3NVKE

Structural basis for substrate placement by an archaeal box c/d ribonucleoprotein particle
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nvkE00
3JCMM 3LWPC 3HJWC 3CC2F 3LWOC 1S72F 1W2BF 1Q81H 1KD1H 1W42A 3OBYA 3V7EA 3RA5A 2WALA 3CMAF 3NVKE 1RLGA 2KG4A 3N4YA 2JNBA 3CCSF 3CCMF 4C4WC 1YITF 2OHWA 5EO3A 3G6EF 3E1YA 3CMEF 2OTLF 3O85A 2VGNA 3GYQA 3OW2F 1YHQF 3VI6A 5GAPK 2HVYD 1YJWF 3CC7F 2AIFA 3MCAB 3LWQC 1K8AH 2QI2A 4BW0B 1GZ0A 1E7KA 3SIUA 3ON1A 1X52A 1ZWZA 1H7MA 1M90H 1VQNF 4NUTA 4X3LA 1W3EX 3WXMB 1VQMF 1T0KB 1M1KH 1VQ7F 3NVIB 1XBIA 1X7OA 4BY9D 3J80M 1VQ8F 3V7QA 4X3MA 1Q7YH 2CZWA 5GIPC 3J81M 1KC8H 1Q82H 1NJIH 3CXCF 1VQ4F 1VQ9F 2OTJF 1VQOF 1SDSA 2LBWA 1GO1A 2QEXF 1K73H 2FC3A 1W40A 1QVFF 3G71F 3NMUC 1PXWA 3NK6A 1N8RH 1Q86H 5DCVA 5G4VC 3CCVF 1VQ6F 3PLAC 1K9MH 5FLXM 3CCJF 2BO1A 3FFMA 5FJ4C 5A2QM 3G4SF 3N4ZA 3CCLF 1IPAA 2ALEA 3CCUF 1VQLF 3CCRF 2QA4F 4LCKA 5EWRA 5IT9M 1VQ5F 3PAFA 1YI2F 1NMUB 1W41A 5G4UC 3LWVC 3I56F 3LFOA 1GO0A 2I6DA 5GINC 3JAMM 5GANK 3E20B 1VQPF 1YJ9F 1RA4A 4TZZA 1YJNF 2VGMA 3J7AR 3VMFB 3NK7A 1CK2A 3CPQA 1QVGF 3CD6F 1YIJF 2KTUA 3IR9A 3RA6A 3I55F 2OZBA 1KQSF 1CN7A 3CG6A 3AGKA 1JJ2F 3CPWF 3CCQF 3HAXD 3CC4F 3SIVA 3OBWA 1VQKF 5GIOC 1X7PA 1DT9A 2LBXA 2KTVA 3CCEF 3LWRC
chains in the Genus database with same CATH superfamily
3CC2F 1S72F 3OBYA 1RLGA 2KG4A 3N4YA 4O4JB 4PWTA 2VAPA 3KE1A 3G6EF 4EI9A 2RHHA 3O85A 2VGNA 3JARA 3OW2F 4B5CA 4ZHWA 4TUYA 2HX0A 3VI6A 5GAPK 3IKFA 4O2BA 2HRYA 3LWQC 3FPIA 3CYPB 3MQWA 2QI2A 1RLUA 4BW0B 1E7KA 3K12A 4O4HA 5HP7A 5LYJA 3FD6A 3ELCA 4YJ3B 1IV1A 1QD9A 5EB0A 4NUTA 4X3LA 4XCQA 2ZODA 3KJJA 1VH8A 5LP6A 1JN1A 4U3JB 4DRXB 1VQMF 3ZOPA 1T0KB 1W59A 4ZHYB 4I4TB 4ZI7B 4C8IA 1X7OA 1GX1A 4C81A 4C82A 1Z5VA 2BTUA 2DT4A 1NJIH 1VQ9F 1X25A 3VYTC 1SDSA 4I50A 5HXUA 5J2TB 2P6YA 2ZVYA 2OTMA 3V3TA 4I4TA 3G71F 3RYIB 5HY0A 4TV8B 1N8RH 5G4VC 1VQ6F 1R1MA 3M84A 5FLXM 3CCJF 2BO1A 3F0EA 3JAWA 3N2GB 5KMGA 3C9UA 5A2QM 2PMPA 4X1IA 3T80A 3LYBA 5EWRA 3UT5A 3WPWA 3LFOA 4NWOB 2AIZP 5GINC 3IEWA 2F9ZC 5GANK 5BMVA 1RA4A 2N48A 1YJ9F 4ZI7A 5CA0B 4G4WA 3VMFB 3DDNA 3CPQA 2GZLA 3RYFA 3Q8HA 5IJ0A 2R751 3MCQA 1YIJF 2DYYA 3B6NA 4IIJA 3JATB 1UFYA 3IR9A 2AMTA 3I55F 5JVDA 3WJQA 3DC2A 4TV9B 4ZHVA 3HAXD 1TUBA 5LXTA 3WGNA 3CC4F 4X1YA 2UYPA 1SZQA 3OBWA 5KX5A 2HP3A 1SA0B 4TUYB 1FNJA 1DT9A 1KNJA 4BT4A 4HNAA 3N2KA 1W2BF 1Q81H 4BT6A 4DXDA 3JATA 3NVKE 1PF5A 2RHLA 2Z1FA 4ZHQA 3CCMF 1ONIA 2HS3A 5EO3A 3E1YA 5JH7A 3CMEF 2FGYA 4IHJB 3GYQA 3JARB 3V4DA 3S0YA 1YHQF 3C9RA 3QTYA 3S02A 3CC7F 2VAMA 4LNUA 5EB1B 1FSZA 1TUBB 3CB2A 4ZHQB 1K8AH 3P4EA 1NQ3A 2RB9A 5CA1B 3N2GA 1ZWZA 1JY8A 5ITZB 1M90H 1SA0A 2GVIA 5FNVA 3VOAA 2IG8A 5EYPA 3HKEB 2CW4A 4BY9D 4EI7A 4X3MA 1Q7YH 4O4JA 5GIPC 2NMUA 3MDOA 1VQ4F 3CXCF 1W5EA 3LMEA 4X1IB 4HNAB 1U40A 2QEXF 2G9IA 2HP0B 3RE3A 2FC3A 1JD1A 3TD4A 1RQ7A 4YJ2A 3S0HA 1JFFB 2UYKA 3RYHA 5LP6B 3FBAA 1Q86H 5DCVA 1YGYA 3JALA 3FFMA 4O4IA 5HXZA 5LXTB 2HP0A 2UYJA 3N4ZA 1IPAA 4ZOLB 5C8YA 5HWEA 3VCZA 3VYUC 3HWUA 3PAFA 1NMUB 1GO0A 5GONB 2I6DA 1YJNF 1QAHA 1W5AA 2KGWA 1U3PA 5CB4A 1FFXA 4ERHA 5B8FA 3JVHA 1TVKB 2OZBA 1KQSF 1XHOA 2HS0A 3CPWF 4G4XA 3S06A 1OAPA 1VQKF 1FNKA 4TV8A 5GIOC 5J2UB 4YJ2B 4U39A 4EB6B 3KJKA 1Z5WA 3I3FA 2KTVA 3EORA 3HKDB 4O2AB 3JAKA 2EWCA 3RYCA 3LWPC 1KD1H 2RHOA 1W42A 3S0WA 2Q1XA 5LA6B 4C8EA 3CMAF 5HY2A 4RHAA 4C4WC 4G4YA 1YITF 3N2KB 2OHWA 5CB4B 3JAKB 4BVSA 3K2XA 3HKBA 2LBTA 4IHJA 2CWJA 2I6RA 2HVYD 5GONA 4NQ3A 3KIZA 3VO8A 2AIFA 2K1SA 3D54A 4BT3A 4TV9A 1W55A 2GLZA 3SIUA 3C9SA 4X20A 3ZP4A 2YYEA 1X52A 1H7MA 1VQNF 4WBNA 4O2BB 1FFXB 3CYQA 3P0ZA 4RQOA 2UYNA 3ESJA 5JH7B 2YXZA 3WGKA 3J80M 1VQ8F 2VAWA 4F6RB 5HY1A 4IIJB 2CZWA 1KC8H 4I55B 1Q82H 4BT7A 4G88A 5IYZA 2HQSC 1GO1A 2VXYA 2H6LA 1W5FA 4EB6A 3JASB 3LDTA 1QVFF 1W57A 3NMUC 5IJ9A 3RYHB 2BTOA 1K9MH 3D00A 5FJ4C 4BVQA 3G4SF 3M1XA 3CCLF 1UI9A 3HTNA 4O4LB 4ZOLA 4KWEA 2ALEA 5IYZB 1VQLF 2V9YA 3CCRF 3K14A 5IT9M 1VQ5F 5G4UC 1W41A 3JAWB 3P10A 3HKCA 3F0GA 3JALB 3I56F 3RYFB 3VTIC 5IJ0B 1VHAA 3BYQA 3TD5A 4TZZA 5LP6C 2Z01A 3J7AR 3WJPA 3TD3A 5J2TA 1QVGF 3CD6F 1VQVA 5HY4A 4I55A 3IMPA 2KTUA 3F6MA 3F0DA 1KNKA 5LA6A 3RA6A 1CN7A 5HP8A 4O4HB 5C8YB 3RYCB 2BTQB 3I7TA 3AGKA 3ERNA 1W5BA 2CHSA 5KMGB 3E22B 3GHZA 3WPXA 4B62A 5J2UA 3SIVA 2Q1YA 3RYIA 2ZF8A 1X7PA 3HKBB 2LBXA 2L26A 3QHDA 4YJ3A 4BT2A 3LWRC 3CCEF 3JCMM 3HJWC 3M4SA 3LWOC 3V7EA 1TVKA 4X1KB 3RA5A 2WALA 2CSLA 2UZHA 2JNBA 3CCSF 5EAZA 2IQQA 3VYSC 3WJRA 1DBFA 3F0FA 2Z1TA 1COMA 3HKDA 2OTLF 3HKEA 5CA0A 4R40B 5EIBC 4U3JA 4DRXA 4EI8A 5JQGA 5KX5B 1YJWF 2IAFA 3IEQA 3MCAB 3VIUA 3UT5B 3WGJA 2RHJA 1GZ0A 2W8BC 1IV4A 5LYJB 3ON1A 3FD5A 3GTZA 1U43A 2PHNA 5LOVB 1H48A 2HRUA 1W3EX 3WXMB 3L7QA 4FFBB 3D01A 2H8CA 1M1KH 1VQ7F 3NVIB 1XBIA 3KHNA 5BMVB 2Z1UA 2LCAA 3V7QA 4G4ZA 2MQEA 5EZYA 3J81M 2HS4A 4X1KA 2OTJF 4B46A 4E6EA 1VQOF 2LBWA 5AVMA 4O2AA 3VOBA 1K73H 1VK3A 4C8GA 1W40A 3ZP7A 3QUWA 2UYNB 2ZVZA 1PXWA 3NK6A 4FFBA 5IJ9B 1JFFA 3CCVF 3PLAC 2QTPA 5MN4A 4G4VA 1ODEA 3R0PA 4X1YB 3JASA 1OFUA 3E22A 1XV2A 5CA1A 1J7HA 2CVLA 5JVDB 1U3LA 4BT5A 3CCUF 3K0TA 5MN5A 3WGMA 2QA4F 4M8IA 5EIBD 5EZYB 4LCKA 1YI2F 4O4IB 1Q8RA 5MN6A 3LWVC 1CLIA 2H8EA 4BVRA 5JQGB 3JAMM 3E20B 3U0OA 1VQPF 2CHTA 1XRGA 1IV3A 2VGMA 5EYPB 3NK7A 1CK2A 3WGLA 2Z1EA 4ZK7A 3S03A 4I50B 4WBNB 3HKCB 1H47A 5LOVA 4BVTA 3MBMA 3IKEA 4X20B 5JCOA 1W581 4O4LA 4B45A 4F6RA 2B33A 3CG6A 3OONA 3C8LA 2ZOVA 1JJ2F 2ZAUA 3CCQF 1QU9A 1T0AA 4LNUB 3C9TA 5FNVB 3ZO8A 5JCOC 2R6R1 5ITZA 1RQ2A 1YQNA 1IV2A
chains in the Genus database with same CATH topology
3JCMM 3LWPC 3HJWC 3CC2F 3LWOC 1S72F 1W2BF 1Q81H 1KD1H 1W42A 3OBYA 3V7EA 3RA5A 2WALA 3CMAF 3NVKE 1RLGA 2KG4A 3N4YA 2JNBA 5HY2A 3CCSF 3CCMF 4C4WC 1YITF 2OHWA 5EO3A 3G6EF 4EI9A 3E1YA 3CMEF 2OTLF 2FGYA 3O85A 4BVSA 2VGNA 3GYQA 3OW2F 1YHQF 4EI8A 3VI6A 5GAPK 2HVYD 1YJWF 3CC7F 4NQ3A 2AIFA 3MCAB 3LWQC 1K8AH 2QI2A 4BW0B 1GZ0A 1E7KA 2GLZA 3SIUA 3ON1A 1X52A 1ZWZA 1H7MA 1M90H 1VQNF 4NUTA 4X3LA 4XCQA 1W3EX 3WXMB 1VQMF 1T0KB 1M1KH 1VQ7F 3NVIB 1XBIA 1X7OA 4BY9D 4EI7A 3J80M 1VQ8F 3V7QA 4X3MA 5HY1A 1Q7YH 2CZWA 5GIPC 3J81M 1KC8H 1Q82H 1NJIH 3CXCF 1VQ4F 1VQ9F 2OTJF 1VQOF 1SDSA 2LBWA 1GO1A 5HXUA 2QEXF 1K73H 3V3TA 2FC3A 1W40A 1QVFF 3G71F 3NMUC 1PXWA 3NK6A 5HY0A 1N8RH 1Q86H 5DCVA 5G4VC 3CCVF 1VQ6F 3PLAC 1K9MH 5FLXM 3CCJF 2BO1A 3D00A 3FFMA 5HXZA 5FJ4C 4BVQA 5A2QM 3G4SF 3N4ZA 3CCLF 1IPAA 2ALEA 3CCUF 1VQLF 5HWEA 3CCRF 2QA4F 4LCKA 5EWRA 5IT9M 1VQ5F 3PAFA 1YI2F 1NMUB 1W41A 5G4UC 3LWVC 3I56F 3LFOA 4BVRA 1GO0A 2I6DA 5GINC 3JAMM 5GANK 2F9ZC 3E20B 1VQPF 1YJ9F 1RA4A 4TZZA 1YJNF 2VGMA 3J7AR 3VMFB 3NK7A 1CK2A 3CPQA 1QVGF 3CD6F 5HY4A 1YIJF 2KTUA 4BVTA 3IR9A 3RA6A 3I55F 2OZBA 1KQSF 1CN7A 3CG6A 3AGKA 1JJ2F 3CPWF 3CCQF 3HAXD 3CC4F 3SIVA 3OBWA 1VQKF 5GIOC 1X7PA 1DT9A 2LBXA 2KTVA 3CCEF 3LWRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM M;  3LWP C;  3HJW C;  3CC2 F;  3LWO C;  1S72 F;  1W2B F;  1Q81 H;  1KD1 H;  1W42 A;  3OBY A;  3V7E A;  3RA5 A;  2WAL A;  3CMA F;  3NVK E;  1RLG A;  2KG4 A;  3N4Y A;  2JNB A;  3CCS F;  3CCM F;  4C4W C;  1YIT F;  2OHW A;  5EO3 A;  3G6E F;  3E1Y A;  3CME F;  2OTL F;  3O85 A;  2VGN A;  3GYQ A;  3OW2 F;  1YHQ F;  3VI6 A;  5GAP K;  2HVY D;  1YJW F;  3CC7 F;  2AIF A;  3MCA B;  3LWQ C;  1K8A H;  2QI2 A;  4BW0 B;  1GZ0 A;  1E7K A;  3SIU A;  3ON1 A;  1X52 A;  1ZWZ A;  1H7M A;  1M90 H;  1VQN F;  4NUT A;  4X3L A;  1W3E X;  3WXM B;  1VQM F;  1T0K B;  1M1K H;  1VQ7 F;  3NVI B;  1XBI A;  1X7O A;  4BY9 D;  3J80 M;  1VQ8 F;  3V7Q A;  4X3M A;  1Q7Y H;  2CZW A;  5GIP C;  3J81 M;  1KC8 H;  1Q82 H;  1NJI H;  3CXC F;  1VQ4 F;  1VQ9 F;  2OTJ F;  1VQO F;  1SDS A;  2LBW A;  1GO1 A;  2QEX F;  1K73 H;  2FC3 A;  1W40 A;  1QVF F;  3G71 F;  3NMU C;  1PXW A;  3NK6 A;  1N8R H;  1Q86 H;  5DCV A;  5G4V C;  3CCV F;  1VQ6 F;  3PLA C;  1K9M H;  5FLX M;  3CCJ F;  2BO1 A;  3FFM A;  5FJ4 C;  5A2Q M;  3G4S F;  3N4Z A;  3CCL F;  1IPA A;  2ALE A;  3CCU F;  1VQL F;  3CCR F;  2QA4 F;  4LCK A;  5EWR A;  5IT9 M;  1VQ5 F;  3PAF A;  1YI2 F;  1NMU B;  1W41 A;  5G4U C;  3LWV C;  3I56 F;  3LFO A;  1GO0 A;  2I6D A;  5GIN C;  3JAM M;  5GAN K;  3E20 B;  1VQP F;  1YJ9 F;  1RA4 A;  4TZZ A;  1YJN F;  2VGM A;  3J7A R;  3VMF B;  3NK7 A;  1CK2 A;  3CPQ A;  1QVG F;  3CD6 F;  1YIJ F;  2KTU A;  3IR9 A;  3RA6 A;  3I55 F;  2OZB A;  1KQS F;  1CN7 A;  3CG6 A;  3AGK A;  1JJ2 F;  3CPW F;  3CCQ F;  3HAX D;  3CC4 F;  3SIV A;  3OBW A;  1VQK F;  5GIO C;  1X7P A;  1DT9 A;  2LBX A;  2KTV A;  3CCE F;  3LWR C; 
#chains in the Genus database with same CATH topology
 3CC2 F;  1S72 F;  3OBY A;  1RLG A;  2KG4 A;  3N4Y A;  4O4J B;  4PWT A;  2VAP A;  3KE1 A;  3G6E F;  4EI9 A;  2RHH A;  3O85 A;  2VGN A;  3JAR A;  3OW2 F;  4B5C A;  4ZHW A;  4TUY A;  2HX0 A;  3VI6 A;  5GAP K;  3IKF A;  4O2B A;  2HRY A;  3LWQ C;  3FPI A;  3CYP B;  3MQW A;  2QI2 A;  1RLU A;  4BW0 B;  1E7K A;  3K12 A;  4O4H A;  5HP7 A;  5LYJ A;  3FD6 A;  3ELC A;  4YJ3 B;  1IV1 A;  1QD9 A;  5EB0 A;  4NUT A;  4X3L A;  4XCQ A;  2ZOD A;  3KJJ A;  1VH8 A;  5LP6 A;  1JN1 A;  4U3J B;  4DRX B;  1VQM F;  3ZOP A;  1T0K B;  1W59 A;  4ZHY B;  4I4T B;  4ZI7 B;  4C8I A;  1X7O A;  1GX1 A;  4C81 A;  4C82 A;  1Z5V A;  2BTU A;  2DT4 A;  1NJI H;  1VQ9 F;  1X25 A;  3VYT C;  1SDS A;  4I50 A;  5HXU A;  5J2T B;  2P6Y A;  2ZVY A;  2OTM A;  3V3T A;  4I4T A;  3G71 F;  3RYI B;  5HY0 A;  4TV8 B;  1N8R H;  5G4V C;  1VQ6 F;  1R1M A;  3M84 A;  5FLX M;  3CCJ F;  2BO1 A;  3F0E A;  3JAW A;  3N2G B;  5KMG A;  3C9U A;  5A2Q M;  2PMP A;  4X1I A;  3T80 A;  3LYB A;  5EWR A;  3UT5 A;  3WPW A;  3LFO A;  4NWO B;  2AIZ P;  5GIN C;  3IEW A;  2F9Z C;  5GAN K;  5BMV A;  1RA4 A;  2N48 A;  1YJ9 F;  4ZI7 A;  5CA0 B;  4G4W A;  3VMF B;  3DDN A;  3CPQ A;  2GZL A;  3RYF A;  3Q8H A;  5IJ0 A;  2R75 1;  3MCQ A;  1YIJ F;  2DYY A;  3B6N A;  4IIJ A;  3JAT B;  1UFY A;  3IR9 A;  2AMT A;  3I55 F;  5JVD A;  3WJQ A;  3DC2 A;  4TV9 B;  4ZHV A;  3HAX D;  1TUB A;  5LXT A;  3WGN A;  3CC4 F;  4X1Y A;  2UYP A;  1SZQ A;  3OBW A;  5KX5 A;  2HP3 A;  1SA0 B;  4TUY B;  1FNJ A;  1DT9 A;  1KNJ A;  4BT4 A;  4HNA A;  3N2K A;  1W2B F;  1Q81 H;  4BT6 A;  4DXD A;  3JAT A;  3NVK E;  1PF5 A;  2RHL A;  2Z1F A;  4ZHQ A;  3CCM F;  1ONI A;  2HS3 A;  5EO3 A;  3E1Y A;  5JH7 A;  3CME F;  2FGY A;  4IHJ B;  3GYQ A;  3JAR B;  3V4D A;  3S0Y A;  1YHQ F;  3C9R A;  3QTY A;  3S02 A;  3CC7 F;  2VAM A;  4LNU A;  5EB1 B;  1FSZ A;  1TUB B;  3CB2 A;  4ZHQ B;  1K8A H;  3P4E A;  1NQ3 A;  2RB9 A;  5CA1 B;  3N2G A;  1ZWZ A;  1JY8 A;  5ITZ B;  1M90 H;  1SA0 A;  2GVI A;  5FNV A;  3VOA A;  2IG8 A;  5EYP A;  3HKE B;  2CW4 A;  4BY9 D;  4EI7 A;  4X3M A;  1Q7Y H;  4O4J A;  5GIP C;  2NMU A;  3MDO A;  1VQ4 F;  3CXC F;  1W5E A;  3LME A;  4X1I B;  4HNA B;  1U40 A;  2QEX F;  2G9I A;  2HP0 B;  3RE3 A;  2FC3 A;  1JD1 A;  3TD4 A;  1RQ7 A;  4YJ2 A;  3S0H A;  1JFF B;  2UYK A;  3RYH A;  5LP6 B;  3FBA A;  1Q86 H;  5DCV A;  1YGY A;  3JAL A;  3FFM A;  4O4I A;  5HXZ A;  5LXT B;  2HP0 A;  2UYJ A;  3N4Z A;  1IPA A;  4ZOL B;  5C8Y A;  5HWE A;  3VCZ A;  3VYU C;  3HWU A;  3PAF A;  1NMU B;  1GO0 A;  5GON B;  2I6D A;  1YJN F;  1QAH A;  1W5A A;  2KGW A;  1U3P A;  5CB4 A;  1FFX A;  4ERH A;  5B8F A;  3JVH A;  1TVK B;  2OZB A;  1KQS F;  1XHO A;  2HS0 A;  3CPW F;  4G4X A;  3S06 A;  1OAP A;  1VQK F;  1FNK A;  4TV8 A;  5GIO C;  5J2U B;  4YJ2 B;  4U39 A;  4EB6 B;  3KJK A;  1Z5W A;  3I3F A;  2KTV A;  3EOR A;  3HKD B;  4O2A B;  3JAK A;  2EWC A;  3RYC A;  3LWP C;  1KD1 H;  2RHO A;  1W42 A;  3S0W A;  2Q1X A;  5LA6 B;  4C8E A;  3CMA F;  5HY2 A;  4RHA A;  4C4W C;  4G4Y A;  1YIT F;  3N2K B;  2OHW A;  5CB4 B;  3JAK B;  4BVS A;  3K2X A;  3HKB A;  2LBT A;  4IHJ A;  2CWJ A;  2I6R A;  2HVY D;  5GON A;  4NQ3 A;  3KIZ A;  3VO8 A;  2AIF A;  2K1S A;  3D54 A;  4BT3 A;  4TV9 A;  1W55 A;  2GLZ A;  3SIU A;  3C9S A;  4X20 A;  3ZP4 A;  2YYE A;  1X52 A;  1H7M A;  1VQN F;  4WBN A;  4O2B B;  1FFX B;  3CYQ A;  3P0Z A;  4RQO A;  2UYN A;  3ESJ A;  5JH7 B;  2YXZ A;  3WGK A;  3J80 M;  1VQ8 F;  2VAW A;  4F6R B;  5HY1 A;  4IIJ B;  2CZW A;  1KC8 H;  4I55 B;  1Q82 H;  4BT7 A;  4G88 A;  5IYZ A;  2HQS C;  1GO1 A;  2VXY A;  2H6L A;  1W5F A;  4EB6 A;  3JAS B;  3LDT A;  1QVF F;  1W57 A;  3NMU C;  5IJ9 A;  3RYH B;  2BTO A;  1K9M H;  3D00 A;  5FJ4 C;  4BVQ A;  3G4S F;  3M1X A;  3CCL F;  1UI9 A;  3HTN A;  4O4L B;  4ZOL A;  4KWE A;  2ALE A;  5IYZ B;  1VQL F;  2V9Y A;  3CCR F;  3K14 A;  5IT9 M;  1VQ5 F;  5G4U C;  1W41 A;  3JAW B;  3P10 A;  3HKC A;  3F0G A;  3JAL B;  3I56 F;  3RYF B;  3VTI C;  5IJ0 B;  1VHA A;  3BYQ A;  3TD5 A;  4TZZ A;  5LP6 C;  2Z01 A;  3J7A R;  3WJP A;  3TD3 A;  5J2T A;  1QVG F;  3CD6 F;  1VQV A;  5HY4 A;  4I55 A;  3IMP A;  2KTU A;  3F6M A;  3F0D A;  1KNK A;  5LA6 A;  3RA6 A;  1CN7 A;  5HP8 A;  4O4H B;  5C8Y B;  3RYC B;  2BTQ B;  3I7T A;  3AGK A;  3ERN A;  1W5B A;  2CHS A;  5KMG B;  3E22 B;  3GHZ A;  3WPX A;  4B62 A;  5J2U A;  3SIV A;  2Q1Y A;  3RYI A;  2ZF8 A;  1X7P A;  3HKB B;  2LBX A;  2L26 A;  3QHD A;  4YJ3 A;  4BT2 A;  3LWR C;  3CCE F;  3JCM M;  3HJW C;  3M4S A;  3LWO C;  3V7E A;  1TVK A;  4X1K B;  3RA5 A;  2WAL A;  2CSL A;  2UZH A;  2JNB A;  3CCS F;  5EAZ A;  2IQQ A;  3VYS C;  3WJR A;  1DBF A;  3F0F A;  2Z1T A;  1COM A;  3HKD A;  2OTL F;  3HKE A;  5CA0 A;  4R40 B;  5EIB C;  4U3J A;  4DRX A;  4EI8 A;  5JQG A;  5KX5 B;  1YJW F;  2IAF A;  3IEQ A;  3MCA B;  3VIU A;  3UT5 B;  3WGJ A;  2RHJ A;  1GZ0 A;  2W8B C;  1IV4 A;  5LYJ B;  3ON1 A;  3FD5 A;  3GTZ A;  1U43 A;  2PHN A;  5LOV B;  1H48 A;  2HRU A;  1W3E X;  3WXM B;  3L7Q A;  4FFB B;  3D01 A;  2H8C A;  1M1K H;  1VQ7 F;  3NVI B;  1XBI A;  3KHN A;  5BMV B;  2Z1U A;  2LCA A;  3V7Q A;  4G4Z A;  2MQE A;  5EZY A;  3J81 M;  2HS4 A;  4X1K A;  2OTJ F;  4B46 A;  4E6E A;  1VQO F;  2LBW A;  5AVM A;  4O2A A;  3VOB A;  1K73 H;  1VK3 A;  4C8G A;  1W40 A;  3ZP7 A;  3QUW A;  2UYN B;  2ZVZ A;  1PXW A;  3NK6 A;  4FFB A;  5IJ9 B;  1JFF A;  3CCV F;  3PLA C;  2QTP A;  5MN4 A;  4G4V A;  1ODE A;  3R0P A;  4X1Y B;  3JAS A;  1OFU A;  3E22 A;  1XV2 A;  5CA1 A;  1J7H A;  2CVL A;  5JVD B;  1U3L A;  4BT5 A;  3CCU F;  3K0T A;  5MN5 A;  3WGM A;  2QA4 F;  4M8I A;  5EIB D;  5EZY B;  4LCK A;  1YI2 F;  4O4I B;  1Q8R A;  5MN6 A;  3LWV C;  1CLI A;  2H8E A;  4BVR A;  5JQG B;  3JAM M;  3E20 B;  3U0O A;  1VQP F;  2CHT A;  1XRG A;  1IV3 A;  2VGM A;  5EYP B;  3NK7 A;  1CK2 A;  3WGL A;  2Z1E A;  4ZK7 A;  3S03 A;  4I50 B;  4WBN B;  3HKC B;  1H47 A;  5LOV A;  4BVT A;  3MBM A;  3IKE A;  4X20 B;  5JCO A;  1W58 1;  4O4L A;  4B45 A;  4F6R A;  2B33 A;  3CG6 A;  3OON A;  3C8L A;  2ZOV A;  1JJ2 F;  2ZAU A;  3CCQ F;  1QU9 A;  1T0A A;  4LNU B;  3C9T A;  5FNV B;  3ZO8 A;  5JCO C;  2R6R 1;  5ITZ A;  1RQ2 A;  1YQN A;  1IV2 A; 
#chains in the Genus database with same CATH homology
 3JCM M;  3LWP C;  3HJW C;  3CC2 F;  3LWO C;  1S72 F;  1W2B F;  1Q81 H;  1KD1 H;  1W42 A;  3OBY A;  3V7E A;  3RA5 A;  2WAL A;  3CMA F;  3NVK E;  1RLG A;  2KG4 A;  3N4Y A;  2JNB A;  5HY2 A;  3CCS F;  3CCM F;  4C4W C;  1YIT F;  2OHW A;  5EO3 A;  3G6E F;  4EI9 A;  3E1Y A;  3CME F;  2OTL F;  2FGY A;  3O85 A;  4BVS A;  2VGN A;  3GYQ A;  3OW2 F;  1YHQ F;  4EI8 A;  3VI6 A;  5GAP K;  2HVY D;  1YJW F;  3CC7 F;  4NQ3 A;  2AIF A;  3MCA B;  3LWQ C;  1K8A H;  2QI2 A;  4BW0 B;  1GZ0 A;  1E7K A;  2GLZ A;  3SIU A;  3ON1 A;  1X52 A;  1ZWZ A;  1H7M A;  1M90 H;  1VQN F;  4NUT A;  4X3L A;  4XCQ A;  1W3E X;  3WXM B;  1VQM F;  1T0K B;  1M1K H;  1VQ7 F;  3NVI B;  1XBI A;  1X7O A;  4BY9 D;  4EI7 A;  3J80 M;  1VQ8 F;  3V7Q A;  4X3M A;  5HY1 A;  1Q7Y H;  2CZW A;  5GIP C;  3J81 M;  1KC8 H;  1Q82 H;  1NJI H;  3CXC F;  1VQ4 F;  1VQ9 F;  2OTJ F;  1VQO F;  1SDS A;  2LBW A;  1GO1 A;  5HXU A;  2QEX F;  1K73 H;  3V3T A;  2FC3 A;  1W40 A;  1QVF F;  3G71 F;  3NMU C;  1PXW A;  3NK6 A;  5HY0 A;  1N8R H;  1Q86 H;  5DCV A;  5G4V C;  3CCV F;  1VQ6 F;  3PLA C;  1K9M H;  5FLX M;  3CCJ F;  2BO1 A;  3D00 A;  3FFM A;  5HXZ A;  5FJ4 C;  4BVQ A;  5A2Q M;  3G4S F;  3N4Z A;  3CCL F;  1IPA A;  2ALE A;  3CCU F;  1VQL F;  5HWE A;  3CCR F;  2QA4 F;  4LCK A;  5EWR A;  5IT9 M;  1VQ5 F;  3PAF A;  1YI2 F;  1NMU B;  1W41 A;  5G4U C;  3LWV C;  3I56 F;  3LFO A;  4BVR A;  1GO0 A;  2I6D A;  5GIN C;  3JAM M;  5GAN K;  2F9Z C;  3E20 B;  1VQP F;  1YJ9 F;  1RA4 A;  4TZZ A;  1YJN F;  2VGM A;  3J7A R;  3VMF B;  3NK7 A;  1CK2 A;  3CPQ A;  1QVG F;  3CD6 F;  5HY4 A;  1YIJ F;  2KTU A;  4BVT A;  3IR9 A;  3RA6 A;  3I55 F;  2OZB A;  1KQS F;  1CN7 A;  3CG6 A;  3AGK A;  1JJ2 F;  3CPW F;  3CCQ F;  3HAX D;  3CC4 F;  3SIV A;  3OBW A;  1VQK F;  5GIO C;  1X7P A;  1DT9 A;  2LBX A;  2KTV A;  3CCE F;  3LWR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...