3NVKE

Structural basis for substrate placement by an archaeal box c/d ribonucleoprotein particle
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 22
structure length 121
sequence length 121
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nvkE00
1T0KB 1QVGF 3JCMM 2QA4F 1VQOF 3WXMB 3ON1A 2CZWA 1ZWZA 3J7AR 1YITF 5FJ4C 2FC3A 3LWVC 4TZZA 1M1KH 3AGKA 3CCSF 1VQPF 2LBWA 4NUTA 4C4WC 5GIOC 3CG6A 2OHWA 4X3MA 1VQ9F 1W42A 1KQSF 3RA5A 1N8RH 1CN7A 1GO1A 3MCAB 3G6EF 2VGMA 3CCJF 1XBIA 5EWRA 5A2QM 2KTVA 3FFMA 1Q81H 2KG4A 5G4VC 3CCQF 1RLGA 3LWRC 1KD1H 1GO0A 1CK2A 5GINC 3J81M 3VMFB 2LBXA 1W2BF 3E1YA 3CCLF 1VQNF 3IR9A 3LFOA 4LCKA 5G4UC 3O85A 4BY9D 3NK7A 5IT9M 1X7PA 1S72F 2HVYD 1W3EX 1VQKF 3N4ZA 1RA4A 5EO3A 3OBYA 3RA6A 1YI2F 2AIFA 1VQ7F 3OBWA 3CPWF 1YIJF 3V7EA 1VQMF 1W41A 3LWOC 2WALA 2OTJF 5DCVA 3CXCF 3HAXD 2QI2A 3CCVF 3OW2F 1Q7YH 5GAPK 3CD6F 1K8AH 1VQ4F 1JJ2F 3CC7F 2KTUA 3N4YA 1VQ8F 1KC8H 3HJWC 2OTLF 2OZBA 3E20B 3GYQA 3J80M 2ALEA 1YJ9F 4X3LA 4BW0B 3G4SF 2VGNA 1K73H 1Q82H 2I6DA 1QVFF 3CMAF 3VI6A 5GANK 2JNBA 1W40A 1YJNF 2BO1A 3CMEF 1M90H 3G71F 3CCUF 2QEXF 1DT9A 1VQ5F 3CPQA 3CC4F 3LWPC 1Q86H 3NMUC 1GZ0A 1X7OA 3SIVA 3I56F 3JAMM 1X52A 3I55F 3CCEF 3NK6A 1PXWA 1YHQF 3NVKE 1NJIH 3CC2F 1NMUB 3V7QA 1IPAA 1H7MA 3CCMF 1K9MH 3PLAC 5FLXM 3LWQC 1YJWF 1SDSA 1VQLF 1VQ6F 3NVIB 5GIPC 3CCRF 3PAFA 3SIUA 1E7KA
chains in the Genus database with same CATH superfamily
5LYJA 3F0DA 2R751 4LNUB 1Z5VA 3JCMM 3JARA 3WXMB 1ODEA 3IEQA 5FJ4C 2FC3A 3K0TA 3LWVC 1M1KH 5HY4A 2F9ZC 3AGKA 4ZK7A 3DC2A 4NUTA 4F6RB 4IIJB 1W42A 5LA6B 1KQSF 4EI8A 3HKEB 3MCAB 3TD5A 5A2QM 2H8CA 2KTVA 3ZOPA 4ZHQA 3DDNA 3E22B 1FSZA 5CA1B 1VH8A 5J2UA 3F0GA 3RYFB 2HP0A 5EYPB 3VYTC 1CK2A 5GINC 4EB6B 1W2BF 1ONIA 3LDTA 3CCLF 3HKDA 5LXTA 1VQNF 3IR9A 3LFOA 5KMGA 5G4UC 5MN6A 2VAMA 5KX5A 5MN4A 5IT9M 1X7PA 2CHTA 3WJQA 4F6RA 1VQKF 2ZF8A 5LP6A 4O4JA 3N4ZA 5LA6A 5EO3A 3OBYA 4X1IA 2AIFA 3HKBB 3OBWA 3CPWF 3JAWB 2WALA 2IQQA 3JAKB 1H47A 2Z1FA 3JATA 5JVDB 3KJJA 3KIZA 4NQ3A 3WJPA 1Q7YH 2RHOA 1W5EA 5IYZB 5FNVA 4EB6A 4BT5A 3CC7F 3T80A 3RYCB 1VQVA 2BTUA 2HX0A 2OTLF 1J7HA 3GYQA 3VYUC 2ALEA 4X1KA 1T0AA 1K73H 2YYEA 1QAHA 4FFBB 3D01A 4YJ2A 2CWJA 2ZODA 5GANK 2JNBA 3JASA 1M90H 4G4WA 1U40A 2BTQB 2HS0A 3GTZA 3VIUA 3BYQA 3VOBA 4BVQA 1COMA 1RLUA 3NMUC 1KNJA 2ZVZA 1X7OA 1UFYA 3SIVA 2RB9A 4U3JB 5BMVA 3NK6A 1PXWA 5HP8A 1YHQF 3C9UA 4BVRA 5IYZA 1YGYA 4X20B 3WGJA 3CC2F 2DT4A 3WGLA 3LWQC 1UI9A 4TUYA 1VQLF 3V3TA 3CCRF 3QHDA 3K12A 3SIUA 1IV3A 2IAFA 3WGMA 4ZHVA 4O2BB 3RYHB 3F6MA 4TV9B 3P0ZA 3CYPB 5EB1B 3M84A 4HNAB 2HS4A 3CCSF 1VQPF 2LBWA 4C4WC 5LP6C 2P6YA 4O4HA 2QTPA 1SZQA 1VHAA 1JFFA 3WPWA 1GO1A 2VGMA 3VO8A 4U3JA 2HS3A 4I4TB 2ZVYA 3FFMA 2Z1EA 3TD4A 1Q8RA 1TVKB 5C8YA 3CCQF 1RLGA 3LWRC 1VK3A 1XRGA 4O2AA 2VXYA 3J81M 2IG8A 4C82A 4ZOLA 2UYNA 1XV2A 3RYHA 3NK7A 3UT5A 1OAPA 3IKEA 4I55A 3RYIA 5HY0A 1FFXB 1W3EX 4O4IA 3HKCA 2AMTA 1RA4A 3WJRA 3N2KB 5CB4B 3ESJA 5HY1A 5EZYB 5EIBD 4G88A 4RQOA 1YIJF 1W41A 1RQ2A 2CHSA 3LWOC 1IV1A 1W5BA 3P4EA 4I4TA 4YJ3A 3CXCF 5DCVA 1W581 5HY2A 3CCVF 3IKFA 3R0PA 2NMUA 4B45A 1K8AH 4X1YA 2HQSC 2Z1TA 3K14A 4LNUA 1JJ2F 1VQ8F 1KC8H 3HJWC 4G4ZA 1R1MA 2EWCA 3VOAA 3FPIA 1PF5A 2OZBA 2VAWA 1TUBB 1YJ9F 4IIJA 1Q82H 4DRXB 3VI6A 4B5CA 3HKEA 1YJNF 1W40A 5IJ0B 3CMEF 3FD5A 1JY8A 3I3FA 5EZYA 3G71F 2Q1XA 1DT9A 4KWEA 2PHNA 2RHHA 1W5AA 3E22A 3U0OA 3CC4F 3LWPC 5CA1A 5HXUA 3RYFA 4ERHA 5EYPA 3JAMM 4ZHYB 3VCZA 4B46A 3I55F 3CCEF 2H6LA 4U39A 1JN1A 5B8FA 5MN5A 1W57A 1NJIH 3S0WA 1W5FA 4O4LB 1IPAA 3D54A 3JALB 1SDSA 1SA0B 3NVIB 1U3PA 4NWOB 5GIPC 1U43A 1TUBA 3S0YA 1W55A 5J2TB 1E7KA 4DRXA 5JH7B 2QA4F 4M8IA 2CZWA 1ZWZA 3HKBA 3F0EA 3N2GB 1YITF 2I6RA 4TZZA 4WBNB 2UZHA 3JAWA 2L26A 3JAKA 4C8EA 5JVDA 3MBMA 2OHWA 1VQ9F 3L7QA 2Z01A 5IJ9B 3RA5A 1N8RH 1YQNA 2KGWA 1CN7A 3G6EF 3CCJF 5ITZB 1CLIA 4TV8B 4BT4A 5JQGB 2KG4A 3RYCA 2UYJA 4C81A 4DXDA 1KD1H 4R40B 3WGKA 5HWEA 3E1YA 2GLZA 4FFBA 5HXZA 2RHLA 2FGYA 4ZI7B 3WPXA 5GONB 2V9YA 2CW4A 1GX1A 1S72F 4BT3A 5JCOA 2UYPA 3C9SA 3ZP4A 2OTMA 4I50B 2HRUA 4RHAA 5LYJB 3S06A 3JARB 1YI2F 1VQ7F 3EORA 3V7EA 1VQMF 1OFUA 3FBAA 4X20A 3HAXD 3M1XA 2QI2A 3QTYA 4G4XA 5GAPK 3CD6F 2K1SA 2W8BC 2B33A 2KTUA 4O2BA 4TV9A 4ZHQB 2HP3A 4HNAA 1KNKA 5J2UB 2HP0B 4X3LA 4BW0B 2VGNA 4BT7A 3K2XA 4C8GA 3HKDB 3Q8HA 3CMAF 2Q1YA 5HP7A 5LXTB 2BTOA 5CA0B 5KX5B 3WGNA 3CPQA 4G4VA 1TVKA 3C9TA 1Q86H 3S03A 3ERNA 4E6EA 1GZ0A 5LP6B 4O4JB 3I56F 1X52A 4X1IB 3QUWA 3MQWA 4XCQA 2H8EA 3KE1A 2HRYA 1NMUB 3JATB 5EIBC 1K9MH 1IV2A 3VTIC 3ZP7A 2AIZP 1FFXA 4G4YA 1VQ5F 1XBIA 5FNVB 1FNJA 4BT6A 4BVTA 1IV4A 3N2KA 2UYKA 4PWTA 5CB4A 1QVGF 1T0KB 1VQOF 3ON1A 1DBFA 3J7AR 4B62A 2GZLA 3S02A 5CA0A 3OONA 5JCOC 5GIOC 3CG6A 4X1KB 4X3MA 5LOVB 1Z5WA 1XHOA 4YJ2B 3TD3A 3JASB 3C9RA 3LYBA 5EWRA 1Q81H 5G4VC 2CSLA 1GO0A 1NQ3A 2YXZA 3VMFB 2LBXA 3IMPA 5BMVB 4LCKA 3LMEA 5IJ0A 3O85A 3S0HA 4BY9D 3V4DA 2Z1UA 3JVHA 4TUYB 1QU9A 3ZO8A 2DYYA 2HVYD 4EI7A 1H48A 3IEWA 3VYSC 2N48A 3CB2A 3MCQA 5LOVA 3GHZA 3RA6A 4C8IA 4ZHWA 3ELCA 2R6R1 1FNKA 4EI9A 2OTJF 4O4LA 3JALA 4O4HB 1SA0A 1JFFB 3OW2F 2LBTA 4IHJB 2GVIA 2LCAA 1VQ4F 5J2TA 5JH7A 3N4YA 2VAPA 4BT2A 3P10A 3N2GA 5C8YB 4O2AB 3HWUA 4WBNA 3E20B 3J80M 3C8LA 3CYQA 3G4SF 3FD6A 4ZOLB 2I6DA 5AVMA 5IJ9A 1QVFF 1QD9A 2UYNB 2BO1A 5ITZA 1U3LA 2ZOVA 4TV8A 3CCUF 3RE3A 2QEXF 3UT5B 5JQGA 3M4SA 3RYIB 3F0FA 4I55B 2G9IA 4I50A 4O4IB 1W59A 3HKCB 3HTNA 3KJKA 4BVSA 2ZAUA 5EAZA 3NVKE 3I7TA 3D00A 4IHJA 2CVLA 2PMPA 4ZI7A 1RQ7A 3MDOA 5GONA 4YJ3B 5EB0A 3V7QA 1H7MA 3CCMF 3PLAC 5FLXM 1JD1A 1YJWF 1VQ6F 2RHJA 3KHNA 1X25A 2MQEA 5KMGB 4X1YB 3PAFA 3B6NA
chains in the Genus database with same CATH topology
4BVTA 1T0KB 1QVGF 3JCMM 2QA4F 1VQOF 3WXMB 3ON1A 2CZWA 1ZWZA 3J7AR 1YITF 5FJ4C 2FC3A 3LWVC 4TZZA 5HY4A 1M1KH 2F9ZC 3AGKA 3CCSF 1VQPF 2LBWA 4NUTA 4C4WC 5GIOC 3CG6A 2OHWA 4X3MA 1VQ9F 1W42A 1KQSF 3RA5A 1N8RH 4EI8A 1CN7A 1GO1A 3MCAB 3G6EF 2VGMA 3CCJF 1XBIA 5EWRA 5A2QM 2KTVA 3FFMA 1Q81H 2KG4A 5G4VC 3CCQF 1RLGA 3LWRC 1KD1H 1GO0A 5HWEA 1CK2A 5GINC 3J81M 3VMFB 2LBXA 1W2BF 3E1YA 3CCLF 2GLZA 5HXZA 2FGYA 1VQNF 3IR9A 3LFOA 4LCKA 5G4UC 3O85A 4BY9D 3NK7A 5IT9M 1X7PA 5HY0A 1S72F 2HVYD 4EI7A 1W3EX 1VQKF 3N4ZA 1RA4A 5HY1A 5EO3A 3OBYA 3RA6A 1YI2F 2AIFA 1VQ7F 3OBWA 3CPWF 1YIJF 3V7EA 4EI9A 1VQMF 1W41A 3LWOC 2WALA 2OTJF 5DCVA 3CXCF 3HAXD 2QI2A 4NQ3A 5HY2A 3CCVF 3OW2F 1Q7YH 5GAPK 3CD6F 1K8AH 1VQ4F 1JJ2F 3CC7F 2KTUA 3N4YA 1VQ8F 1KC8H 3HJWC 2OTLF 2OZBA 3E20B 3GYQA 3J80M 2ALEA 1YJ9F 4X3LA 4BW0B 3G4SF 2VGNA 1K73H 1Q82H 2I6DA 1QVFF 3CMAF 3VI6A 5GANK 2JNBA 1W40A 1YJNF 2BO1A 3CMEF 1M90H 3G71F 3CCUF 2QEXF 1DT9A 1VQ5F 3CPQA 3CC4F 4BVQA 3LWPC 1Q86H 3NMUC 5HXUA 1GZ0A 1X7OA 3SIVA 3I56F 3JAMM 1X52A 3I55F 4BVSA 3CCEF 3NK6A 1PXWA 1YHQF 3NVKE 3D00A 4XCQA 4BVRA 1NJIH 3CC2F 1NMUB 3V7QA 1IPAA 1H7MA 3CCMF 1K9MH 3PLAC 5FLXM 3LWQC 1YJWF 1SDSA 1VQLF 1VQ6F 3NVIB 5GIPC 3V3TA 3CCRF 3PAFA 3SIUA 1E7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0K B;  1QVG F;  3JCM M;  2QA4 F;  1VQO F;  3WXM B;  3ON1 A;  2CZW A;  1ZWZ A;  3J7A R;  1YIT F;  5FJ4 C;  2FC3 A;  3LWV C;  4TZZ A;  1M1K H;  3AGK A;  3CCS F;  1VQP F;  2LBW A;  4NUT A;  4C4W C;  5GIO C;  3CG6 A;  2OHW A;  4X3M A;  1VQ9 F;  1W42 A;  1KQS F;  3RA5 A;  1N8R H;  1CN7 A;  1GO1 A;  3MCA B;  3G6E F;  2VGM A;  3CCJ F;  1XBI A;  5EWR A;  5A2Q M;  2KTV A;  3FFM A;  1Q81 H;  2KG4 A;  5G4V C;  3CCQ F;  1RLG A;  3LWR C;  1KD1 H;  1GO0 A;  1CK2 A;  5GIN C;  3J81 M;  3VMF B;  2LBX A;  1W2B F;  3E1Y A;  3CCL F;  1VQN F;  3IR9 A;  3LFO A;  4LCK A;  5G4U C;  3O85 A;  4BY9 D;  3NK7 A;  5IT9 M;  1X7P A;  1S72 F;  2HVY D;  1W3E X;  1VQK F;  3N4Z A;  1RA4 A;  5EO3 A;  3OBY A;  3RA6 A;  1YI2 F;  2AIF A;  1VQ7 F;  3OBW A;  3CPW F;  1YIJ F;  3V7E A;  1VQM F;  1W41 A;  3LWO C;  2WAL A;  2OTJ F;  5DCV A;  3CXC F;  3HAX D;  2QI2 A;  3CCV F;  3OW2 F;  1Q7Y H;  5GAP K;  3CD6 F;  1K8A H;  1VQ4 F;  1JJ2 F;  3CC7 F;  2KTU A;  3N4Y A;  1VQ8 F;  1KC8 H;  3HJW C;  2OTL F;  2OZB A;  3E20 B;  3GYQ A;  3J80 M;  2ALE A;  1YJ9 F;  4X3L A;  4BW0 B;  3G4S F;  2VGN A;  1K73 H;  1Q82 H;  2I6D A;  1QVF F;  3CMA F;  3VI6 A;  5GAN K;  2JNB A;  1W40 A;  1YJN F;  2BO1 A;  3CME F;  1M90 H;  3G71 F;  3CCU F;  2QEX F;  1DT9 A;  1VQ5 F;  3CPQ A;  3CC4 F;  3LWP C;  1Q86 H;  3NMU C;  1GZ0 A;  1X7O A;  3SIV A;  3I56 F;  3JAM M;  1X52 A;  3I55 F;  3CCE F;  3NK6 A;  1PXW A;  1YHQ F;  3NVK E;  1NJI H;  3CC2 F;  1NMU B;  3V7Q A;  1IPA A;  1H7M A;  3CCM F;  1K9M H;  3PLA C;  5FLX M;  3LWQ C;  1YJW F;  1SDS A;  1VQL F;  1VQ6 F;  3NVI B;  5GIP C;  3CCR F;  3PAF A;  3SIU A;  1E7K A; 
#chains in the Genus database with same CATH topology
 5LYJ A;  3F0D A;  2R75 1;  4LNU B;  1Z5V A;  3JCM M;  3JAR A;  3WXM B;  1ODE A;  3IEQ A;  5FJ4 C;  2FC3 A;  3K0T A;  3LWV C;  1M1K H;  5HY4 A;  2F9Z C;  3AGK A;  4ZK7 A;  3DC2 A;  4NUT A;  4F6R B;  4IIJ B;  1W42 A;  5LA6 B;  1KQS F;  4EI8 A;  3HKE B;  3MCA B;  3TD5 A;  5A2Q M;  2H8C A;  2KTV A;  3ZOP A;  4ZHQ A;  3DDN A;  3E22 B;  1FSZ A;  5CA1 B;  1VH8 A;  5J2U A;  3F0G A;  3RYF B;  2HP0 A;  5EYP B;  3VYT C;  1CK2 A;  5GIN C;  4EB6 B;  1W2B F;  1ONI A;  3LDT A;  3CCL F;  3HKD A;  5LXT A;  1VQN F;  3IR9 A;  3LFO A;  5KMG A;  5G4U C;  5MN6 A;  2VAM A;  5KX5 A;  5MN4 A;  5IT9 M;  1X7P A;  2CHT A;  3WJQ A;  4F6R A;  1VQK F;  2ZF8 A;  5LP6 A;  4O4J A;  3N4Z A;  5LA6 A;  5EO3 A;  3OBY A;  4X1I A;  2AIF A;  3HKB B;  3OBW A;  3CPW F;  3JAW B;  2WAL A;  2IQQ A;  3JAK B;  1H47 A;  2Z1F A;  3JAT A;  5JVD B;  3KJJ A;  3KIZ A;  4NQ3 A;  3WJP A;  1Q7Y H;  2RHO A;  1W5E A;  5IYZ B;  5FNV A;  4EB6 A;  4BT5 A;  3CC7 F;  3T80 A;  3RYC B;  1VQV A;  2BTU A;  2HX0 A;  2OTL F;  1J7H A;  3GYQ A;  3VYU C;  2ALE A;  4X1K A;  1T0A A;  1K73 H;  2YYE A;  1QAH A;  4FFB B;  3D01 A;  4YJ2 A;  2CWJ A;  2ZOD A;  5GAN K;  2JNB A;  3JAS A;  1M90 H;  4G4W A;  1U40 A;  2BTQ B;  2HS0 A;  3GTZ A;  3VIU A;  3BYQ A;  3VOB A;  4BVQ A;  1COM A;  1RLU A;  3NMU C;  1KNJ A;  2ZVZ A;  1X7O A;  1UFY A;  3SIV A;  2RB9 A;  4U3J B;  5BMV A;  3NK6 A;  1PXW A;  5HP8 A;  1YHQ F;  3C9U A;  4BVR A;  5IYZ A;  1YGY A;  4X20 B;  3WGJ A;  3CC2 F;  2DT4 A;  3WGL A;  3LWQ C;  1UI9 A;  4TUY A;  1VQL F;  3V3T A;  3CCR F;  3QHD A;  3K12 A;  3SIU A;  1IV3 A;  2IAF A;  3WGM A;  4ZHV A;  4O2B B;  3RYH B;  3F6M A;  4TV9 B;  3P0Z A;  3CYP B;  5EB1 B;  3M84 A;  4HNA B;  2HS4 A;  3CCS F;  1VQP F;  2LBW A;  4C4W C;  5LP6 C;  2P6Y A;  4O4H A;  2QTP A;  1SZQ A;  1VHA A;  1JFF A;  3WPW A;  1GO1 A;  2VGM A;  3VO8 A;  4U3J A;  2HS3 A;  4I4T B;  2ZVY A;  3FFM A;  2Z1E A;  3TD4 A;  1Q8R A;  1TVK B;  5C8Y A;  3CCQ F;  1RLG A;  3LWR C;  1VK3 A;  1XRG A;  4O2A A;  2VXY A;  3J81 M;  2IG8 A;  4C82 A;  4ZOL A;  2UYN A;  1XV2 A;  3RYH A;  3NK7 A;  3UT5 A;  1OAP A;  3IKE A;  4I55 A;  3RYI A;  5HY0 A;  1FFX B;  1W3E X;  4O4I A;  3HKC A;  2AMT A;  1RA4 A;  3WJR A;  3N2K B;  5CB4 B;  3ESJ A;  5HY1 A;  5EZY B;  5EIB D;  4G88 A;  4RQO A;  1YIJ F;  1W41 A;  1RQ2 A;  2CHS A;  3LWO C;  1IV1 A;  1W5B A;  3P4E A;  4I4T A;  4YJ3 A;  3CXC F;  5DCV A;  1W58 1;  5HY2 A;  3CCV F;  3IKF A;  3R0P A;  2NMU A;  4B45 A;  1K8A H;  4X1Y A;  2HQS C;  2Z1T A;  3K14 A;  4LNU A;  1JJ2 F;  1VQ8 F;  1KC8 H;  3HJW C;  4G4Z A;  1R1M A;  2EWC A;  3VOA A;  3FPI A;  1PF5 A;  2OZB A;  2VAW A;  1TUB B;  1YJ9 F;  4IIJ A;  1Q82 H;  4DRX B;  3VI6 A;  4B5C A;  3HKE A;  1YJN F;  1W40 A;  5IJ0 B;  3CME F;  3FD5 A;  1JY8 A;  3I3F A;  5EZY A;  3G71 F;  2Q1X A;  1DT9 A;  4KWE A;  2PHN A;  2RHH A;  1W5A A;  3E22 A;  3U0O A;  3CC4 F;  3LWP C;  5CA1 A;  5HXU A;  3RYF A;  4ERH A;  5EYP A;  3JAM M;  4ZHY B;  3VCZ A;  4B46 A;  3I55 F;  3CCE F;  2H6L A;  4U39 A;  1JN1 A;  5B8F A;  5MN5 A;  1W57 A;  1NJI H;  3S0W A;  1W5F A;  4O4L B;  1IPA A;  3D54 A;  3JAL B;  1SDS A;  1SA0 B;  3NVI B;  1U3P A;  4NWO B;  5GIP C;  1U43 A;  1TUB A;  3S0Y A;  1W55 A;  5J2T B;  1E7K A;  4DRX A;  5JH7 B;  2QA4 F;  4M8I A;  2CZW A;  1ZWZ A;  3HKB A;  3F0E A;  3N2G B;  1YIT F;  2I6R A;  4TZZ A;  4WBN B;  2UZH A;  3JAW A;  2L26 A;  3JAK A;  4C8E A;  5JVD A;  3MBM A;  2OHW A;  1VQ9 F;  3L7Q A;  2Z01 A;  5IJ9 B;  3RA5 A;  1N8R H;  1YQN A;  2KGW A;  1CN7 A;  3G6E F;  3CCJ F;  5ITZ B;  1CLI A;  4TV8 B;  4BT4 A;  5JQG B;  2KG4 A;  3RYC A;  2UYJ A;  4C81 A;  4DXD A;  1KD1 H;  4R40 B;  3WGK A;  5HWE A;  3E1Y A;  2GLZ A;  4FFB A;  5HXZ A;  2RHL A;  2FGY A;  4ZI7 B;  3WPX A;  5GON B;  2V9Y A;  2CW4 A;  1GX1 A;  1S72 F;  4BT3 A;  5JCO A;  2UYP A;  3C9S A;  3ZP4 A;  2OTM A;  4I50 B;  2HRU A;  4RHA A;  5LYJ B;  3S06 A;  3JAR B;  1YI2 F;  1VQ7 F;  3EOR A;  3V7E A;  1VQM F;  1OFU A;  3FBA A;  4X20 A;  3HAX D;  3M1X A;  2QI2 A;  3QTY A;  4G4X A;  5GAP K;  3CD6 F;  2K1S A;  2W8B C;  2B33 A;  2KTU A;  4O2B A;  4TV9 A;  4ZHQ B;  2HP3 A;  4HNA A;  1KNK A;  5J2U B;  2HP0 B;  4X3L A;  4BW0 B;  2VGN A;  4BT7 A;  3K2X A;  4C8G A;  3HKD B;  3Q8H A;  3CMA F;  2Q1Y A;  5HP7 A;  5LXT B;  2BTO A;  5CA0 B;  5KX5 B;  3WGN A;  3CPQ A;  4G4V A;  1TVK A;  3C9T A;  1Q86 H;  3S03 A;  3ERN A;  4E6E A;  1GZ0 A;  5LP6 B;  4O4J B;  3I56 F;  1X52 A;  4X1I B;  3QUW A;  3MQW A;  4XCQ A;  2H8E A;  3KE1 A;  2HRY A;  1NMU B;  3JAT B;  5EIB C;  1K9M H;  1IV2 A;  3VTI C;  3ZP7 A;  2AIZ P;  1FFX A;  4G4Y A;  1VQ5 F;  1XBI A;  5FNV B;  1FNJ A;  4BT6 A;  4BVT A;  1IV4 A;  3N2K A;  2UYK A;  4PWT A;  5CB4 A;  1QVG F;  1T0K B;  1VQO F;  3ON1 A;  1DBF A;  3J7A R;  4B62 A;  2GZL A;  3S02 A;  5CA0 A;  3OON A;  5JCO C;  5GIO C;  3CG6 A;  4X1K B;  4X3M A;  5LOV B;  1Z5W A;  1XHO A;  4YJ2 B;  3TD3 A;  3JAS B;  3C9R A;  3LYB A;  5EWR A;  1Q81 H;  5G4V C;  2CSL A;  1GO0 A;  1NQ3 A;  2YXZ A;  3VMF B;  2LBX A;  3IMP A;  5BMV B;  4LCK A;  3LME A;  5IJ0 A;  3O85 A;  3S0H A;  4BY9 D;  3V4D A;  2Z1U A;  3JVH A;  4TUY B;  1QU9 A;  3ZO8 A;  2DYY A;  2HVY D;  4EI7 A;  1H48 A;  3IEW A;  3VYS C;  2N48 A;  3CB2 A;  3MCQ A;  5LOV A;  3GHZ A;  3RA6 A;  4C8I A;  4ZHW A;  3ELC A;  2R6R 1;  1FNK A;  4EI9 A;  2OTJ F;  4O4L A;  3JAL A;  4O4H B;  1SA0 A;  1JFF B;  3OW2 F;  2LBT A;  4IHJ B;  2GVI A;  2LCA A;  1VQ4 F;  5J2T A;  5JH7 A;  3N4Y A;  2VAP A;  4BT2 A;  3P10 A;  3N2G A;  5C8Y B;  4O2A B;  3HWU A;  4WBN A;  3E20 B;  3J80 M;  3C8L A;  3CYQ A;  3G4S F;  3FD6 A;  4ZOL B;  2I6D A;  5AVM A;  5IJ9 A;  1QVF F;  1QD9 A;  2UYN B;  2BO1 A;  5ITZ A;  1U3L A;  2ZOV A;  4TV8 A;  3CCU F;  3RE3 A;  2QEX F;  3UT5 B;  5JQG A;  3M4S A;  3RYI B;  3F0F A;  4I55 B;  2G9I A;  4I50 A;  4O4I B;  1W59 A;  3HKC B;  3HTN A;  3KJK A;  4BVS A;  2ZAU A;  5EAZ A;  3NVK E;  3I7T A;  3D00 A;  4IHJ A;  2CVL A;  2PMP A;  4ZI7 A;  1RQ7 A;  3MDO A;  5GON A;  4YJ3 B;  5EB0 A;  3V7Q A;  1H7M A;  3CCM F;  3PLA C;  5FLX M;  1JD1 A;  1YJW F;  1VQ6 F;  2RHJ A;  3KHN A;  1X25 A;  2MQE A;  5KMG B;  4X1Y B;  3PAF A;  3B6N A; 
#chains in the Genus database with same CATH homology
 4BVT A;  1T0K B;  1QVG F;  3JCM M;  2QA4 F;  1VQO F;  3WXM B;  3ON1 A;  2CZW A;  1ZWZ A;  3J7A R;  1YIT F;  5FJ4 C;  2FC3 A;  3LWV C;  4TZZ A;  5HY4 A;  1M1K H;  2F9Z C;  3AGK A;  3CCS F;  1VQP F;  2LBW A;  4NUT A;  4C4W C;  5GIO C;  3CG6 A;  2OHW A;  4X3M A;  1VQ9 F;  1W42 A;  1KQS F;  3RA5 A;  1N8R H;  4EI8 A;  1CN7 A;  1GO1 A;  3MCA B;  3G6E F;  2VGM A;  3CCJ F;  1XBI A;  5EWR A;  5A2Q M;  2KTV A;  3FFM A;  1Q81 H;  2KG4 A;  5G4V C;  3CCQ F;  1RLG A;  3LWR C;  1KD1 H;  1GO0 A;  5HWE A;  1CK2 A;  5GIN C;  3J81 M;  3VMF B;  2LBX A;  1W2B F;  3E1Y A;  3CCL F;  2GLZ A;  5HXZ A;  2FGY A;  1VQN F;  3IR9 A;  3LFO A;  4LCK A;  5G4U C;  3O85 A;  4BY9 D;  3NK7 A;  5IT9 M;  1X7P A;  5HY0 A;  1S72 F;  2HVY D;  4EI7 A;  1W3E X;  1VQK F;  3N4Z A;  1RA4 A;  5HY1 A;  5EO3 A;  3OBY A;  3RA6 A;  1YI2 F;  2AIF A;  1VQ7 F;  3OBW A;  3CPW F;  1YIJ F;  3V7E A;  4EI9 A;  1VQM F;  1W41 A;  3LWO C;  2WAL A;  2OTJ F;  5DCV A;  3CXC F;  3HAX D;  2QI2 A;  4NQ3 A;  5HY2 A;  3CCV F;  3OW2 F;  1Q7Y H;  5GAP K;  3CD6 F;  1K8A H;  1VQ4 F;  1JJ2 F;  3CC7 F;  2KTU A;  3N4Y A;  1VQ8 F;  1KC8 H;  3HJW C;  2OTL F;  2OZB A;  3E20 B;  3GYQ A;  3J80 M;  2ALE A;  1YJ9 F;  4X3L A;  4BW0 B;  3G4S F;  2VGN A;  1K73 H;  1Q82 H;  2I6D A;  1QVF F;  3CMA F;  3VI6 A;  5GAN K;  2JNB A;  1W40 A;  1YJN F;  2BO1 A;  3CME F;  1M90 H;  3G71 F;  3CCU F;  2QEX F;  1DT9 A;  1VQ5 F;  3CPQ A;  3CC4 F;  4BVQ A;  3LWP C;  1Q86 H;  3NMU C;  5HXU A;  1GZ0 A;  1X7O A;  3SIV A;  3I56 F;  3JAM M;  1X52 A;  3I55 F;  4BVS A;  3CCE F;  3NK6 A;  1PXW A;  1YHQ F;  3NVK E;  3D00 A;  4XCQ A;  4BVR A;  1NJI H;  3CC2 F;  1NMU B;  3V7Q A;  1IPA A;  1H7M A;  3CCM F;  1K9M H;  3PLA C;  5FLX M;  3LWQ C;  1YJW F;  1SDS A;  1VQL F;  1VQ6 F;  3NVI B;  5GIP C;  3V3T A;  3CCR F;  3PAF A;  3SIU A;  1E7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...