 2HG5C 4R1NA 5AJZA 5F4BA 1RYBA 1XTPA 3CLHA 3FVTA 3IAM1 3S55A 3TQRA 3UY4A 3FPEA 2ZIOA 1MEOA 1XD2B 2BZ0A 2C29D 4GYYA 3V80A 4HG2A 1U0EA 5FOWA 1G3RA 3CT4A 2JLWA 3GEBA 2DOSA 1LSUA 3IUYA 1C9YA 5DRTA 3WGZA 3EHEA 1VE1A 1N2SA 2B78A 3E8BA 1RHRA 4OPMA 5CIWA 3I6QA 3CNEA 1X7WA 4EFBA 3VIUA 2X4LA 3MWDA 1L7EA 2XW6A 3NFYA 4LISA 3TL3A 3WGGA 2VS0A 5BY1A 1QG2A 2J3DA 5A4JA 4IVQA 4XQ9A 1IK4A 4Z54A 1YZTA 2VBIA 1ZW1A 4YACA 5U4XA 1K5HA 1CUCA 3OE7A 3KOMA 2HPAA 1WCWA 3STXA 4EG0A 3K5IA 1G3IA 2WLJA 4Z4FA 1KPGA 3TD4A 4YS6A 4J41A 5F3DA 5B8FA 5HZKA 1PIWA 3FUVA 2UUOA 2CJFA 4QDOA 4JELA 1E7MA 3HRKA 3DVLA 5DNEA 5E1AC 1YTUA 2EJRA 2CNNA 1Q6IA 2H1WA 3HDHA 2O3UA 4WKGA 3G2JA 4ALIA 1T9ZA 4ABTA 1S5LZ 3ZDCA 4WSOA 3NK7A 1B2RA 3ZCRA 2IYEA 3VBBA 5EHGA 3G85A 4ISCA 5BSWA 2GR9A 1MNGA 2L0XA 4MP3A 4L6CA 4PSUA 2FZGA 5TJ9A 2XQKA 1K8XB 1XNQB 3EX7C 4X6UA 1ZI8A 4PGMA 2DQ0A 4DCMA 3KPJA 4MYCA 1ND6A 2C7GA 2JEYA 1RJWA 2CCKA 2GEKA 3C6XA 3NR2A 2ZI5A 4I46A 1W3EX 4IRMA 4L8WB 4QUBA 4MULA 1O96B 4DCUA 4EY7A 4D8VA 4GVXA 2GJ9A 5JNUA 1SVMA 3QVGB 4IIHA 4H1UA 1IWPB 4YPOA 1NN3A 3O21A 3VOSA 3DP7A 3EFOA 3CB4A 4OI1A 2E76B 1GOTA 1SHKA 2COEA 2DOKA 1ADFA 3C70A 4CMKA 5L6MB 1NHWA 5BVHB 3KB8A 2C82A 4J9UE 4DFDA 3KU4A 3HAXD 3LO8A 3V2GA 3RK1A 4LF9B 1SRRA 3GL9A 1NX6A 1MHTA 1ZZEA 2BHTA 3O03A 3X1DA 2AEMA 4KSYA 3IFXA 1HE8B 3NGXA 3KJJA 1MH1A 5LDDC 1VSVA 2X0JA 4E5KA 5CLJA 4GR5A 1K9MW 3SDLA 5LNK1 4EQ6B 2JARA 3SC6A 3T7EA 2ZVJA 1KHHA 4PZUA 3L8FA 4P0PB 1C3XA 1WXGA 4RS4A 1GQFA 5DF1A 1XA4A 5JH7B 2QIOA 2V65A 4P4UA 3E2MA 4ZYWA 2XCRB 3I61A 1GFZA 2F1RA 2GI4A 3GUCA 1JPNA 1VQKF 2NXJA 2Z56A 4KP7A 4EKIA 3FYEB 4BO5A 1V8FA 5KWSA 1XZGA 2GA8A 1D2MA 2OBXA 2ZW9A 4B84A 2XAJA 2EX0A 5TPWA 4H4EA 4RDIA 3ZQJA 5K8CA 1DJPA 3SZOA 4FYIA 2J7KA 3KBOA 2QTTA 3UFBA 3WIEA 3TIIA 2W9XA 4KZKA 1T3TA 1XF1A 3GJZA 3KVRA 3WNQA 5KZMB 1WO8A 4S1VA 3T54A 1GZVA 4EGSA 2E55A 1S0VA 3CEAA 2Q2NA 5F5NA 5T6BA 2C5EA 4GL2A 1H8EA 1COWD 4U6SA 5T4BA 3H6HA 3M49A 1RAAA 2DLNA 4LXYA 1WZEA 2IOFK 3CH4B 5I4CA 5EHZA 3W1VA 3UJCA 4KP4A 7ADHA 3HR4A 1AC5A 4CBVA 1SC6A 1Z4PX 1K7DA 2JLZA 1SOVA 2HDHA 2XYQA 2G40A 3E0QA 4KUHA 2ZRLA 2DQ4A 1OAKA 4G4SP 5JHGB 1GQ2A 5AI8A 1E5VA 3AUTA 4MTGA 3RARA 4ZIRA 1PU2A 1IXYA 5T4HA 1P1FA 3I58A 4NEHB 1PWZA 1MG0A 2YBDA 4M6WB 2Q0OC 2GGSA 3OWHA 3H1IH 3B85A 4MQEA 3RIHA 4TPKA 4R1SA 2GYUA 2AI1A 1XKTA 3BJIC 3A04A 2WVHA 5FKJA 5KVQA 5DX0A 3R7DA 4YUWA 1DB3A 2PD3A 2VATA 3G2LA 1U9CA 2VJDA 4B2IA 1RFLA 1V5WA 3HB3B 2PWZA 2KI5A 1C7JA 4U3JB 1SA0B 2REQB 3HU2A 1IG0A 2OD2A 3KXIA 1R3DA 4RSMA 2BR4A 1ENOA 4OXQA 3K9SA 3QOXA 1XYVA 4IUBS 4ND8A 4KRYA 4ZCRA 2GD6A 3SPJA 5CXUA 4CC5A 2FB5A 1VHWA 2O0KA 1Q7EA 5THKA 1AGNA 1LNQA 4Y1RA 4YAUA 1T9GR 2ZWIA 1BXGA 5K8VA 2V9PA 5GMOA 1X9HA 3D3QA 2YZ2A 3DDCA 1TF5A 3K3PA 4GXTA 4A16A 2WLLB 4RKQA 2CGOA 1MABA 2WHXA 1P9LA 1MO5A 4RAIA 2C4MA 2WNSA 3O93A 4CN9A 4HV4A 3VNVA 1D04A 2B6NA 4ZGWA 1GITA 1BU8A 2O1WA 3CW9A 1OPXA 2DPHA 4ZGGA 4ZTBA 4NEQA 2EG9A 1D8AA 2HIHA 5TS2A 2IDMA 2DLDA 3FPAA 3CC7F 1M1ZA 3JAMN 1PD3A 2XDQA 4D92A 1WV1A 4KAJA 1V3QE 3QBVA 4X85A 5AK5A 3DEHA 3I92A 4R6XA 5F1YA 3OCVA 4ZJPA 4OX9Y 5MFPA 2ZR3A 4HAWA 3IQGX 3TINA 3EY4A 4H6PA 3NC1C 2WM8A 5HPYB 2ZDIA 3RREA 1ELOA 2KLHA 4F4CA 5BN5A 3DBIA 4DM4A 2PNFA 2HCFA 1MA1A 1W2BF 2I6QA 2O8VA 2WILA 1I8TA 1XAHA 2DYRC 4RLSA 1ODLA 2G3YA 3EGXB 4J7UA 2IJGX 3VC7A 4GG1A 3V3KA 3EH1A 3A3PA 4YAJA 1F4VA 3ZY4A 2I3BA 1AIPA 1K1EA 3BZUA 4JC4A 2TRSB 1MENA 3LW7A 5ECDA 5CNJA 1N0WA 2VHVA 4CQLA 1OWNA 1JAZA 3PPYA 3L92A 3LBNA 2DPXA 3RO7A 2Q6VA 4F3TA 3MMNA 3SXPA 4AMZA 2WSBA 4JU9A 1TI7A 3VNSA 2IS2A 4JLPA 4X1YA 3EIXA 1U0JA 3H8SA 1O4VA 3R3UA 3QXXA 4G85A 4WCFA 2BJWA 2FSHA 1P7YA 3ND9A 2QL7A 1L7AA 5EHQA 1ZUNB 1AKUA 3OT1B 1GU0A 2O2HA 2Q0SA 4ARAA 2LP7A 2WAAA 3LC0A 2J41A 1U9IC 2J6BA 1BYIA 3R24A 4FGLA 4S1PA 1UZUA 1RQGA 1YDGA 2HXSA 5ALSA 1WLSA 4JV5O 3FSGD 4AKIA 5I4KA 2AC2A 2C9YA 1KXJA 2Z5UA 1EEXB 3FWPA 4LDAA 1OASA 5EKUA 3PEWA 3BHNA 2P2YA 1E60A 1QAMA 4FPPA 2J6CA 5JJKA 3FJOA 4JC8A 1VL6A 2PXHA 2R96A 1WMAA 1DO2A 5HFLA 1HETA 4U0KA 4BFWA 121PA 4Q12A 2ITDC 4WFHA 1TQ8A 2CXXA 2W5UA 4K86A 1KL7A 1NBIA 3CEIA 2OHHA 3W2EA 5KQSA 1WBJB 2PMPA 4YPVA 2VWPA 5I7SA 4NBVA 3KUUA 4OJMX 4CMAA 4KITB 4UV9A 4UE2A 2DETA 2DU8A 3RABA 3NK6A 2HPZA 3B40A 5KTNA 4V0QA 4DUGA 4I4IA 2XD9A 4S24A 2VH5R 1Y6XA 3DP9A 3A6EA 3FKSD 4W1SA 4ZAZA 3V34A 1PK9A 1JB1A 2P79A 3ANXA 1ODEA 2PRJA 1N5KA 3VKHA 3C9TA 1HMPA 3KZMA 1PK7A 1EUDB 4WN9B 1P1BA 3R3YA 1CZNA 5FD8A 4E03A 1TGYA 5B2ZA 2WWVD 4Z2WA 3DWIA 1S8NA 3OQIB 3A11A 2A5GA 2OBBA 3DDSA 2C0CA 2VDNB 3QUAA 3INNA 4MA0A 4UHEA 3DAPA 3OZFA 3JARB 1FS6A 1TE2A 2FW9A 1O94C 1JLSA 1WW2A 3E9EA 1HQCA 3AY7A 3IQWA 2ID7A 4TYWA 4XUDA 3T3GA 1YGYA 1L5WA 2ACVA 2WTAA 2ZJ4A 4GI1A 2DRIA 3MFYA 4LF8B 2HRQA 4LZPA 1VQ9F 4OAQA 2Y1DA 3V6MA 1L8OA 4OSPA 2IYTA 4UFOA 1ZD8A 2GN1A 3C15C 2XCIA 3QPCA 3EIUA 4J49A 1GQRA 2XCQA 1WB6A 1LRLA 1PG2A 4LYYA 2X4IA 4RK4A 3WGIA 2ITCC 3AG1C 3RYIB 2P0EA 2LV8A 2Z8YA 3K2BA 3JQBA 3BDAA 3K6JA 2DYYA 1U8TA 1U3PA 4B3TO 2QTVA 4DXWA 3L8YA 1G8JA 1BWRA 1KOJA 2QI9C 2YZNA 4NHEA 4PZAA 5E79Z 3ZZTA 3SYCA 5JMWA 1YJ5A 2C5HA 4DEXA 4YT8A 3JVEA 4RY2A 1YZLA 3BGDA 2B1GA 5FA6A 3ZZ1A 4UOEA 3KKNA 5EJ9A 2P5UA 2W4IA 3FTNA 3GVPA 4RHCA 3ZXXA 2X86A 3E2PA 1QQ7A 3Q1KA 5KHGA 1KS9A 4V1CA 5HUJA 2O57A 1DWQA 2VNHA 4PNEA 2VF8A 1DIBA 2BISA 3QELA 4N03A 3DUFB 3M6AA 1M1YE 4YYEA 3T7JA 1T5DX 2AW5A 2D0PB 4DQVA 2BE3A 3T4DA 3AB8A 1VJRA 4UHFA 5HUQA 1N1GA 4ALMA 1NLYA 2C4WA 1VGRA 4WFEA 3A6JA 3GBSA 3JQPA 1SBZA 4LY0A 2Q73A 1RIFA 5CVUA 3JV7A 1X7XB 4F9GA 3C3CA 4KO8A 4U2CA 1LBIA 1E63A 1Z75A 1XU9A 1HWYA 5B57C 4TT3D 4CM3A 1BDIA 4B2PA 3EZGA 2PT6A 4L2IA 4OFXA 4B7ZA 4G0WA 2Q4TA 3MJCA 2R1TA 4MRSA 4Z9XA 3T95A 5K51A 1U1GA 4FEYA 1BGXT 2ODEA 5IH7A 1NXSA 1RTTA 1D4FA 1YBAA 3G5MA 3TIXB 1XJWA 1Z36A 3S2UA 3WO0A 1QTRA 3I55F 3LLCA 1GTZA 2M2IA 3NTQA 2LD4A 4DR6B 1VTKA 1I7NA 1G8SA 2D6FA 3PYMA 2LBTA 3K1ZA 2C2ZA 3WOVA 3ZRVA 3TBHA 2EWCA 1SC1A 2OZLB 1AP6A 5G4KA 1JLHA 3QHDA 1LTHR 1IBMB 4DG9A 3O95A 4OH1A 4BJ3A 4UXJA 5I9TA 2QGZA 3F90A 1PJZA 2MSLA 1KORA 1RCUA 3S2IA 5BUQA 5I7RA 3ONNA 2VDKB 4RKRA 3CX8A 3KO8A 1XWIA 1JFFA 2H18A 1BROA 2NLOA 2RJNA 1M73E 4LGCA 4FK5C 4CTJA 4X8MA 3I9V6 3SYTA 2CBXA 4R05A 1WXHA 4TYQA 3UFXA 2AFIA 1SEVA 5LR6A 4CEIB 4J0IA 2XVXA 5HFAA 3VZQA 2C98A 1VG8A 4AO6A 4YROA 4NZMA 4ZYTA 1YBVA 3P0RA 3U4AA 5DW3A 4BQSA 5B36A 8AT1A 1YKGA 4RSHA 4BNWA 1YFKA 3H2GA 3ZK8A 1NYLA 1V9SA 2B30A 3SFVA 3TJZA 1C5KA 1Y3BE 4OAPA 1O08A 3L6CA 1NWCA 2DFVA 2FOIA 2A35A 4F5DA 2FMXA 4A4DA 2C58A 4NP6A 2CMFA 3APQA 1M2NA 4HFJA 3R3XA 2FA9A 5EPUA 4X93A 5GANK 1Y5RA 2LTAA 1YMVA 3UMRA 1P5RA 2O3TA 4MPTA 5EIWA 2XMBA 4HPWA 3OOJA 2X5JO 1U0HC 4IQ0A 2Z4SA 1UINA 3RIMA 3IUBA 2J0UA 3KSAC 1WX1A 4ZAXA 3WKCA 4HGPA 4CG3A 1F1JA 2RBEA 4EB6A 3Q0IA 4U5XA 1OT5A 3TAXA 1Z39A 1U43A 1U0SY 1T1SA 1PQYA 2X0RA 4X3OA 5CG2A 3L7MA 4KDCA 3L0CA 2F4NA 1UMCB 3FOFC 3AF0A 4DY6A 3CVYA 1BC5A 3ZWMA 5IFKA 2F9MA 3EHBB 4AYWA 3ZWYA 3L0SA 4DUPA 1F4LA 2ZOSA 5UKDA 5DTIA 2HIAA 1TIPA 4NEGA 4BEJA 4HSGA 3IMCA 4DV4O 1W30A 3ZQ6A 2HF7A 3N8HA 4ZREA 3QU4A 4PW0A 1OWPA 2VHCA 4IIVA 5KKAA 1N5OX 1U3UA 2IGBA 3RYTC 3TEJA 5HJ5A 1Z5WA 4KMOA 5MDHA 3O6VA 2E7ZA 1P33A 3C41J 4BCDA 1VMIA 4QTZA 5IYDO 1MRNA 3PKZA 5JPDA 1AQUA 2PG3A 2LQTA 3KYIB 3LOPA 3JCUZ 2NO7A 1XZCA 2FZEA 3CZMA 3DW3X 5CM8B 5BT8A 3FAVB 3DDHA 4ZCQA 4YCBA 2CY0A 1D1SA 1JJ7A 2WRZA 1ZN7A 2YIJA 3B1KA 3OEHA 3QIVA 5CDHA 1U1FA 3GELA 5E3HA 2I34A 1T8TA 2PD4A 2V6JA 4K35A 3OPXA 4C7OA 1ENZA 4Z8XA 3U48A 4BN5A 1P8JA 4PGFA 4IT5A 5FPRA 4EA9A 5KIAA 3LUTB 3GHYA 2B0JA 4K1LA 5G0WA 1UJ2A 1TF7A 4N3NA 4NOLA 4KR2A 3GJYA 3D0OA 1HUQA 3H2ZA 1O7JA 3LP8A 3OZAA 5EMJA 1DBVO 1VG1A 1XAIA 1T26A 3RS0A 4ZHQA 4Z7NB 2O7RA 2WFLA 2C00A 1Y1SA 2VKTA 1ZMRA 3UCXA 1XFAA 4Q3DA 5CR9A 3BHIA 3QFTA 5AK0A 3HN7A 3ZU4A 2W42A 1H2ZA 3TQQA 3ZX6A 2JK1A 2NACA 3MGAA 1BGWA 2XAAA 1BDJA 4M1OA 1EK5A 1P80A 4WT7A 5AOBA 4N21A 3CPSA 1U11A 4BMOB 3TTSA 2XWSA 2DT8A 2H8GA 4H0CA 2O48X 1ID1A 4E5NA 4K46A 2GCPA 1CP2A 3ZZNA 3PD7A 3CZPA 5FEUA 3W7SA 1Z3CA 2VZ8A 3MWGA 1MOPA 1QRRA 2AOUA 2WKRA 2PX5A 4MLZA 4W6QA 5H8WA 3CUTA 2J1LA 1WXIA 4C04A 4I5EA 4FZ0A 3D8NA 4IGGA 1G6HA 1U9JA 3D1VA 4RVOA 4XEUA 4KCGA 5TPZA 5JCZA 3KYDB 2FFRA 5CK4A 4S04A 3AVOA 2E1PA 3DFIA 4D0NA 3C90A 2BMDA 2AJCA 4DLXA 4NE9A 3VKGA 1VKNA 1Y1QA 3G9UA 3KTFA 1ZMXA 2B5WA 4RD0A 5TY0A 3CZCA 1BFKA 1A76A 1KH3A 1YQXA 3QYPA 4FZ5A 4MUHA 2YI8A 2XTZA 1MSWD 2UUBO 1DFHA 4FFRA 1YTFD 2FP4A 1RJFA 1S5HC 3I39X 1KJNA 1BHQ1 2LIPA 5B1BB 3B3JA 3FTFA 2X1HA 1TECE 5EYPA 3GO4A 3GNQA 4ZAGA 2V5VA 3BRCA 1ZM9A 1GJRA 3OFJA 3U0VA 1FVFA 4W5JA 1AUOA 5IG2A 1FNJA 2MT9A 3Q15C 3OTGA 2ZYUX 3RTGA 1PJ2A 4ZYZA 4LWSB 3KZCA 4ZZ3A 4OXXA 2DVMA 2Q4DA 2PZKA 5CDYA 2ZUVA 5TC4A 2JGIA 1XUQA 2GT1A 4IILA 2PUCA 3K1YA 1XYYA 1B15A 1V1MB 1YCFA 2GKOA 3AKCA 3ITDA 3PDCA 2XKAA 3HZRA 1DSSG 3N5KA 4Q9AA 4YJ3F 1SURA 3U61B 1LF0A 2HSJA 4KR9A 1WQ4A 3PKJA 3BXGA 1YGPA 3ZKAA 3W06A 3B77A 1ZD5A 4ZVTA 1OFUA 1RKQA 2GEVA 1H2RS 2FW1A 2OGSA 2ZCUA 3RS2A 5HXZA 1LNZA 3L49A 1M56C 1XEWX 1Z5NA 3KQOA 2AT1A 3BGWA 2AG5A 3L6UA 4Q3EA 4XFJA 3UK2A 1LX7A 3BXHA 3KZ1E 2Y0CA 3DEKA 5DB4A 4R4JA 3DKIA 3F1LA 3FBGA 4EJSC 3GCDA 1KNKA 3CC2F 4TWBA 1JD1A 1N6NA 2R84A 5AW6A 1EXDA 1CJBA 2VAMA 3DLPX 4RHEA 1N2CE 4EG1A 1BQ0A 1J70A 1DUSA 1QFYA 5FBKA 2R70A 4I14A 5G53C 3DXRB 4N5HX 4REMA 3BD6A 4ZO9A 2EIMB 2Q50A 3CTPA 1IHYA 2ZAMA 1ESNA 3A6HA 1X13A 3H9EO 5FOSA 3ZBPA 2B25A 1RM1B 4EI8A 3HEBA 1JAHA 1P29A 2HGSA 2I8CA 1QGZA 1H8HA 4XCVA 4G1MB 1U28C 1PGOA 1QIEA 4C7XA 3S2SA 4Q6WA 1IN7A 3FB8C 4B7XA 1EFRG 2H4ZA 4BO3A 3LGXA 4WPGA 3TLAA 4MV4A 3SQNA 4Z0TA 1NL3A 3HI4A 1ZGJA 1B41A 1H8HG 1SIUA 2VSQA 1GRNA 1QIIA 3NRJA 1JFVA 5CJJA 3GWGA 2A88A 4CEHB 1C30B 1KF0A 5IABA 1C8KA 3Q9SA 1T91A 1ZSVA 2ZRIA 2W4MA 3WGJA 2GK4A 3WADA 5IJ9A 4BIMA 4P31A 5KWVA 4PY2A 4GIBA 4N76A 4LFBB 3O85A 1U8UA 1N6PA 2F3PA 1O94A 2Q1YA 2RHDA 4DQ0A 2DERA 3DOHA 3W3ZB 1UJWB 2FVXA 3KSBC 3EQ2A 1QVAA 3M4JA 3RHSA 3AL0C 3DTNA 4B6PA 3HWSA 1C0IA 4AROA 2DH5A 2I7CA 4HZGA 4MKZA 3RIYA 4RQAA 3PRKE 4ZICA 2XRYA 4JSTA 1WMEA 2H8CA 2NZYA 1L7QA 4RTQA 3QQ5A 4NQ3A 4EZIA 2FFBA 3A6ZA 2BUBA 3PVZA 4MB2A 2A59A 1GRQA 3P2EA 4OQPA 1AUQA 1V8ZA 5JUWA 5EIXA 2HJGA 4I1VA 1NE2A 4B79A 1CDOA 1OILA 1YRBA 2QMQA 1IY8A 4I08A 2AWNA 3W6UA 1AVMA 1UPTA 3FMPB 3QPBA 4FW8A 1IXKA 2YFKA 3S2YA 1B6QA 1D4ZA 1SUAA 2BLLA 3I5UA 3TQHA 4EAAA 4KVZA 5LWQA 3EEQA 1KMNA 3K6KA 1RI1A 5DU2A 5EMNA 3B8EA 5BPFA 1JJAA 3UKMA 1JV2B 5B1AB 1SVOA 4CT4B 2ZRBA 3ELYA 3IB6A 2C20A 2HZBA 5LBIA 5K0CA 3C14C 3Q85A 1BHJA 4G5YA 1U7WA 5BWOA 3KFLA 4EUSA 4CKCB 4IIXA 2JL1A 4RXMA 4J0GA 1G5RA 1YB1A 3ZWNA 1V5EA 1XI1A 3R0PA 2PJZA 1NQAO 1Y8AA 1GG8A 3AR4A 1JB9A 4QU9A 4WNAB 1RM0A 2GJAA 2HS4A 3AOEA 5IC6A 1KETA 2PVSA 4KI0A 4LGYA 4I5DA 4XGNA 1AI4A 1LKZA 4H35A 1VJGA 3MCTA 1MMMA 5JBNA 3TSOA 3TNYA 1TTPB 5ADWA 3EW9A 2LKCA 4EJSB 5KWEA 3T7SA 1J9GA 3S68A 4F6CA 2RGNA 1XLTC 1XQYA 1ZA2A 1VLMA 2P9ZA 3UT0A 1VF6A 4LCKA 4F45A 3VU9B 5BMOA 1NBWB 4PO9A 3NWBA 3T0FA 5J2TB 2WT4A 4AY3A 2R8ZA 2X7JA 2WHYA 2I3AA 3AR2A 8MHTA 1GN4A 5GJVC 4DOMA 2X8JB 1SCUB 1FBNA 1PWHA 1M57B 3CMEF 4L8JA 1Q1EA 3DVAA 2WI8A 1K0UA 1G20B 2Q9CA 4L4UA 1H6DA 1M2HA 4QXOA 5IAEA 2P8JA 1G9SA 1QG4A 2IITA 4UNQA 4G1EB 4MYUA 2WA4A 3VPDA 2WSIA 3OZEA 5A4FS 4QVGA 5EJ7A 1Y1PA 3F3KA 2Z6VA 3QMVA 1N0HA 2BMEA 2YY7A 4R01A 4EPXA 2Q8VA 1AS3A 5HMLA 5KTOA 1C29B 1NUUA 4G09A 3HA2A 4GAEA 4PN7A 2QTOA 5BYKA 1JR3A 2FF7A 4B32A 5CITA 4HJXA 5JYCA 3DF7A 1ECPA 2NXNA 4YRPA 1AOXA 3ZHCA 3D0RA 1IPHA 1ZWKA 4IVNA 4IX1A 1TQ6A 3GYQA 2E4XA 1C7QA 3ELCA 5F2OA 3EXG1 4ACAA 1YZYA 1QYWA 1YS4A 3M7IA 5JTUA 1VSUA 1AGXA 2NO9A 3B53X 4XQ0A 5ER9A 3UMSA 3ZDQA 1ECGA 1TZMA 4KL8S 1HYEA 1UEJA 1U6IA 1W0JD 3QHPA 2EJUA 4RGVA 1HTWA 1P6QA 1GXSB 1QO7A 1X8JA 1BGVA 3RVYA 2JRIA 3L9DA 4R54A 3CCBA 4IMIB 4MWOA 3I52A 3LECA 2CK3G 4WZAA 5IUJC 3RCBA 4AQ7A 4RA6B 2ZR2A 3IO3A 5C8YB 2EZ4A 1RADA 4HTFA 3VRHA 3ZDDA 1N2ZA 3FZEA 1Q8IA 2XAFA 7GPBA 2FTKE 2QTHA 3W2IA 2VRCD 3GFRA 3HY4A 1ADCA 1MEEA 2J09A 5TGTA 4IOMA 1SRYA 5H6QA 2JJ2G 4I0XB 4J11A 1WSWA 2W48A 1WZCA 2ZI9A 3F6CA 5GVSA 4HXFB 1CJMA 2EXXA 1XK7A 1VQ7F 2M98A 4O5OA 4IQ8A 4G88A 2CUNA 2BGWA 3C9RA 2ZIMA 3H3JA 2COUA 1X7ZB 1SZQA 2J9GA 2X0FA 3WGTA 4R81A 4Q7MB 3RF7A 3GAAA 2YJNA 2G9RA 3BK7A 1ODKA 3HMKA 4ICGA 1F2UA 2H8EA 3VH4A 4HDSA 3GMTA 2NR5A 1EFPA 1NN5A 5DYIA 3D00A 2I4OA 2WDZA 1G2QA 1T8PA 2FQQA 4NTYA 4B87A 3A9WA 3ZD7A 2FRVA 4KHZA 1UEXC 3OHSX 3A2NA 3ZRWA 4D8UA 1SBNE 1OXSC 4F3RA 1CY7A 2G1PA 1N33B 4W5OA 4DQKA 2XNSA 1CY8A 1V4NA 2VK1A 2ZWAA 2QM8A 4TMVA 2E21A 5TQ2B 3IT3A 4IMPA 3FNRA 2WWWA 1J6UA 1OHHA 4G4SO 3OF5A 2WVAA 3CGWA 4XPZA 4NULA 1QJCA 5DLEA 3ZLBA 2DQSA 3FPFA 1Q7RA 1XVUA 4EA6A 1S5JA 2ZJ6A 5TT0A 4IDBA 2AOXA 3Q6MA 3MWYW 4C0XA 2IHUA 1I9CA 2AHOA 4AJLA 3K30A 4PLFA 3W7VA 4RIHA 4G28B 2JB9A 3ADCA 2HM7A 2VDJA 4J0DA 3IDQA 4M53A 1CQZA 2I1WA 5ICEA 2FN3A 1V2HE 1HP8A 5JEDA 3D6NB 1U7XA 5IK2A 4CIBA 4QZVA 1VDZA 2G63A 1Y76B 3HJTA 5A5VA 1S72F 1QIJA 2IXEA 2NU6A 1G55A 1I5YA 3DVQX 4FQ5A 1CUVA 1KJZA 2NUPB 2E4WA 4K88A 2ILMA 3C2QA 1YQQA 3H5RA 5EIAA 4UZSA 1QP8A 4F72A 1Q44A 3O8NA 4ZO6A 2JLRA 4P58A 1SRQA 1WPQA 4X0EA 1A5TA 2A4KA 4WXEA 3P4EA 3LUKA 1DOAA 5CDFA 1CRQA 3DL7A 3R6LA 2X5XA 4PZLA 3T4UA 1TTTA 1DKMA 1EX1A 3KHNA 1TO1E 3V8NA 4JXKA 2HK7A 3TGWA 5LLSA 5JYDA 1M1KW 2PS0A 2O1SA 4CU5A 1Q0QA 4GBED 4W8GA 5BMVF 1JJBA 1DWPA 1R2QA 1H8ED 1PW7A 4HX5A 3KKQA 3U2QA 3PE3A 2VT2A 4NMHA 4TSRA 3U7RA 2PUTA 3F74A 3RFCA 3AESA 3NDRA 2C97A 2IP2A 1SXJD 2F59A 4BLQA 4LPSA 1XRSB 5B4UA 3A3KA 1L5VA 2GSDA 3GD5A 1ZH6A 3IKJA 4W6ZA 2BEWA 3QYFA 4HT3B 2XUPA 1KECA 2VXOA 4AZ0A 3ID6C 3ZS8C 4BHTA 1JDUA 2K9PA 1MF7A 2WT9A 4BVLA 3BMNB 4DWJA 2YDEA 1ZKMA 5HRCA 5D86A 4U7GA 5C53B 4HN9A 3V1TC 1U1DA 2HTFA 1YL7A 4NCJA 4P4NA 3SDBA 4ENUA 1O6GA 4RC9A 4CEJA 2CJXA 2ADQB 1IM2A 4DXDA 1LC0A 1PQUA 2VT7A 4Y2XA 5DIZA 2X3FA 3BUSA 2V7XA 1V5IA 2FUEA 4TKMA 2A30A 2Y0BA 3UAWA 2R6R1 4MRPA 5JCPA 2X4DA 2D7DA 2ZWOA 2CH7B 1KFCB 3K1AB 4JEIA 2H1FA 3B1YA 3BYZA 3G3EA 4X90A 2N3ZA 4YP0A 5GIOE 2WZDA 1VLZA 2IPLA 3BM5A 6REQA 2NQ2C 1AJPA 2ET6A 5GTDA 2P3LA 1S4QA 3GLFA 3AG4B 1OCCB 1KP9A 4DO2A 4MKIA 2QEQA 3AG2C 2CAZC 4WVFA 1NQWA 4H3KB 5T8KA 5KU1A 1R3JC 2I6TA 3B9RA 4N8DA 1OSNA 2P35A 4PC1A 1JDNA 4RL6A 2Y1FA 4ZT7A 4CF7A 3IHKA 3JQ9A 2V3WA 2XT0A 1FP2A 1MDBA 1NSYA 5LQKA 3SJAC 1OFVA 1UOOA 3K0HA 3QLVC 1G1MA 3UQYS 4KRGA 3OEHD 3ZU5A 4WCFC 1APBA 4IDCA 1R1MA 1AU9A 1IY0A 4ZQCB 5AVRA 1DDGA 1SCBA 2ZETA 4U5QA 2X0KA 3DT6A 4ZCMA 4BLUA 2P4EA 3EN0A 4ASUG 3G4SV 1MFZA 4JEHA 4DZZA 1YBHA 4UD6A 5ILGA 1G59A 4RW0A 4XH9B 1WMSA 1QRTA 4EYGA 1CZOA 4CFSA 3GIWA 2AW3A 1AQIA 5JPIA 3T0GA 4EK9A 1YQ9A 5JFOA 4LE0A 2JHGA 3IAM6 4OI0A 4KR6A 3V8VA 2ZIXA 2V7QD 2HO4A 3AUKA 2CL6X 4HRXA 3R8XA 1FYFA 4E94A 3O2QB 3L7LA 1RYYA 4Y18A 4D3ZA 4JASA 2BLNA 1NI8A 2HFEC 2DUUA 2QD3A 1TAHA 2DGDA 5K3AA 4AJNA 4AY6A 2Q2QA 1R8QA 3B82A 2W6ZA 1ZOLA 3HPRA 3OEYA 4PYRA 4RK1A 2OG2A 2QA5A 4TQAA 4ZVVA 3T3NA 1YQWA 2PAAA 4YRJA 3GEPA 1GCAA 1V1RB 4YRDA 1ZSNA 1U1IA 5AI0A 4FMDB 5CYOA 5EXEA 1I33A 5TMPA 2EX3A 4NCBA 2G80A 3PN1A 4H0LB 2IS4A 5A2QM 3PDIA 3B6NA 3STVA 4F4IA 5JS7A 2J08A 3ANYB 3H3XA 3ML1A 2PA3A 2ZTSA 4MCAA 2OYSA 1FPQA 3I56V 1SQSA 3VR6D 2GYWA 1JJ2U 3R20A 4L2IB 1OTHA 4M9QA 3F78A 3UQZA 1UZAA 1RC1A 1G20A 2ATKC 3FVRA 3NHRA 3V1NA 1J2EA 4CETA 3G6EF 3P2OA 4GQIA 2ZT5A 4V0ME 5EJ6A 2X1VA 2QPOA 1FFXB 3QI7A 3S03A 3UUEA 1OX5A 4Q0MA 2UAGA 2F62A 5CW1A 3U19A 1ZVKA 5FBLB 5ALFA 3CT6A 4NXNO 1G18A 3KVOA 4Q37A 2YZGA 1CDZA 4Q7KA 5AVSA 4ZU3A 4OHBA 2UZ1A 4FX2A 1P3JA 1WP4A 1FUIA 5IT5A 1NS1A 2C2YA 4PWTA 3JD3A 3SZLA 2HREA 3BDVA 3DHEA 2X13A 4DV5O 5FPQA 3WJ1A 3FVVA 4GLFA 3WK8A 1RHUA 2VPYA 1G66A 4L15A 4AIRA 4YAIA 4H0FA 1M1KH 4JYYA 3GFBA 1EFLA 5K05A 1J0BA 2NSLA 1M33A 3UK0A 1ORQC 1N3LA 5EN4A 3ZBQA 2D54A 4ESEA 3EVGA 2Y05A 1GO1A 4MQ5A 4PC7A 3TVDA 1EVJA 2IPOA 4KGZA 5I47A 2CB9A 3PJGA 1XRMA 1WY5A 2GBFA 1VPDA 3FX2A 4RMNA 4WOKA 1KO1A 4K9MA 5D51S 5ALTA 3RJ9A 1HDRA 4Y67A 4HQLA 2HX1A 2WD7A 4BO7A 3GB7C 1T8RA 1XHEA 2VTEA 3FMVA 4N40A 4OQFA 3OQMA 4XUGB 1XROA 1ODCA 2PKCA 2BF7A 3X1KA 2QQFA 3AEKB 4QO8A 2HP0B 4EHJA 1P2GA 2XLCA 3R8FA 3PG5A 4JQSA 1F2TB 1EN5A 1L4GA 3QX8A 4QYTA 3AF3A 5IT4A 3TOXA 3ZCTA 2L6LA 3ZHQA 2WM3A 1OB5A 3AVWA 2IQIA 4Q15A 1WPBA 1R0SA 3A6LA 4IOLA 1COWA 4MO2A 4RTOA 2ZJAA 2QN3A 2VTVA 3LK6A 3CSSA 4X61A 3ZPXA 4P53A 4UBJA 1YHZA 3EYWA 3VNRA 2EKDA 3AHJA 1OT3A 2AS0A 2H2GA 3KEFA 4RIFA 4HDRA 1HZZC 5KYNA 3QITA 3MAAC 3HGQA 1SULA 2FX5A 1Z15A 3H6GA 3N39C 2X3YA 3LOQA 1MOZA 3NW9A 1AO3A 4P3YA 4X91A 5D84A 5DKFA 3TLGB 4DNQA 1NN0A 1POXA 1Z37A 2I4LA 1Q0RA 3BE8A 2W6JG 3TKLA 4CUZA 4DM3A 1B8NA 1NMSA 1CP3A 1VPLA 2IU3A 2J31A 3CF4A 4HNQA 3EWNA 2A06H 4V0MA 1VEWA 3MHTA 4X66B 4J9ZB 4WY8A 4R2IA 1FMTA 1OIWA 4QO7A 3BORA 2P41A 1YAHA 3G0DA 2GZRA 4HGRA 5HIIA 4AILC 1E6UA 1W88A 3G0HA 1YDFA 4BFSA 4HYYA 5EIEA 1SGWA 4J0QA 5JRJA 1S8FA 1TMGE 4ZZ2A 5EIHA 1VG0B 4YIKA 3WJAA 5BXQC 3VO8A 1XXLA 4CCYA 5BR8B 4BXOA 1TA9A 1XZAA 2QSJA 4LDJA 3ZI4A 3Q6NA 2JBHA 2Q9UA 3RE3A 2OQRA 3GLQA 5B53A 1LLFA 3MT9A 4KPGA 3G5AA 2G1AA 4D79A 5IJWA 1S89A 4BVEA 4PHZA 1JAYA 3L7CA 3TH5A 1QZTA 1XO1A 4A0GA 1I2ZA 1RAIA 1Z4IA 1Y5MA 4G0QA 1T6BY 1YQNA 4QPKA 4O2LA 3TCNA 1I80A 4ITUA 4CKWB 1ZP6A 3PJRA 3GH3A 4E08A 4E5DA 4DL9A 2I4IA 1ENYA 1SQ6A 4Q6BA 2NG1A 2XV1A 3BULA 5ICGA 1T35A 2QDXA 3O4GA 4C82A 1EGQA 2ZS9A 5FTMA 1G4AE 4BS9A 1W47A 2BMAA 2VHTA 1PCXA 1L0BA 3NBXX 3TEMA 4BMCA 4BNYA 1QRUA 3IQIX 4TV8F 1FYXA 4YUYA 1E9DA 4KBFA 1YR2A 2J3LA 4A8JB 3B9QA 3SSMA 3CG0A 3ZC3A 4ER6A 4EYEA 1ZLZA 1Z0DA 3OEHG 1TNDA 3KELA 1FS5A 1JWAB 2YDXA 1C0PA 1RYMA 1MIOB 1Y34E 2CMHA 4HDMA 4PBSA 1EVZA 1TJNA 5ER6A 4BNJA 4FR5A 1TM4E 1M74A 2JIMA 1CS4C 3NJ4A 1CEYA 3CX4A 4QD3A 1T3ZA 1QUFA 1T6NA 2FZLA 2G1UA 4BV2A 1CZLA 1G5TA 3P19A 3FPHA 4D6XA 1P4RA 3B78A 3N7TA 4OK6A 1PEYA 4R5MA 4J7JA 3RSZA 3ZCQA 5LYJA 2CUGA 1CUJA 3OQNA 1E62A 4YGYA 2O8EB 5CLIA 3FPSA 4XB2A 4ZEMA 1C1YA 1E79D 4LHSA 4A2QA 4U7DA 2ACKA 3AFOA 4WCDA 1E7QA 1ECBA 1Z56C 4UCXA 4DREA 1S8AA 4EI7A 1OXVA 1WNTA 3E9MA 3D1LA 4IH9A 4RZHA 3SK0A 3TNLA 3VM6A 2I7DA 4YRKA 4AP5A 2E37A 5EBLC 4O2AA 2IZ1A 1TT7A 2CXHA 3BWCA 3JYHA 3NH6A 1XMQO 1CDDA 1NNLA 1U9YA 1XZDA 4GLOA 1Z6ZA 3FVWA 4IQGA 3SBDA 3TDNA 3LQKA 3P7MA 1MUUA 4JR0A 4WLEA 2AQHA 1FJGO 2YV2A 3T94A 2GXSA 4KQWA 3GJTA 4BBJA 2AXNA 3A4VA 4M1ZA 2VF7A 2VUUA 4HF7A 3WTCA 4F12A 2PCJA 4F8YA 1WZUA 5CG1A 2VDLB 4Z4GA 2DSNA 2WIAA 3T4PA 3TMKA 4B4VA 3H9GA 2YCLA 4DSOA 4EMUA 1ZH4A 4FP9A 2NWQA 3USZA 5AKXA 4CKXA 3MINA 5IULC 4MMXB 3U7JA 1R16A 3H5OA 3ESDA 2LGWA 3B38A 3G88A 5T41A 2ID4A 3CUWA 3RYCA 3TTYA 3VA7A 2EFHB 3NMUF 3O47A 2QRMA 1EWYA 3FUUA 3RTBA 4HFRA 3UGKA 3HCNA 4RTLA 2ZUFA 1OV4A 4NK5A 1F6BA 3K9BA 4QUKA 5FNVB 1A8IA 1R3IC 1CUEA 3ETCA 2OEPA 4BKUA 4PX5A 5AUNB 4G0XA 1NW7A 4FLVA 3NORA 3DOCA 3F73A 3EYAA 2I4RA 5FBRB 4NZYA 3URMA 5A4MS 2FG7C 1M2WA 3TI9A 3EZNA 4ZVPA 1T3HA 2PZMA 1QS0A 2YQ5A 4DA0A 1AGYA 5FPTA 3H1JH 1SUCA 1SWWA 1GZDA 4Q4AB 1WXFA 3VX4A 3F5QA 2PZAA 3LPMA 1E18A 1O6BA 1DT5A 2CL7X 2GEUA 4KQKA 3BICA 2ZRFA 4BU1A 4EW6A 2PI4A 4IS3A 4KIGA 5H0IA 2FHPA 4TRJA 1UKZA 3W7BA 5TPWB 2A94A 3ZXSA 1M90W 4IGEA 2YZMA 1VARA 1SXQA 5C51B 2VDOB 4C4PA 2IXGA 5CB4B 3DBHA 4DUYB 2YXDA 5KHAA 3SEQA 3KQWA 2R47A 2HDNB 2O07A 3SYAA 2IH1C 2UUAO 4KDEA 3JPWA 2P6MA 4R8LA 4HNAB 2GUWA 4OQQA 5TMBA 1TUGA 4WZ6A 2QD5A 3QTYA 2AK3A 4NAVA 4BE7B 4V1CB 4MR7A 1Y9JA 1YVWA 3L77A 5DK6A 4AJIA 1PE0A 2UXCB 2NT4A 2PCLA 2OHXA 3HDGA 2B9EA 4XDZA 3C0KA 4FCTA 3T41A 1GSHA 1NVKA 3U4DA 4QOGA 3E86A 3IMKA 3RIXA 2F7SA 1NC3A 4NG4A 2IEBA 4TYMA 3EEIA 2AGVA 2F4VB 3WA7A 3ASOB 1TK3A 1ZGZA 5KUKA 1QOQB 4FHFA 1JDVA 2I55A 4ND4A 3WB1A 4NYJQ 5KSYA 1KI1A 1KZHA 3B09A 3PQEA 2YS7A 3A1EA 2P6RA 1P7PA 2XLBA 2WTNA 1EX6A 4ZJZA 4EGFA 1AKTA 5I7OA 2ZU6A 3IIMA 4MQFA 2WNHA 4C1BA 1O96A 2I78A 4CIYA 1K08A 3D4LA 3B6ZA 1BN6A 1PJSA 2CLMB 2HHLA 3FLAA 3EGCA 2QW1A 2CXTA 1E2NA 4OHOA 1KI7A 1PX2A 3KQVA 5ENDA 4WCEV 4ID3A 2ACWA 2QLJA 1HNZB 1CN7A 3D8TA 1J49A 2PK3A 1C9EA 3HDJA 3QKSA 4LF6B 3SPXA 1F48A 4P36A 3GRFA 5C1IA 4B9AA 2CH7A 3O1HB 4KFRA 3TLEA 2XZDA 4Z2AA 5KTRA 4X9QA 5FR2A 4B40A 3LYHA 1DJMA 3TTWA 3ZH9B 1FFEA 4N9WA 2VHYA 1YC5A 3EAQA 2A4MA 4M0DA 2C0PA 1M8FA 3PWSA 1JIKA 5BNWA 1CSEE 4BFYA 2ZNJA 4EGJA 4ZQEA 2FZ5A 1NVVR 1OY1A 4KXUA 3ZLTA 5A2QN 1W46A 3OD5A 2XMQA 4OUDB 1OLUB 3RBVA 5IFLA 2AJTA 3WZ2A 3D36C 1E3WB 3DQZA 3MEQA 5AM5A 4YRZA 3WLRA 4KXVA 3GGJA 2L2QA 2HT6A 1WUHS 5AK3A 3RFTA 3QJ5A 1BSMA 3WGLA 2ZBEA 3UO3A 3BS4A 3VJLA 4TQ9A 3CRVA 3N1UA 3WLTA 3USCS 4E0BA 1CCWA 2ZSDA 2CFSA 2UV8A 2JRLA 2OCLA 1YACA 1R15A 3F4KA 3OAAG 1T1JA 4LHZA 1RBQA 4HCJA 1T9GS 1Z7YA 1RQ2A 3EXFA 3LBYA 4HGNA 3VSAA 4OGGA 4XIYA 3C8UA 4EEXA 2YMLA 1QTIA 1IXMA 2ZREA 3S2FA 4IIGA 2FK7A 4EELA 1R0BA 4L3VA 3RYFB 3IKEA 5IE9A 1S72V 3VO2A 1MGPA 2NUTA 4HB3A 2DCMA 1MW8X 1QZZA 3EE6A 4GM4A 2HIMA 2C61A 3THRA 1QHNA 1H23A 1ECFA 3GZNB 3HPQA 4YO8A 3ELBA 3UMMA 5HTOA 3SZGA 4M7PA 5LL6P 2PF4E 1KGSA 3VSDA 3CSDA 2D2XA 4MI9A 721PA 1N57A 1V43A 3A1SA 1X1RA 4KG7A 4WGGA 1NWHA 4MHOA 4UBIA 1KSFX 2JIBA 3EC1A 5ANRB 2OA0A 3NS7A 2OZEA 3BWVA 3TM4A 3CR3C 3UC9A 3KOXA 4UCTA 4YDSA 1ECCA 1CUBA 1ODTC 5K0JA 3GLIE 5GOZA 4MQUA 3SYPA 1YDXA 1IURA 1X1DA 2B2XA 3GXOA 1U3DA 4NMXB 1EU1A 2G5CA 2NU7B 1FCJA 1NJGA 4D9FA 1P31A 2V74B 4LZAA 2O0HA 3W8NA 1PDOA 2Z5LA 4IFBA 1X86B 2C2GA 1P0QA 1RMQA 3I2KA 2Q8QA 3APOA 3OW2U 4NZOA 4PSCA 4ZV4A 3CCVV 1XZHA 2FV8A 1R3LC 1ISPA 2H2FA 5A5FA 4MUGA 4BP9A 2WWGA 4BX9A 4CLRB 1G21B 4P6VF 1NFRA 1MA3A 4OGLA 1LLQA 4TTPA 3HADA 4BAUA 5HZMA 3FMIA 3DS8A 2VYFA 1QHFA 1P0CA 1VBKA 2ZI4A 4BT4A 5K99A 3OT4A 1A0OA 5B5SA 4PA3A 1A88A 4NYJR 4NE2A 2J32A 2C88A 4MGEA 2J9ZB 4NECA 1E94E 2XZTA 3AIMA 4KUEA 4XWGA 1QGAA 4YUAA 5LQUA 3L4KA 2UZHA 2AR7A 2ZTLA 1H69A 5FRDA 4P2GA 3RKSA 5TMDA 3STLC 1GCIA 2NVOA 4MEJA 5CX4A 2QHXA 4JTCB 4BV8A 4W7HA 2F67A 2XUZA 2X8LA 3ZV6A 4BNVA 4TVSA 4X63A 4DIFA 3A2FA 2XKBA 2BFFA 2RIPA 2VOJA 3HDTA 2PAFA 1K4YA 1WPXA 3OFNA 4REQB 3L7JA 1P7ZA 3N2KA 4DA7A 3KLBA 1NDHA 5ICCA 2OXTA 2WLNA 3ASOC 4LZJA 3ZZ0A 1WBBA 1UQRA 3ESYA 4TYPA 5CHYA 3GJRA 3H6KA 4IQFA 5CN0A 2ECPA 5LA6A 2BO1A 4BAYA 1SZTA 5LHIA 2B4QA 5TQ2A 3P2MA 2VVTA 4DA6A 1HT2E 3OZIA 5H5NA 4YDQA 2XDAA 1IV2A 5K5EA 1TEHA 3K1JA 4BB6A 4Y9DA 1EAMA 3IMFA 4DT1B 2HMWA 1IY1A 3SIPA 1TA4A 1GZ5A 1Q3HA 2XUGA 5H4HA 9ATCA 3SC2A 3PQ8A 1CYEA 1USUA 1AE1A 4P34A 3LGSA 2AMFA 3KEOA 2BL4A 2MMCA 2R5NA 1SY7A 4LMAA 3RM3A 2IWHA 2GD0A 4OKIA 3VBCA 3H5IA 2OC4A 4DGQA 1Q86H 3AFGA 1ZIOA 1BS9A 1KDTA 2A0UA 2ECFA 4LZZA 2FQWA 4RKFA 4CL2A 4PHFA 4C30A 5DEOA 4P7GA 3ABQB 2JFNA 3UBMA 3TWOA 2I7TA 3PD0A 3SR0A 1SOWA 2OT5A 1QIFA 4KWTA 5JMOA 3OT1A 3QKUA 2GZDA 1AR1B 2F23A 1A3CA 3DLIA 3BWBA 2L17A 3M81A 1C3EA 4IXTA 4N3BA 3HB0A 2GV9A 5CA1F 3INRA 5KNBH 2YHIB 4GPIB 4RA6A 1FNNA 3PA6A 4HATA 2B9ZA 1X70A 1R0WA 4TM8A 1OC2A 5AKGA 4IIYA 1ZISA 3ZI0A 8ABPA 3HACA 3GFFA 4L0QA 4O4IF 3REFA 3KRTA 1DF4A 1ZNZA 2CSUA 3GFQA 4K8OA 3HFGA 4LTNA 3CUVA 1CNEA 3EVCA 5SV2A 2X6TA 2AE2A 5CT9A 3T1NA 4E70A 5CB0A 3Q4HB 5BO5A 1TM3E 4XCXA 5GWXA 2V3VA 1QF7A 4DQLA 2BOVA 3M82A 1GMGA 2GUZB 3NKLA 2ZSKA 5CYGA 3NUGA 2HPHA 2QTWB 5HFJA 1E64A 2BYTA 4MQFB 2SKDA 4HQRA 3E5HA 1JW9B 1N36B 4R1OA 1JS1X 2J3IA 1Z06A 2RHBA 3PFIA 4P3OA 3S29A 4BO6A 2CTWA 3QVUA 2YXYA 3WFIA 4A36A 1EM8B 4TGLA 3AK3A 2CHGA 1DRVA 1N25A 2QLLA 1GGMA 2XNCA 3CPHA 1KO4A 3DGEC 3M9WA 3NIFB 3R6TA 4MA5A 4B47A 4X00A 3G67A 1ETUA 4YX9A 5JDCA 4R1TA 1YB7A 2BH2A 4AB1A 2YHIA 1ZMOA 2BIFA 5JAIA 3MF4A 4HQOA 4UC0A 4YJ2F 4MP8A 2G4LA 3RAPR 3T9DA 5JQGF 5C5EA 4I0WB 3SZRA 1ZA1A 2PD6A 2X8AA 3IUEA 4FD2A 4H17A 3DBRA 2XCSB 1X87A 4PZ9A 4R2LA 3KDSE 1WBDA 4UBMA 1MKYA 5BMVB 3GGCA 2XX3A 3KVYA 3BTOA 4G89A 1IPAA 3IS3A 4DXAA 5COAA 4QLBA 3ZD6A 3G7NA 3UM9A 4DZRA 1OU0A 5DJ5A 2PTGA 3RUPA 3WLAA 3ZXUB 4BVBA 1ZSPA 1YR3A 2X3UA 4GGOA 2Y4TA 3DXZA 3SC4A 2CF5A 4LZWA 4CMCA 4G8BA 4AKGA 5FO1A 4LSMA 3LPAA 3AXSA 4MKXA 1GDDA 2FPOA 3GDFA 1XQ8A 3NZEA 4O4JA 5JRZA 2OHFA 3KKOA 4OXYA 5FBWB 1H0HA 3R0VA 1YZBA 3NEAA 5GAJA 3LUJA 1G8FA 2WJZB 2ZVYA 1MO2A 1KYVA 1VXOA 1YKFA 4BNIA 5I9LA 3KEQA 4BKRA 1N9GA 2JH9A 1D0SA 4Q4JA 2AQIA 3NHMA 4BC1A 4Q1AA 2VOEA 4B7CA 1WU8A 3PXCX 4PLCA 3P20A 3LY9A 5DWVA 2CYAA 1USKA 4FTWA 2B35A 4LRWA 5BSGA 5CDFE 3CPEA 1PJ8A 1T0IA 2UZ3A 3L7BA 4MV8A 4A8JC 2F1KA 2E0IA 4AVYA 1HY3A 2ZI7A 4MQ4A 3G9QA 3IODA 5IAGA 3M5PA 1VH8A 1W29A 4ZHQF 1NP7A 1JXOA 2EWMA 3O8RA 2PBLA 5B2EA 3P3PA 4RTKA 4B17A 3BD9A 1JKJB 1T5SA 3COZA 5KC8A 4IIJF 3KNZA 3I2HA 1YHNA 1ZGBA 1IJEA 2A58A 4GPAA 3TCUA 4N5DA 4ZARA 1YRQA 2I33A 4D3DA 4RWEA 2IX3A 5HP7A 4CLXA 2VSNA 4RESA 1QONA 2PY6A 2FZ4A 2PKWA 3RA6A 3QKWA 3K03A 3FDFA 2NQ8A 1R6VA 3HCBA 3O82A 4P4SB 2WHQA 1Q82W 5I7AA 1QPBA 4HRYA 4LTMA 3RODA 2FEMA 2A1IA 4GFDA 3VSBA 4BP3A 2FMIA 3CF2A 4BJ6A 1UUFA 1QVFU 1XELA 2EBOA 2VQFB 3CE2A 1T5TA 4K05A 1VQNF 2GZMA 1JYSA 3DHVA 1P44A 1WXWA 3QJYA 1E9BA 4ND7A 2AZ4A 2FEWB 3H11A 4ND8B 4YJFA 3DE6X 1DLBA 4D7TA 5DNCA 4Y2YA 2HQSC 4DJ5X 1V16B 2G8LA 2WMDA 3AI3A 1Y5NA 3H1EA 4JUBA 5FTKA 1VI6A 1QPZA 3IUMA 3KSZO 4LOJA 2FETA 4BPBA 2EC5A 2ZTMA 2IW3A 5CNIA 5CAEB 3T3EA 3BH6A 2JKYA 3ONEA 3PQ4A 3PS9A 2VUSA 4IZHA 2G76A 2KM1A 2LKDA 4NHOA 1QIDA 4YJGB 5IEBA 3KHTA 5KKCA 3BJZA 4WBNB 5TT1A 2BSQA 1H9BA 4B4OA 1UOPA 4BO4A 3O8BA 3RFUA 3HR0A 1SCJA 1YQUA 3EJWA 2HRZA 4LRYA 4EDFA 2BKAA 3UK7A 3NOQA 5TJHA 3RVKA 5HUHA 1NM5A 2O1EA 4AZSA 2C2WA 2RJZA 5E1OA 4C3VA 2GNOA 2VTKA 3I8SA 3INGA 3P97A 2BUCA 4HTFB 3ZHOA 4CIWA 4B7KA 3LL4A 1VI2A 5HY4A 4EHFA 3R09A 1DV1A 3D54A 4BT5A 1P7VA 2DFDA 2H5LA 3K35A 4MS1A 3UW3A 5ALYA 4DT1A 1EZ1A 2ODTX 1Z73A 4Q1EA 4PG8A 3H84A 3UIEA 4TV9B 3V4FA 3HB1A 4M1MA 2ID8A 4R98A 5D8DA 3K94A 3H17A 4M0UA 1K8AH 1NLUA 3F47A 4WL0A 3S3XA 4TRNA 4EL0A 5KNLA 2XXJA 1SOAA 3H9BA 1CUXA 2L18A 3OLCX 2ZUWA 4PEVA 2W6IG 3BE6A 3CRNA 4BL5A 5IVDA 2QTRA 3QYJA 3GMIA 1U3CA 4BGDA 2AMVA 2OV6A 2BFFB 2GUZA 3D59A 1YI0A 2ZR9A 2QMYA 4INZA 4XM0A 4BO1A 2V3CC 3FI9A 4B08A 4A0RA 4DK0A 1XEQA 3G6EV 2ETVA 4O0MA 2ZBUA 3K9LA 4CIDA 4IFIA 3EXAA 1CNFA 1Z2CA 3A0UA 3VJRA 5CA0F 4B62A 4K9NA 2WWFA 4L51A 3KD3A 3KJXA 5EZYB 5G4VC 2QTAA 4YNBA 2JGEA 5INTA 2FWJA 1JG2A 3JD2A 1RFYA 5GTHZ 3LXXA 3T61A 4JC0A 2A1UA 2J0EA 1FMCA 2QN7A 2VJOA 3L7OA 1ZOSA 2EIKB 2SCUB 2AX4A 4OGQB 3FB5C 1YS6A 1KFKB 2HADA 4LC0A 4ALNA 1GO3F 1Y9ZA 1KDOA 1ANKA 1W4BA 3L7NA 4I9NA 3T3DA 7AT1A 5J23A 2YASA 4TLAA 3P9YA 1OBOA 3HU5A 1C3OA 3FTQA 4H7PA 4PBRA 2HA6A 4NNJA 2FFQA 3BDIA 1DARA 2QWPB 1LI7A 2D2EA 2IKQA 2ZI3A 5L53A 3RS3A 2QXUA 2VO1A 3DDUA 2IW5A 4DMLA 2PPVA 3UK1A 3WJRA 3OR6C 2XMZA 3M4SA 3BFPA 3CF0A 3E9RA 5JLAA 3SSNA 2OWEA 3KUXA 3SYOA 1T36B 1ZM4A 1H9CA 2VSFA 2HK9A 2CDAA 2DECA 3GFPA 5MF6A 5J9FA 2H29A 3DL0A 4FT4A 1SELA 4QLOA 4V0OA 3CR7A 4CG0A 1SUPA 4E3ZA 3FW1A 2CFTA 3RG2A 1EXNA 3BILA 2XAUA 4DCJA 1OJLA 2JIRA 1IIRA 1UBOS 2ZRMA 2VYQA 3OJLA 5I6DA 4UEJA 1ZRMA 3P9SA 2B5VA 2FLKA 4XX1A 3VVBA 2F64A 5JATA 2P78A 3AB7A 1G8KA 3AEIA 4PNPA 2HP0A 1MR3F 1F14A 1KSJA 3JYOA 5G41A 4HWOA 4LDQA 5LA6F 4KUMA 1GPKA 2EP8A 2G28A 2JLAA 2VT6A 5G4KB 3WK4A 4PHHA 1CD5A 2VRZA 1GLNA 4YJ3A 5DECA 4GLXA 3FBAA 4ER0A 3ROXA 3EK2A 4FXPA 2BF4A 3MVEA 4HAUA 1E59A 4QIHA 1BE1A 1UPXA 3IPXA 4I5IA 5DP1A 2R00A 3AR7A 4PO8A 1DBFA 2Y6UA 4TTAA 3TXXA 4GOMD 4G41A 1P5JA 1DQNA 2VK2A 3KC2A 2HOQA 5E7JA 2JIZD 1U31A 2QL6A 3AFMA 4QQNA 2ZB7A 3ONVA 4HAOA 4GKJB 5F7JA 1DQYA 4D42A 4RK7A 3J7AC 1LUVA 1M0TA 6CHYA 1WVIA 2IW1A 4MIYA 3QBTA 4QOFA 1JXQA 2VDUE 1KAEA 3A25A 5E4FA 2ZUUA 3ZIUA 1RPZA 1XRGA 2D1YA 1IG3A 1YFJA 3QKRB 1PFWA 3SPHA 1GYQA 3G8DA 3HWX1 5JCOC 2ZKLA 3VQVA 3N07A 4Q3BA 5FV7A 1JHQA 3AM4A 1G8GA 2YBEA 1TVMA 1WG8A 2QRVA 2VP3A 3GRZA 4B6GA 3DPSA 1N0UA 5T6MA 1TFRA 2FUG1 2GM3A 3QOYA 5AVMA 2QRPA 5KHJA 2X76A 3HC7A 3TGUH 4DV1B 4QHYA 1RWMA 2ZP1A 3VU8A 4JLMA 1V26A 1KP2A 1U40A 1PJCA 4QUJA 1QQTA 4B5KA 3J81N 2PDAA 4WUTA 3KKYA 2GFHA 3N8KA 3KQKA 1GUAA 1UFKA 1PJTA 1T1RA 5J43A 3QUWA 3NEJA 4HAMA 3A3YA 1XLUA 4UVGA 1SCKA 5B5EZ 1XZNA 2I2BA 1DS6A 2QMOA 3DL2A 4PU0A 4E09A 4B5CA 2JIQA 2CV0A 3IBSA 1FJ2A 3AF1A 1W19A 3IBCA 3U7QB 3PRYA 2G5PA 2UVDA 4HLCA 4B8YA 5JOQA 5EB0A 1AA9A 2QUKA 1Z8NA 3S1SA 4E7PA 4OMDA 2P77A 3TSAA 5EWJA 1O95C 2VUIB 3EG9B 3ENKA 3IKMB 3TIVA 4BQRA 1EK6A 1SKQA 1LJLA 4KTTE 4JASB 2QWQB 3JAWB 4CBCA 3ZYZA 3OO1A 4GICA 4V1CI 4HJRA 4LY6A 4NS4A 2WWTA 3DBOB 4GLLA 4PFKA 4TXJA 4B80A 4TMKA 3L0DA 1B04A 1ZGGA 2AFIB 2FEOA 4IW3B 2XB8A 4MWTA 5DCYA 4M0PA 4BNGA 1ZXLA 2GJKA 4IEFB 4AMGA 3IIEA 1IY9A 5K3DA 5LZ9A 1EIWA 1WABA 3TLCA 1KMIZ 4IJ6A 3S70A 5LP1A 5FJJA 3ZCSA 4WBNA 1JNXX 4L5AA 4JB8A 4B6QA 2H31A 1CE8A 5KMGA 4X84A 3ET5A 3OX3A 5H5JA 1SB9A 4PQGA 3ZUGA 1L3IA 3SHQA 3T7DA 2UXBO 3NVIB 2LRHA 4A2WA 2ZKOA 1G19A 4AY2A 4MWZA 4QA9A 2GEBA 1L5YA 2R6ZA 3AQIA 3SEFA 4BMZA 2BCEA 5DWQA 1O54A 3COJA 3TIFA 5KREA 3V3TA 3IJRA 4JVSB 1HDGO 4BX8A 1L5OA 1R5JA 2Q3LA 1OXUA 2ECOA 4RV9A 1ABFA 3RVPA 2AQ8A 1I7LA 1IH8A 1WXXA 1ADJA 2ZJ8A 4J0EA 2PVPA 5CYPA 3W8FA 1IVYA 1HDOA 5A9RA 4RM3A 1E3QA 2PLNA 3N27A 3EVFA 4RQEA 3NJRA 4CFZA 2LVBA 2HLDG 1O0CA 3A36A 1IXRC 3CJHA 1AQYA 1C3JA 4WX2B 1VHAA 3HBFA 2FZCA 2WQ6A 4LYAA 3JR7A 3R74A 1C81A 4WY2A 4Q7JB 4X8LA 1M93A 4LK2A 5B7PA 1KC8W 4AS3A 3DOJA 2VYVA 2YIVX 3GLGA 2HRUA 3RRBA 1VKHA 1KBQA 2NTNA 2DAPA 4DYLA 3C5WP 2Q5CA 4BN4A 2FHSA 1Y7TA 2D5LA 3RG8A 3UOAB 4M9SA 4FZ1A 3P9NA 3ILHA 2I6FA 2UYGA 1W75A 1DTWB 2QAJA 3CCUV 2OTJF 1EM8A 1UC9A 1WF3A 3Q3CA 1O6CA 4S3MA 4X6XA 5H02A 5JJJB 3O1IC 4ARBA 3R40A 5K4HA 2L42A 2NSDA 1V96A 3N7UA 3IDZA 3FRHA 5T5QA 4EVIA 1H5QA 1WMDA 4GYWA 2J9XB 1P9NA 2GTHA 4MPRA 2A9PA 3F9CA 1E0DA 1N5LA 4HRVA 4AF6A 3UB3A 3PPWA 1NYTA 1T6XA 1PJAA 2DULA 2IV2X 1M6VB 1P8AA 1S77D 4GOND 3LDUA 3WMRA 4CQMD 2HK6A 3STYA 5DCVA 1BH6A 1MTZA 1R50A 2QVGA 4MVJP 4PFQA 1OH8A 2I66A 3NT5A 5DM2A 2D62A 5E95A 2JS5A 3GQVA 1VP3A 4MVUA 2HA4A 3IAS1 3QEKA 4LDRA 4U7FA 2QENA 5JXGA 1Q50A 1CF4A 3GX1A 2Q1WA 4XWAA 4D3YA 2J0SA 2V7QA 4ZZ1A 4AI6A 2ZDQA 3RADC 4C0HA 5LQRA 1W5AA 4YV7A 3CMEV 4X94A 3C45A 3GGOA 4TL8A 2WG1A 5A7HA 3Q3EA 4HUTA 2IE8A 4HUQB 1H2AS 3KT6A 1EJ6A 2C3PA 3EFOB 1PYOA 3VX3A 1C7ZA 4A92A 4KXQA 4OX9B 1E2EA 4MRNA 1T0KB 4P35A 5E4YA 2ISQA 1FXVA 2FOLA 5CEJA 2ZZNA 4YK7A 3FHTA 2IYWA 1R74A 4FOLA 1GM8A 1Z7WA 3HP1A 4FDAA 4XXHA 5DI9A 4DJFC 2JANA 4G4IA 3DXRA 5FP0A 1EHIA 4FDLA 2AFHB 2FMLA 4L5IA 5FWAA 3OF2A 3NYRA 3QX7A 2ZR8A 3NBMA 2ZJYA 5SYMA 4PDLA 4BEBA 4P7JA 4G24A 5HBGA 4C0JA 3CW2A 2ZJ1A 4F91B 2RJ3A 2XH8A 2V55B 4DQDA 4DG8A 1DAKA 2B8NA 3D8RA 2QTGA 5CX1B 4DDWA 3ND6A 4N01A 1ZINA 5J3JA 3GK3A 1BYUA 3IGFA 1DXYA 1LBHA 2YJ6A 3H19A 4QJFB 4B3SB 4PZYA 4JITA 1V47A 4MV5A 3MQ2A 3ZLUA 2H9YA 5IBCA 2PZLA 2R62A 3KT3A 3U39A 1H47A 1OQAA 5DHUA 2RD2A 4E4EA 4S05A 4IO1A 5C93A 4F2DA 2ZM6B 1AZLA 1O0BA 1FNCA 4GMKA 5DYTA 1Q82H 4QHTA 4CKBA 3I53A 3QEJA 4EB0A 1KO5A 2VPXA 3OMLA 5SY6A 3EQ6A 4Q03A 2OBMA 5DE3A 5DCLA 4ZOLA 4BQPA 4RX1A 5LOVA 1MZVA 2QPTA 3B2QA 2HC9A 2QZZA 1LR1A 2WWIA 4GVLA 4J1TC 4L72A 1U1EA 4QNNA 5JWPA 1W1UA 4WINA 2QPAA 3OX2A 2D3TA 5E1MA 2OPHA 1KI4A 2IH5A 5ITZB 1K6IA 4I9FA 5FFFA 1VQ4F 2G9UA 1CRWG 4QPPA 3OKPA 5ENZA 3SEAA 1NU1H 4JB0A 4IICA 2F1MA 3OU2A 2CMKA 5C31A 3OVMA 3IEQA 1C1DB 3QPDA 1XG5A 1EZVH 4WE3A 4EPRA 1ZU4A 5BSTA 3MRTA 2ISSD 3AY3A 4CC6A 2B21A 2IZ6A 3HZZA 5CGZA 4RJTA 1NXOA 2VPWA 5CH5A 2XJ9A 1DC8A 3VOBA 5CBKA 5IAOA 1H4VB 4ESOA 2V1XA 5EUCA 3ZHRA 5NULA 1HNXO 1Q83A 2YR0A 5FI0B 3LSUA 2R7MA 2Y71A 4WFBV 4ZCTA 5EHIA 1GZ3A 1EXMA 4JI1B 2W0SA 4KMMA 2FMHA 1VK3A 2QVCA 5KHHA 2OOSA 3IQHX 3K0BA 1ZK4A 1V37A 4KXNA 5ALIA 2R9RB 3T1TA 3WLNA 3EISA 2DFNA 3ZIDA 1Y7LA 3FTPA 3BABA 1SIBE 4TS1A 5G4LA 3V1KA 2XCTB 1YVEI 2V7QG 2YVLA 4O4LB 1ZMBA 4RABA 2QTMA 4DPMA 5H6RA 4JQZA 2F3QA 4Z8YA 4ARUA 3SQDA 3UJPA 2GN8A 2IYQA 2QK4A 2XQVA 2P2CA 5KWIA 5TMEA 1D1QA 5ALVA 1D3AA 4CS3A 2NXEA 2OP0A 2WFLB 1XCJA 2WZBA 3F46A 3LFUA 1LY1A 2ZXFA 3NONA 3NC4A 5GJWC 4IIBA 3ZJUA 4JZYA 2LDXA 2A5YB 1EGAA 2FL4A 2QZPA 1VMGA 1UZNA 3OECA 16PKA 3PPVA 1KVUA 3OW2F 2Z8XA 4NATA 4PV7A 2Q7GA 4LJSA 2IC5A 1TQ2A 4Q66C 1HO3A 3DZHA 3EAGA 2ENWA 3JQFA 4UM9D 4W63A 3SYNA 4BB0A 4QUIA 3IILA 2ZF8A 1O8CA 1F3LA 1F51A 1FXWF 1X1BA 2QVLA 2VF4X 2A3QA 3BXXA 5EMMA 1OH7A 1NPTO 1QFSA 2ZB2A 1YDMA 1GZHB 1RT9A 4Y6OA 5U4QA 3RRFA 5CU7A 5L4SA 2O8DA 2XSZD 3QFRA 4CLRA 1L1QA 1V6SA 4BRUA 3ZE1B 2QL5A 1LS1A 2XCOA 3VR2A 4EATA 3ABZA 1HL7A 2OCXA 4TTJA 1II8A 1IB6A 1D0VA 5THQA 3DVSX 5FI3A 3WJ2A 4FNAA 3VOUA 1HDJA 5B1BC 4AXXA 5ICSA 4JI5B 1RTKA 1CULC 3I64A 3GFOA 3OOHA 2Z6UA 1NUSA 4ZYYA 3OJWA 1V9CA 2WUEA 2G77B 3QWHA 2PMKA 3D3WA 5ERXA 1UAAA 2HMYB 2H1RA 3BREA 2A9OA 3JQ9C 3DZFA 4ZP1A 1S76D 5IT9M 1EH5A 5FWYB 4AN0A 1GGKA 3DHYA 3VNUA 1BMFG 1E2IA 1Q22A 4KSCA 5K1XA 3OR7C 1WU7A 5IK2D 4QT4A 2O9JA 1QC5A 3UWOA 1IBKB 1C9KA 9LDBA 3AINA 3QPAA 4I2NA 1PLJA 5AVOA 4ZQFA 4IGIA 3SPIA 3AEKA 3PE4A 2FUNB 3L75H 5TDHA 1SG9A 2JATA 3DOFA 3T12A 1ETHA 5FH9A 1E1QG 1AVTA 2RHJA 1QIKA 2WB4A 2AZTA 3DO6A 2O3RA 3GQBA 2O7QA 2IIVA 1RQNA 1W5FA 3H5LA 1ZHFA 4YIOA 1L5ZA 3KK0A 1M6VA 4HEHA 4F5ZA 1K73W 1BW9A 2AJLI 4CR6A 8ATCA 1UPGA 2HUNA 2O3JA 4KNVA 1E6MA 1EEHA 4ITRC 1Y81A 3IP3A 3FNIA 3DKVA 2G07A 1W9MA 4EQ6A 2FPKA 2J4CA 5TQJA 2QVYX 1JIVA 1QBKC 4C4AA 1HSOA 4LWZA 1K92A 1XXHA 1SUFA 4IKOA 3NKVA 1SD5A 4OGKA 4LHVA 3C43A 5K3CA 5CDGA 4I9UA 2JS3A 1TUEB 4F7DA 2QGFA 3MOGA 1IVNA 2QF7A 1MAVA 3AK1A 1QCYA 2WW8A 2YYZA 1W5EA 2QV0A 4M36A 1A9OA 2ZAOA 3CNBA 3WQSB 5JI3E 4DQUA 3FCYA 4IDDA 1X19A 3LPNA 2A0KA 3C6KA 2C78A 1OROA 3RE1A 3ZY5A 1PFGA 1NLZA 1YFLA 1BWQA 1GTRA 4LFCB 3HNRA 4K28A 2VJNA 1DBWA 2OCPA 4D9EA 4ZHWA 4CM1A 4BB5A 3ANTA 4CQMB 1S2GA 2BFMA 4J1NA 3U6BA 2QX4A 2Z98A 1VBFA 4IDNA 4LV5B 2JW5A 5FAKA 1KJ8A 3A9UA 4EYQA 3E9NA 5GADl 2A8YA 4QGFA 4QDJA 1VSTA 2CHQA 3IP1A 4EITA 2J3EA 3D01A 2JVIA 3Q5EA 1DQPA 4OY3A 4V0RA 3SBEA 1WCV1 1NW3A 2XRFA 5B7GA 4ENVA 4IRXA 3FKQA 5CDSA 3ZBUA 1E3WA 4QXQA 4LQDA 2GVIA 2CC2A 2N75A 3WGQA 3FR8A 1H2SB 3H83A 4PYQA 1Y8ZA 1L4YA 2CSXA 3K79A 2D5BA 4FM1A 1U5CA 4XTCS 3PNVA 4LJRA 1AM4D 1FXSA 1LVHA 5M34A 3KTAA 2B5UA 2B9VA 2X15A 5LMNB 1ZK2A 1TEZA 4X64O 4TSFG 4IGFA 3FYTA 3V6LA 5DX1A 3LSTA 1FYEA 2OVBA 4DV7B 4EG5A 1GTG1 1Y0BA 1T4MA 1KO8A 2ZVPX 4WK0B 4LOIA 2P6YA 3Q1LA 5E4JA 3HVRA 3H9JA 1W4AA 4QUDA 1GAJA 4M7RA 1VQ6V 1H0SA 2WJIA 2L19A 2XHEA 3EGWA 1Q1ZA 2ID9A 4YO7A 1U8CB 1N7HA 5BN5B 5B4TA 1JZTA 5JVDA 2BV3A 2Q6OA 1CDEA 2VQDA 1A4UA 1TCAA 2CVLA 3FB1A 4TZ6A 3E0XA 3X3HA 4TWIA 3AJEA 1VQPV 4KLAA 3QHQA 4NJMB 2B82A 4FHGA 3ZWAA 1RXCA 5IJ0A 4TWRA 3NNDA 3GEHA 4Q3OA 4PPQA 5FR1A 3MCAA 2C2MA 1LLDA 3DZBA 3A4LA 3AIIA 4AJ9A 1EA7A 2IUSA 2EKBA 4LBWA 1NUAA 3MXTA 3T3HA 4ZHSA 3KJHA 4XYGA 4JMLA 1DFIA 4U3JA 3RSFA 4B3JA 4Q9LA 2P06A 2R65A 4FGWA 4PYMA 5DBEX 1C3VA 3PLRA 1IUKA 4ZYLA 1LSJA 2VNSA 4FFOA 1J0AA 2GK3A 3U3XA 6REQB 3D3KA 4GSLA 3EVBA 4C0AC 3JWPA 1MMFB 1SKVA 3M84A 3CCMV 3JVDA 3PGLA 4UBLA 2DZDA 4ZI5A 3WGHA 5FI5A 2YV5A 1VL2A 5LA6B 2KTUA 1ZIXA 3G1WA 4LPKA 5JD5A 3DOEA 2DBVO 4L73A 4BEVA 4IL6Z 1U7ZA 2R1VB 1E1MA 4TXHA 4UDYX 1TKBA 5JU6A 3KALA 2ZR7A 2APJA 3MCZA 4JH0A 3NYIA 3WU2Z 4JI4B 3BQNB