3NVKE

Structural basis for substrate placement by an archaeal box c/d ribonucleoprotein particle
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 22
structure length 121
sequence length 121
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nvkE00
1KD1H 1S72F 1VQ7F 1RLGA 2I6DA 3CCUF 2KTVA 1VQLF 3LFOA 3ON1A 3VI6A 1CN7A 2QA4F 1VQNF 3HJWC 1YI2F 1VQ4F 1X7OA 1Q86H 1NJIH 3AGKA 4X3MA 5EWRA 3CCJF 1QVFF 2WALA 3CCQF 1M90H 3NK6A 2LBWA 3CD6F 1YJWF 3I56F 3CCMF 2FC3A 2ALEA 4C4WC 1K9MH 3IR9A 3CCLF 2AIFA 1KQSF 1IPAA 5GIOC 3CCVF 1SDSA 3N4ZA 3LWPC 1GO0A 3V7EA 5IT9M 5GINC 1T0KB 1YHQF 3J7AR 3GYQA 3NMUC 1W42A 1K8AH 1CK2A 1Q7YH 2OHWA 1VQ8F 2CZWA 3PLAC 3G4SF 5GANK 1YIJF 3NVKE 1W2BF 3CPWF 3CC2F 3RA5A 3CPQA 2JNBA 5EO3A 3SIVA 1ZWZA 1W40A 3LWVC 1YITF 1H7MA 1N8RH 4NUTA 2BO1A 3PAFA 5GIPC 3CG6A 3J81M 3LWOC 3G6EF 1W41A 1YJ9F 3CXCF 3G71F 3JAMM 3HAXD 1Q82H 3CC4F 2OTJF 3JCMM 1Q81H 1W3EX 3VMFB 5DCVA 2OTLF 1VQMF 3CCRF 3OBYA 1XBIA 1E7KA 2VGMA 3RA6A 3WXMB 3SIUA 3CMEF 1PXWA 1X52A 4BW0B 3I55F 1DT9A 3NK7A 3OBWA 1VQ9F 1K73H 4BY9D 1NMUB 1X7PA 1RA4A 1JJ2F 5G4VC 5G4UC 3CCEF 2LBXA 1VQ6F 5FLXM 1GO1A 3LWQC 5A2QM 3OW2F 5FJ4C 2VGNA 1VQKF 2HVYD 5GAPK 2OZBA 1VQPF 2QI2A 3MCAB 3N4YA 2KG4A 3O85A 4TZZA 2QEXF 4X3LA 1M1KH 3CCSF 3NVIB 3FFMA 3E20B 3LWRC 1VQOF 1KC8H 3CC7F 1GZ0A 3V7QA 2KTUA 3J80M 1VQ5F 4LCKA 1YJNF 1QVGF 3E1YA 3CMAF
chains in the Genus database with same CATH superfamily
4ZHWA 4G88A 2EWCA 3RYIA 3HWUA 4ZHVA 1RLGA 3CCUF 5EYPA 2HX0A 2Q1XA 4YJ2A 4X1IA 4FFBA 3T80A 2QA4F 1VQNF 1ODEA 3HJWC 3JASA 3MCQA 5AVMA 3OONA 2VAMA 2UYNA 5EYPB 1Q86H 2CVLA 3E22A 4X3MA 3R0PA 1VQVA 4X1IB 3JAWB 4FFBB 4EI8A 5J2UA 3HKBA 3JASB 2UYNB 2CW4A 2BTQB 2R751 5LP6A 1JFFA 3FD6A 2ALEA 4EI9A 1W55A 5J2UB 1K9MH 2AIFA 2K1SA 3S0WA 5LP6B 2UYPA 3I7TA 1UI9A 3IKEA 3RYCA 5MN6A 5GIOC 3L7QA 1JFFB 3D00A 3CCVF 3N4ZA 3WGLA 2YYEA 1T0KB 4BT7A 1YHQF 3J7AR 3DDNA 3GYQA 1W57A 4ZOLA 1ONIA 3RYCB 1FSZA 3KHNA 3NVKE 4DRXA 1OAPA 4ZOLB 1W5AA 5CA1B 1H47A 2LCAA 2CHSA 5EO3A 4BVTA 3LWVC 2VAPA 4DRXB 3PAFA 4XCQA 4F6RA 3LWOC 4G4VA 3G6EF 5HP8A 3C8LA 3C9UA 3TD3A 3MBMA 3CXCF 5IJ9A 3WPXA 4F6RB 1FFXA 3VMFB 3VOAA 3S0YA 5HXUA 5IJ9B 3F0DA 3C9TA 4B62A 1FFXB 1XBIA 2VGMA 3SIUA 3CMEF 4EB6A 1PXWA 3KJKA 3I55F 3M1XA 2W8BC 2LBTA 1U40A 1X7PA 1RA4A 1JJ2F 3FPIA 5G4VC 4EB6B 1QU9A 4ZHYB 1W581 2HS0A 2RB9A 2GLZA 4C82A 3U0OA 5A2QM 3VCZA 2H6LA 3MDOA 2HVYD 2PMPA 5HP7A 3O85A 3N4YA 2KG4A 4O4HA 3F0GA 1VQOF 2CHTA 1KC8H 1GZ0A 3FD5A 5HY1A 1VQ5F 3IEQA 4YJ3A 4O4HB 5LXTB 2RHOA 3CMAF 1Q82H 4BVSA 1S72F 5J2TA 4YJ3B 2KTVA 4C8IA 3VYSC 4C8GA 3VO8A 3MQWA 5BMVB 3ON1A 4I55A 1CN7A 2KGWA 5J2TB 1YI2F 1NJIH 4I55B 4G4XA 5EWRA 3CCJF 1QVFF 2MQEA 4TV9A 5JH7A 1YJWF 1KNJA 2CSLA 2FC3A 3BYQA 4C4WC 3N2GA 3S02A 4TV9B 5HY0A 3KIZA 1IPAA 1W5BA 5JH7B 3S0HA 4HNAA 3N2GB 3RYFA 4B46A 1W42A 3JAWA 3V3TA 1CK2A 4HNAB 2V9YA 2CZWA 3RYFB 1GX1A 4I4TB 5GANK 1YIJF 1W2BF 2Z1FA 4DXDA 2HS3A 3ESJA 1IV4A 5KX5A 1XV2A 2JNBA 2RHJA 2HS4A 2PHNA 1H7MA 5KX5B 4U3JA 3TD5A 3CG6A 2HQSC 1W41A 3EORA 4E6EA 3QTYA 3JAMM 3HAXD 4U3JB 1JN1A 4ERHA 2OTLF 1VQMF 2ZVZA 5CA1A 3JVHA 3S03A 4KWEA 4IHJA 5IYZB 1SZQA 1U3PA 3RE3A 5ITZB 2ZAUA 5EZYA 2OTMA 3N2KB 3P10A 4G4YA 4BT2A 4EI7A 1K73H 1VQ9F 1NMUB 4IHJB 2R6R1 4O4LA 3CYQA 5CA0A 5G4UC 3CCEF 1VK3A 2LBXA 1VQ6F 2ZOVA 5EZYB 1U43A 3LWQC 3B6NA 2Z01A 3ZO8A 2GVIA 2H8EA 4O2BA 4O4LB 5CA0B 5GONA 1Q8RA 3F6MA 1OFUA 1W5EA 3ZP4A 2B33A 4O2BB 3RYHA 5GAPK 2OZBA 3MCAB 4O4JA 4BT5A 4G4ZA 5GONB 3CCSF 2BTOA 3E20B 3IKFA 3CC7F 2Z1TA 3RYHB 1T0AA 2L26A 2UZHA 4O4JB 5C8YA 4LNUA 2HRUA 1QAHA 3E1YA 4IIJA 5C8YB 5FNVA 1KD1H 1VQ7F 2I6DA 4LNUB 1YQNA 1W5FA 2P6YA 1PF5A 3ZP7A 3LFOA 5KMGA 4IIJB 5FNVB 3C9RA 2RHLA 3C9SA 3D54A 1VQ4F 1Z5VA 1RLUA 5JCOC 1TVKA 3AGKA 5KMGB 2N48A 5LXTA 3GTZA 2WALA 1H48A 2GZLA 3NK6A 3WGJA 3CCQF 2IQQA 3F0EA 3Q8HA 1TVKB 2I6RA 4B5CA 1XHOA 2NMUA 3I56F 3CCMF 1NQ3A 2FGYA 4U39A 3IR9A 5BMVA 1KQSF 4WBNA 3VTIC 3IEWA 3JALA 3VIUA 3LDTA 3LWPC 3V7EA 2IAFA 5HY2A 5GINC 3K0TA 4WBNB 3NMUC 3JALB 1Q7YH 2OHWA 3I3FA 1VQ8F 3PLAC 3G4SF 2ZVYA 3VYUC 3CPWF 5HXZA 3CC2F 3RA5A 3CPQA 1VHAA 1QD9A 2HP3A 3VOBA 4X1YA 5MN5A 1N8RH 4NUTA 3QHDA 4C81A 2QTPA 2RHHA 1IV2A 1COMA 5LA6B 4NQ3A 4X1YB 1SA0A 1X25A 1CLIA 3G71F 2Q1YA 3CC4F 4I4TA 1Q81H 1IV1A 1W3EX 5DCVA 3UT5A 3K2XA 1SA0B 4BT6A 3CYPB 4O4IA 3JATB 3OBYA 5EB0A 4B45A 1TUBA 3RA6A 1FNKA 3WXMB 3UT5B 1X52A 1DT9A 4X20B 4O4IB 1Z5WA 1TUBB 3LYBA 3FBAA 1FNJA 3V4DA 3HKCA 4ZHQA 5EIBC 3OW2F 2UYJA 1DBFA 5EB1B 3RYIB 2UYKA 3CB2A 4PWTA 1VQKF 4ZHQB 3HKCB 1RQ2A 5IYZA 3WPWA 4YJ2B 1VQPF 2QI2A 2QEXF 1M1KH 4TZZA 2CWJA 4X3LA 3KE1A 5ITZA 3NVIB 3FFMA 3D01A 3N2KA 2ZF8A 3VYTC 4BVQA 5JCOA 1RQ7A 5LYJA 2KTUA 3E22B 3JAKA 3P4EA 4LCKA 1YJNF 1QVGF 5MN4A 1IV3A 3HKBB 3F0FA 3QUWA 4ZI7A 5LYJB 1R1MA 4M8IA 5EAZA 3JAKB 3KJJA 3IMPA 3ERNA 4G4WA 4RQOA 1VQLF 4ZI7B 4I50A 3VI6A 3K12A 3TD4A 1X7OA 3M4SA 5HY4A 5HWEA 2YXZA 4I50B 1W59A 1M90H 2LBWA 3CD6F 2H8CA 5JQGA 2F9ZC 4RHAA 3WJRA 3WJQA 3CCLF 1XRGA 4TUYA 3WGNA 1JY8A 5JQGB 3WGKA 1SDSA 2BTUA 3WGMA 1GO0A 2DYYA 5IT9M 3HKEA 4TUYB 4ZK7A 2HRYA 1K8AH 2ZODA 5CB4A 3HKEB 2VAWA 5LP6C 2Z1EA 3ZOPA 3P0ZA 5CB4B 3SIVA 1ZWZA 2HP0A 4BT3A 1VH8A 1W40A 2G9IA 1YITF 3WJPA 2BO1A 5GIPC 3J81M 3ELCA 2HP0B 1YJ9F 5LOVA 5EIBD 2DT4A 2AIZP 2OTJF 4TV8A 3JCMM 3LMEA 5LOVB 5IJ0A 3CCRF 3M84A 1J7HA 4TV8B 1E7KA 3HKDA 4R40B 2VXYA 3JARA 4O2AA 2Z1UA 5IJ0B 4BW0B 5JVDA 1KNKA 2AMTA 3HTNA 3NK7A 3OBWA 5B8FA 1U3LA 5LA6A 4BY9D 3HKDB 3JARB 4O2AB 2IG8A 3GHZA 5JVDB 5FLXM 1GO1A 5FJ4C 2VGNA 3JATA 3DC2A 1YGYA 4BVRA 4X20A 3K14A 4X1KA 3LWRC 1UFYA 4C8EA 4NWOB 3S06A 3V7QA 3J80M 4X1KB 4BT4A 1JD1A
chains in the Genus database with same CATH topology
4BVSA 1KD1H 1S72F 1VQ7F 1RLGA 2I6DA 3CCUF 2KTVA 1VQLF 3LFOA 3ON1A 3VI6A 1CN7A 2QA4F 1VQNF 3HJWC 1YI2F 1VQ4F 1X7OA 1Q86H 5HY4A 5HWEA 1NJIH 3AGKA 4X3MA 5EWRA 3CCJF 1QVFF 4EI8A 2WALA 3CCQF 1M90H 3NK6A 2LBWA 3CD6F 2F9ZC 1YJWF 3I56F 3CCMF 2FC3A 2ALEA 2FGYA 4EI9A 4C4WC 1K9MH 3IR9A 5HY0A 3CCLF 2AIFA 1KQSF 1IPAA 5GIOC 3CCVF 3D00A 1SDSA 3N4ZA 3LWPC 1GO0A 3V7EA 5IT9M 5HY2A 5GINC 1T0KB 1YHQF 3J7AR 3GYQA 3NMUC 1W42A 3V3TA 1K8AH 1CK2A 1Q7YH 2OHWA 1VQ8F 2CZWA 3PLAC 3G4SF 5GANK 1YIJF 3NVKE 1W2BF 3CPWF 5HXZA 3CC2F 3RA5A 3CPQA 2JNBA 5EO3A 4BVTA 3SIVA 1ZWZA 1W40A 3LWVC 1YITF 1H7MA 1N8RH 4NUTA 4XCQA 2BO1A 3PAFA 5GIPC 3CG6A 3J81M 3LWOC 3G6EF 1W41A 4NQ3A 1YJ9F 3CXCF 3G71F 3JAMM 3HAXD 1Q82H 3CC4F 2OTJF 3JCMM 1Q81H 1W3EX 3VMFB 5DCVA 2OTLF 5HXUA 1VQMF 3CCRF 3OBYA 1XBIA 1E7KA 2VGMA 3RA6A 3WXMB 3SIUA 3CMEF 1PXWA 1X52A 4BW0B 3I55F 1DT9A 3NK7A 3OBWA 1VQ9F 4EI7A 1K73H 4BY9D 1NMUB 1X7PA 1RA4A 1JJ2F 5G4VC 5G4UC 3CCEF 2LBXA 1VQ6F 5FLXM 1GO1A 2GLZA 3LWQC 5A2QM 3OW2F 5FJ4C 2VGNA 1VQKF 2HVYD 5GAPK 2OZBA 1VQPF 2QI2A 3MCAB 3N4YA 2KG4A 3O85A 4TZZA 4BVRA 4X3LA 2QEXF 3CCSF 3NVIB 3FFMA 3E20B 3LWRC 1VQOF 4BVQA 1KC8H 3CC7F 1GZ0A 3V7QA 2KTUA 5HY1A 3J80M 1VQ5F 4LCKA 1YJNF 1QVGF 3E1YA 1M1KH 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 H;  1S72 F;  1VQ7 F;  1RLG A;  2I6D A;  3CCU F;  2KTV A;  1VQL F;  3LFO A;  3ON1 A;  3VI6 A;  1CN7 A;  2QA4 F;  1VQN F;  3HJW C;  1YI2 F;  1VQ4 F;  1X7O A;  1Q86 H;  1NJI H;  3AGK A;  4X3M A;  5EWR A;  3CCJ F;  1QVF F;  2WAL A;  3CCQ F;  1M90 H;  3NK6 A;  2LBW A;  3CD6 F;  1YJW F;  3I56 F;  3CCM F;  2FC3 A;  2ALE A;  4C4W C;  1K9M H;  3IR9 A;  3CCL F;  2AIF A;  1KQS F;  1IPA A;  5GIO C;  3CCV F;  1SDS A;  3N4Z A;  3LWP C;  1GO0 A;  3V7E A;  5IT9 M;  5GIN C;  1T0K B;  1YHQ F;  3J7A R;  3GYQ A;  3NMU C;  1W42 A;  1K8A H;  1CK2 A;  1Q7Y H;  2OHW A;  1VQ8 F;  2CZW A;  3PLA C;  3G4S F;  5GAN K;  1YIJ F;  3NVK E;  1W2B F;  3CPW F;  3CC2 F;  3RA5 A;  3CPQ A;  2JNB A;  5EO3 A;  3SIV A;  1ZWZ A;  1W40 A;  3LWV C;  1YIT F;  1H7M A;  1N8R H;  4NUT A;  2BO1 A;  3PAF A;  5GIP C;  3CG6 A;  3J81 M;  3LWO C;  3G6E F;  1W41 A;  1YJ9 F;  3CXC F;  3G71 F;  3JAM M;  3HAX D;  1Q82 H;  3CC4 F;  2OTJ F;  3JCM M;  1Q81 H;  1W3E X;  3VMF B;  5DCV A;  2OTL F;  1VQM F;  3CCR F;  3OBY A;  1XBI A;  1E7K A;  2VGM A;  3RA6 A;  3WXM B;  3SIU A;  3CME F;  1PXW A;  1X52 A;  4BW0 B;  3I55 F;  1DT9 A;  3NK7 A;  3OBW A;  1VQ9 F;  1K73 H;  4BY9 D;  1NMU B;  1X7P A;  1RA4 A;  1JJ2 F;  5G4V C;  5G4U C;  3CCE F;  2LBX A;  1VQ6 F;  5FLX M;  1GO1 A;  3LWQ C;  5A2Q M;  3OW2 F;  5FJ4 C;  2VGN A;  1VQK F;  2HVY D;  5GAP K;  2OZB A;  1VQP F;  2QI2 A;  3MCA B;  3N4Y A;  2KG4 A;  3O85 A;  4TZZ A;  2QEX F;  4X3L A;  1M1K H;  3CCS F;  3NVI B;  3FFM A;  3E20 B;  3LWR C;  1VQO F;  1KC8 H;  3CC7 F;  1GZ0 A;  3V7Q A;  2KTU A;  3J80 M;  1VQ5 F;  4LCK A;  1YJN F;  1QVG F;  3E1Y A;  3CMA F; 
#chains in the Genus database with same CATH topology
 4ZHW A;  4G88 A;  2EWC A;  3RYI A;  3HWU A;  4ZHV A;  1RLG A;  3CCU F;  5EYP A;  2HX0 A;  2Q1X A;  4YJ2 A;  4X1I A;  4FFB A;  3T80 A;  2QA4 F;  1VQN F;  1ODE A;  3HJW C;  3JAS A;  3MCQ A;  5AVM A;  3OON A;  2VAM A;  2UYN A;  5EYP B;  1Q86 H;  2CVL A;  3E22 A;  4X3M A;  3R0P A;  1VQV A;  4X1I B;  3JAW B;  4FFB B;  4EI8 A;  5J2U A;  3HKB A;  3JAS B;  2UYN B;  2CW4 A;  2BTQ B;  2R75 1;  5LP6 A;  1JFF A;  3FD6 A;  2ALE A;  4EI9 A;  1W55 A;  5J2U B;  1K9M H;  2AIF A;  2K1S A;  3S0W A;  5LP6 B;  2UYP A;  3I7T A;  1UI9 A;  3IKE A;  3RYC A;  5MN6 A;  5GIO C;  3L7Q A;  1JFF B;  3D00 A;  3CCV F;  3N4Z A;  3WGL A;  2YYE A;  1T0K B;  4BT7 A;  1YHQ F;  3J7A R;  3DDN A;  3GYQ A;  1W57 A;  4ZOL A;  1ONI A;  3RYC B;  1FSZ A;  3KHN A;  3NVK E;  4DRX A;  1OAP A;  4ZOL B;  1W5A A;  5CA1 B;  1H47 A;  2LCA A;  2CHS A;  5EO3 A;  4BVT A;  3LWV C;  2VAP A;  4DRX B;  3PAF A;  4XCQ A;  4F6R A;  3LWO C;  4G4V A;  3G6E F;  5HP8 A;  3C8L A;  3C9U A;  3TD3 A;  3MBM A;  3CXC F;  5IJ9 A;  3WPX A;  4F6R B;  1FFX A;  3VMF B;  3VOA A;  3S0Y A;  5HXU A;  5IJ9 B;  3F0D A;  3C9T A;  4B62 A;  1FFX B;  1XBI A;  2VGM A;  3SIU A;  3CME F;  4EB6 A;  1PXW A;  3KJK A;  3I55 F;  3M1X A;  2W8B C;  2LBT A;  1U40 A;  1X7P A;  1RA4 A;  1JJ2 F;  3FPI A;  5G4V C;  4EB6 B;  1QU9 A;  4ZHY B;  1W58 1;  2HS0 A;  2RB9 A;  2GLZ A;  4C82 A;  3U0O A;  5A2Q M;  3VCZ A;  2H6L A;  3MDO A;  2HVY D;  2PMP A;  5HP7 A;  3O85 A;  3N4Y A;  2KG4 A;  4O4H A;  3F0G A;  1VQO F;  2CHT A;  1KC8 H;  1GZ0 A;  3FD5 A;  5HY1 A;  1VQ5 F;  3IEQ A;  4YJ3 A;  4O4H B;  5LXT B;  2RHO A;  3CMA F;  1Q82 H;  4BVS A;  1S72 F;  5J2T A;  4YJ3 B;  2KTV A;  4C8I A;  3VYS C;  4C8G A;  3VO8 A;  3MQW A;  5BMV B;  3ON1 A;  4I55 A;  1CN7 A;  2KGW A;  5J2T B;  1YI2 F;  1NJI H;  4I55 B;  4G4X A;  5EWR A;  3CCJ F;  1QVF F;  2MQE A;  4TV9 A;  5JH7 A;  1YJW F;  1KNJ A;  2CSL A;  2FC3 A;  3BYQ A;  4C4W C;  3N2G A;  3S02 A;  4TV9 B;  5HY0 A;  3KIZ A;  1IPA A;  1W5B A;  5JH7 B;  3S0H A;  4HNA A;  3N2G B;  3RYF A;  4B46 A;  1W42 A;  3JAW A;  3V3T A;  1CK2 A;  4HNA B;  2V9Y A;  2CZW A;  3RYF B;  1GX1 A;  4I4T B;  5GAN K;  1YIJ F;  1W2B F;  2Z1F A;  4DXD A;  2HS3 A;  3ESJ A;  1IV4 A;  5KX5 A;  1XV2 A;  2JNB A;  2RHJ A;  2HS4 A;  2PHN A;  1H7M A;  5KX5 B;  4U3J A;  3TD5 A;  3CG6 A;  2HQS C;  1W41 A;  3EOR A;  4E6E A;  3QTY A;  3JAM M;  3HAX D;  4U3J B;  1JN1 A;  4ERH A;  2OTL F;  1VQM F;  2ZVZ A;  5CA1 A;  3JVH A;  3S03 A;  4KWE A;  4IHJ A;  5IYZ B;  1SZQ A;  1U3P A;  3RE3 A;  5ITZ B;  2ZAU A;  5EZY A;  2OTM A;  3N2K B;  3P10 A;  4G4Y A;  4BT2 A;  4EI7 A;  1K73 H;  1VQ9 F;  1NMU B;  4IHJ B;  2R6R 1;  4O4L A;  3CYQ A;  5CA0 A;  5G4U C;  3CCE F;  1VK3 A;  2LBX A;  1VQ6 F;  2ZOV A;  5EZY B;  1U43 A;  3LWQ C;  3B6N A;  2Z01 A;  3ZO8 A;  2GVI A;  2H8E A;  4O2B A;  4O4L B;  5CA0 B;  5GON A;  1Q8R A;  3F6M A;  1OFU A;  1W5E A;  3ZP4 A;  2B33 A;  4O2B B;  3RYH A;  5GAP K;  2OZB A;  3MCA B;  4O4J A;  4BT5 A;  4G4Z A;  5GON B;  3CCS F;  2BTO A;  3E20 B;  3IKF A;  3CC7 F;  2Z1T A;  3RYH B;  1T0A A;  2L26 A;  2UZH A;  4O4J B;  5C8Y A;  4LNU A;  2HRU A;  1QAH A;  3E1Y A;  4IIJ A;  5C8Y B;  5FNV A;  1KD1 H;  1VQ7 F;  2I6D A;  4LNU B;  1YQN A;  1W5F A;  2P6Y A;  1PF5 A;  3ZP7 A;  3LFO A;  5KMG A;  4IIJ B;  5FNV B;  3C9R A;  2RHL A;  3C9S A;  3D54 A;  1VQ4 F;  1Z5V A;  1RLU A;  5JCO C;  1TVK A;  3AGK A;  5KMG B;  2N48 A;  5LXT A;  3GTZ A;  2WAL A;  1H48 A;  2GZL A;  3NK6 A;  3WGJ A;  3CCQ F;  2IQQ A;  3F0E A;  3Q8H A;  1TVK B;  2I6R A;  4B5C A;  1XHO A;  2NMU A;  3I56 F;  3CCM F;  1NQ3 A;  2FGY A;  4U39 A;  3IR9 A;  5BMV A;  1KQS F;  4WBN A;  3VTI C;  3IEW A;  3JAL A;  3VIU A;  3LDT A;  3LWP C;  3V7E A;  2IAF A;  5HY2 A;  5GIN C;  3K0T A;  4WBN B;  3NMU C;  3JAL B;  1Q7Y H;  2OHW A;  3I3F A;  1VQ8 F;  3PLA C;  3G4S F;  2ZVY A;  3VYU C;  3CPW F;  5HXZ A;  3CC2 F;  3RA5 A;  3CPQ A;  1VHA A;  1QD9 A;  2HP3 A;  3VOB A;  4X1Y A;  5MN5 A;  1N8R H;  4NUT A;  3QHD A;  4C81 A;  2QTP A;  2RHH A;  1IV2 A;  1COM A;  5LA6 B;  4NQ3 A;  4X1Y B;  1SA0 A;  1X25 A;  1CLI A;  3G71 F;  2Q1Y A;  3CC4 F;  4I4T A;  1Q81 H;  1IV1 A;  1W3E X;  5DCV A;  3UT5 A;  3K2X A;  1SA0 B;  4BT6 A;  3CYP B;  4O4I A;  3JAT B;  3OBY A;  5EB0 A;  4B45 A;  1TUB A;  3RA6 A;  1FNK A;  3WXM B;  3UT5 B;  1X52 A;  1DT9 A;  4X20 B;  4O4I B;  1Z5W A;  1TUB B;  3LYB A;  3FBA A;  1FNJ A;  3V4D A;  3HKC A;  4ZHQ A;  5EIB C;  3OW2 F;  2UYJ A;  1DBF A;  5EB1 B;  3RYI B;  2UYK A;  3CB2 A;  4PWT A;  1VQK F;  4ZHQ B;  3HKC B;  1RQ2 A;  5IYZ A;  3WPW A;  4YJ2 B;  1VQP F;  2QI2 A;  2QEX F;  1M1K H;  4TZZ A;  2CWJ A;  4X3L A;  3KE1 A;  5ITZ A;  3NVI B;  3FFM A;  3D01 A;  3N2K A;  2ZF8 A;  3VYT C;  4BVQ A;  5JCO A;  1RQ7 A;  5LYJ A;  2KTU A;  3E22 B;  3JAK A;  3P4E A;  4LCK A;  1YJN F;  1QVG F;  5MN4 A;  1IV3 A;  3HKB B;  3F0F A;  3QUW A;  4ZI7 A;  5LYJ B;  1R1M A;  4M8I A;  5EAZ A;  3JAK B;  3KJJ A;  3IMP A;  3ERN A;  4G4W A;  4RQO A;  1VQL F;  4ZI7 B;  4I50 A;  3VI6 A;  3K12 A;  3TD4 A;  1X7O A;  3M4S A;  5HY4 A;  5HWE A;  2YXZ A;  4I50 B;  1W59 A;  1M90 H;  2LBW A;  3CD6 F;  2H8C A;  5JQG A;  2F9Z C;  4RHA A;  3WJR A;  3WJQ A;  3CCL F;  1XRG A;  4TUY A;  3WGN A;  1JY8 A;  5JQG B;  3WGK A;  1SDS A;  2BTU A;  3WGM A;  1GO0 A;  2DYY A;  5IT9 M;  3HKE A;  4TUY B;  4ZK7 A;  2HRY A;  1K8A H;  2ZOD A;  5CB4 A;  3HKE B;  2VAW A;  5LP6 C;  2Z1E A;  3ZOP A;  3P0Z A;  5CB4 B;  3SIV A;  1ZWZ A;  2HP0 A;  4BT3 A;  1VH8 A;  1W40 A;  2G9I A;  1YIT F;  3WJP A;  2BO1 A;  5GIP C;  3J81 M;  3ELC A;  2HP0 B;  1YJ9 F;  5LOV A;  5EIB D;  2DT4 A;  2AIZ P;  2OTJ F;  4TV8 A;  3JCM M;  3LME A;  5LOV B;  5IJ0 A;  3CCR F;  3M84 A;  1J7H A;  4TV8 B;  1E7K A;  3HKD A;  4R40 B;  2VXY A;  3JAR A;  4O2A A;  2Z1U A;  5IJ0 B;  4BW0 B;  5JVD A;  1KNK A;  2AMT A;  3HTN A;  3NK7 A;  3OBW A;  5B8F A;  1U3L A;  5LA6 A;  4BY9 D;  3HKD B;  3JAR B;  4O2A B;  2IG8 A;  3GHZ A;  5JVD B;  5FLX M;  1GO1 A;  5FJ4 C;  2VGN A;  3JAT A;  3DC2 A;  1YGY A;  4BVR A;  4X20 A;  3K14 A;  4X1K A;  3LWR C;  1UFY A;  4C8E A;  4NWO B;  3S06 A;  3V7Q A;  3J80 M;  4X1K B;  4BT4 A;  1JD1 A; 
#chains in the Genus database with same CATH homology
 4BVS A;  1KD1 H;  1S72 F;  1VQ7 F;  1RLG A;  2I6D A;  3CCU F;  2KTV A;  1VQL F;  3LFO A;  3ON1 A;  3VI6 A;  1CN7 A;  2QA4 F;  1VQN F;  3HJW C;  1YI2 F;  1VQ4 F;  1X7O A;  1Q86 H;  5HY4 A;  5HWE A;  1NJI H;  3AGK A;  4X3M A;  5EWR A;  3CCJ F;  1QVF F;  4EI8 A;  2WAL A;  3CCQ F;  1M90 H;  3NK6 A;  2LBW A;  3CD6 F;  2F9Z C;  1YJW F;  3I56 F;  3CCM F;  2FC3 A;  2ALE A;  2FGY A;  4EI9 A;  4C4W C;  1K9M H;  3IR9 A;  5HY0 A;  3CCL F;  2AIF A;  1KQS F;  1IPA A;  5GIO C;  3CCV F;  3D00 A;  1SDS A;  3N4Z A;  3LWP C;  1GO0 A;  3V7E A;  5IT9 M;  5HY2 A;  5GIN C;  1T0K B;  1YHQ F;  3J7A R;  3GYQ A;  3NMU C;  1W42 A;  3V3T A;  1K8A H;  1CK2 A;  1Q7Y H;  2OHW A;  1VQ8 F;  2CZW A;  3PLA C;  3G4S F;  5GAN K;  1YIJ F;  3NVK E;  1W2B F;  3CPW F;  5HXZ A;  3CC2 F;  3RA5 A;  3CPQ A;  2JNB A;  5EO3 A;  4BVT A;  3SIV A;  1ZWZ A;  1W40 A;  3LWV C;  1YIT F;  1H7M A;  1N8R H;  4NUT A;  4XCQ A;  2BO1 A;  3PAF A;  5GIP C;  3CG6 A;  3J81 M;  3LWO C;  3G6E F;  1W41 A;  4NQ3 A;  1YJ9 F;  3CXC F;  3G71 F;  3JAM M;  3HAX D;  1Q82 H;  3CC4 F;  2OTJ F;  3JCM M;  1Q81 H;  1W3E X;  3VMF B;  5DCV A;  2OTL F;  5HXU A;  1VQM F;  3CCR F;  3OBY A;  1XBI A;  1E7K A;  2VGM A;  3RA6 A;  3WXM B;  3SIU A;  3CME F;  1PXW A;  1X52 A;  4BW0 B;  3I55 F;  1DT9 A;  3NK7 A;  3OBW A;  1VQ9 F;  4EI7 A;  1K73 H;  4BY9 D;  1NMU B;  1X7P A;  1RA4 A;  1JJ2 F;  5G4V C;  5G4U C;  3CCE F;  2LBX A;  1VQ6 F;  5FLX M;  1GO1 A;  2GLZ A;  3LWQ C;  5A2Q M;  3OW2 F;  5FJ4 C;  2VGN A;  1VQK F;  2HVY D;  5GAP K;  2OZB A;  1VQP F;  2QI2 A;  3MCA B;  3N4Y A;  2KG4 A;  3O85 A;  4TZZ A;  4BVR A;  4X3L A;  2QEX F;  3CCS F;  3NVI B;  3FFM A;  3E20 B;  3LWR C;  1VQO F;  4BVQ A;  1KC8 H;  3CC7 F;  1GZ0 A;  3V7Q A;  2KTU A;  5HY1 A;  3J80 M;  1VQ5 F;  4LCK A;  1YJN F;  1QVG F;  3E1Y A;  1M1K H;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...