3NVKE

Structural basis for substrate placement by an archaeal box c/d ribonucleoprotein particle
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 22
structure length 121
sequence length 121
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nvkE00
2KG4A 1ZWZA 1KD1H 2FC3A 1VQPF 4X3MA 1S72F 3SIVA 1M1KH 2LBXA 2ALEA 1VQ5F 1VQKF 1T0KB 1W41A 3CCVF 3CCUF 4X3LA 1VQ7F 5GANK 3NVKE 2HVYD 1YJNF 1KC8H 3CCQF 1X52A 2AIFA 3HJWC 3CG6A 3CD6F 4LCKA 1NMUB 3OBWA 5GAPK 1Q86H 5IT9M 2BO1A 3CCEF 1PXWA 1YITF 1W2BF 3N4YA 1K9MH 3VI6A 3O85A 4C4WC 3ON1A 1VQ8F 3J80M 1W3EX 1IPAA 1YJWF 3CCSF 3RA5A 5GIOC 3OW2F 3LWOC 1K8AH 1W42A 1E7KA 1VQ4F 1DT9A 3PAFA 1QVFF 2KTUA 1N8RH 3MCAB 3N4ZA 4TZZA 3CMAF 5GINC 1Q82H 1GO1A 3AGKA 2QA4F 1YI2F 2QEXF 3LWVC 3V7QA 3CPQA 2QI2A 3I55F 1K73H 1JJ2F 1KQSF 3CC2F 3JCMM 3CCRF 5DCVA 1X7PA 3NK7A 3CCMF 3V7EA 1QVGF 1XBIA 3NVIB 3E1YA 3CMEF 1NJIH 5EO3A 3LWQC 2WALA 2I6DA 5G4VC 3LWPC 4NUTA 1YIJF 4BW0B 1YJ9F 3E20B 2CZWA 1CN7A 1VQ6F 3GYQA 3FFMA 3NK6A 1VQMF 5FJ4C 3LWRC 3CCLF 1Q81H 5GIPC 2OTLF 1VQ9F 2OHWA 3J81M 3CC7F 2VGMA 1H7MA 3G6EF 2OTJF 1GO0A 1CK2A 3CPWF 3G4SF 3VMFB 1VQNF 3I56F 3CC4F 3WXMB 1RA4A 3CCJF 2JNBA 3SIUA 1Q7YH 5A2QM 5EWRA 2KTVA 3OBYA 3HAXD 2VGNA 3RA6A 1X7OA 3LFOA 1VQLF 1RLGA 4BY9D 5FLXM 1M90H 1GZ0A 2OZBA 3CXCF 3JAMM 1VQOF 3IR9A 2LBWA 3G71F 3PLAC 5G4UC 1W40A 3NMUC 1YHQF 1SDSA 3J7AR
chains in the Genus database with same CATH superfamily
2KG4A 3S0WA 3RYIB 5GONB 4X3MA 4X20B 2DT4A 5EB0A 1S72F 2MQEA 2ALEA 1QAHA 1W41A 3CCVF 1VQ7F 3M4SA 5AVMA 3CCQF 5IYZB 3M1XA 3HJWC 3CG6A 3CD6F 5IT9M 4XCQA 2GZLA 3JAWB 3JASA 1W2BF 1FFXA 3K12A 2UYPA 3VI6A 3O85A 1VQ8F 1IPAA 3CCSF 3RA5A 3IKEA 5GIOC 3UT5B 3LWOC 1W42A 4C8IA 1E7KA 3KHNA 2V9YA 3HKEB 1VH8A 4F6RA 2IAFA 3KJKA 3F0EA 2OTMA 2VAWA 1XV2A 4ZHVA 2RB9A 4ZOLA 1ODEA 3N4ZA 1XHOA 2RHLA 5GINC 3VO8A 3ZP7A 3AGKA 1W55A 2QEXF 4TUYB 3ZO8A 2HP0B 3CPQA 3FPIA 4B5CA 2EWCA 1KQSF 3CC2F 3I3FA 2BTUA 1FNKA 1Z5VA 1YQNA 4M8IA 4C8EA 5EB1B 1TUBA 3HKBA 3E1YA 3RYCA 5EO3A 5LOVA 3WJQA 3LWQC 4C81A 3KJJA 2I6DA 1YGYA 3JATA 4C82A 4U3JA 2HS4A 5J2UA 4YJ2A 1JFFB 2HS0A 2L26A 2R751 3FFMA 3NK6A 1CLIA 3CCLF 1Q81H 2OHWA 3G6EF 1H7MA 2UYKA 1GO0A 1CK2A 3CPWF 3I56F 3WXMB 1RA4A 2HP3A 3GTZA 1TVKB 5KX5B 4EB6A 3JAKB 4X1IA 4ZHWA 5ITZB 5J2TB 4DRXA 2DYYA 2CVLA 3HAXD 3RA6A 5LXTB 3F6MA 1X7OA 2UZHA 4X1YB 1M90H 3RYIA 4C8GA 1FNJA 1IV3A 2K1SA 3E22B 3JARA 3G71F 5LYJA 1T0AA 4I50B 5G4UC 5CA0A 1J7HA 3JALB 5LP6B 3C9RA 1RQ2A 2LBXA 1T0KB 1VQ5F 3QHDA 3IEWA 3CCUF 4X3LA 2CWJA 2UYNB 4G88A 3NVKE 3RYFA 4HNAA 1KC8H 3RYHA 1X52A 5JQGB 4EI8A 5EYPA 3CCEF 1YITF 1RLUA 5HY2A 3N4YA 1NQ3A 1K9MH 4FFBA 2G9IA 3WGNA 3CYPB 4ERHA 1U3PA 3OW2F 1K8AH 4O2AA 2NMUA 4O4IA 5JVDB 3L7QA 3N2KA 3PAFA 5KMGA 3HKCA 4BT6A 4EI7A 5JH7A 1N8RH 4TV9B 3TD3A 1GO1A 5CA1B 2QA4F 4X1KB 3LWVC 5LA6A 2RHJA 1W5EA 5HY1A 3S03A 2UYJA 4TV8A 3WGMA 2YYEA 5BMVA 1W59A 2QI2A 3IEQA 3I55F 2HQSC 4YJ3B 4ZI7B 4IHJA 3JCMM 4ZHYB 3ERNA 4O4JB 4IIJA 5CB4B 1XRGA 4O4HB 3NK7A 2PHNA 1QVGF 3NVIB 1ONIA 3P4EA 4NWOB 4NQ3A 1KNKA 4BT5A 3HKDA 3FBAA 2Q1YA 1W57A 4G4YA 5IJ0A 2Z01A 1QU9A 2QTPA 4G4WA 1X25A 4I55A 3WGKA 3D54A 4B45A 2AIZP 4BVSA 3CC7F 3QUWA 4O2BA 5IJ9B 3F0GA 3G4SF 1VQNF 3N2GB 3K0TA 3V4DA 4WBNB 3WPXA 5HY0A 2IQQA 4ZHQB 4LNUB 3P0ZA 2PMPA 4B46A 5HWEA 2KTVA 5EZYA 3K2XA 2HRYA 2VGNA 3IKFA 1RLGA 2ZOVA 5FLXM 3B6NA 1GZ0A 2OZBA 3C9SA 3S0YA 1U3LA 4BVRA 4I4TA 1SA0A 1W5FA 4BVQA 4O4LB 1YHQF 2AMTA 1SDSA 5LP6C 3JASB 2ZVYA 1KD1H 5EIBC 1IV2A 3RE3A 3SIVA 1FFXB 4G4XA 4G4VA 1VQKF 1VK3A 5GANK 3C9UA 3LMEA 2HVYD 5FNVA 2Z1TA 3VCZA 5HXUA 4LCKA 1JN1A 5EAZA 4F6RB 1NMUB 3OBWA 1Q86H 1U40A 5C8YA 2GVIA 3VTIC 5GONA 5MN4A 3QTYA 4X20A 4ZOLB 2VXYA 3KE1A 4C4WC 3ON1A 3K14A 3MCQA 1YJWF 5IYZA 3P10A 1H47A 4X1KA 1DT9A 1QVFF 3U0OA 3JAWA 3HKBB 3RYCB 3Q8HA 1UFYA 5LOVB 3CMAF 2H8EA 1YI2F 2H6LA 3S02A 2I6RA 3JATB 3WGJA 4U3JB 3CB2A 5J2UB 2Q1XA 4YJ2B 3V7QA 5HP7A 2YXZA 3UT5A 2H8CA 1JJ2F 4KWEA 2ZODA 3HKEA 1KNJA 3CCRF 5DCVA 5JCOC 3WPWA 3MDOA 3CCMF 3V7EA 3C9TA 3CMEF 4DXDA 3IMPA 5G4VC 3ELCA 4TUYA 1RQ7A 3VOBA 2HP0A 1YJ9F 2CSLA 3F0FA 4U39A 5MN5A 4EB6B 4X1IB 2B33A 1VQMF 3LWRC 2IG8A 4BT7A 4DRXB 2FGYA 3M84A 3C8LA 2ZVZA 2Z1EA 1OAPA 1JD1A 4BT3A 4EI9A 2F9ZC 3CC4F 2CHTA 5HY4A 3JARB 3KIZA 2JNBA 2CW4A 4E6EA 5LYJB 5CA0B 1IV4A 1JFFA 2HRUA 1Q7YH 1SZQA 2Z1FA 3OBYA 3ESJA 1FSZA 4O4LA 4BVTA 1VQLF 3RYFB 4HNAB 3RYHB 1TVKA 3IR9A 5KX5A 3HWUA 4B62A 3VYUC 3JAKA 5EYPB 3NMUC 3J7AR 5ITZA 5J2TA 1ZWZA 3I7TA 3V3TA 2FC3A 2RHHA 1VQPF 4FFBB 1M1KH 5LXTA 4RHAA 3VIUA 3BYQA 1JY8A 1W5AA 3MBMA 3JVHA 4X1YA 5MN6A 2N48A 1YJNF 3E22A 1Z5WA 4BT2A 2AIFA 4O2AB 4O4IB 3S06A 3LYBA 3WGLA 3ZP4A 5GAPK 4I50A 2BO1A 3JALA 3N2KB 5KMGB 1PF5A 1PXWA 3HKCB 3F0DA 5JH7B 4ZK7A 5LP6A 3MQWA 3TD4A 3FD6A 1H48A 2P6YA 1W3EX 1VHAA 5LA6B 3J80M 3EORA 4TV8B 5BMVB 2UYNA 1VQVA 4IHJB 5JQGA 4IIJB 4PWTA 2HX0A 3FD5A 1VQ4F 5EIBD 2KTUA 3OONA 4R40B 3MCAB 4TZZA 1Q82H 2RHOA 2BTQB 3LDTA 3WJRA 4G4ZA 3HKDB 2W8BC 3TD5A 2GLZA 3R0PA 1U43A 5IJ0B 1K73H 2LBTA 4I55B 4RQOA 3VOAA 1X7PA 5JVDA 3D00A 5HP8A 3DC2A 1XBIA 2ZAUA 3VYTC 2KGWA 1NJIH 4O2BB 3GHZA 2WALA 4TV9A 5CA1A 1QD9A 3S0HA 5HXZA 3LWPC 4NUTA 1UI9A 1YIJF 4BW0B 1TUBB 2Z1UA 3VYSC 3E20B 2CZWA 4BT4A 1CN7A 4YJ3A 1VQ6F 3GYQA 3DDNA 1IV1A 1GX1A 3ZOPA 4ZI7A 4O4JA 2HS3A 5FJ4C 5CB4A 2ZF8A 3HTNA 4O4HA 5GIPC 2OTLF 5EZYB 1VQ9F 5JCOA 3J81M 1Q8RA 2VAPA 2VGMA 2BTOA 3WJPA 2R6R1 2OTJF 2LCAA 3D01A 3VMFB 3CCJF 4I4TB 1SA0B 2CHSA 1COMA 3SIUA 1DBFA 5A2QM 5EWRA 2VAMA 5B8FA 3CYQA 3LFOA 1R1MA 4BY9D 5IJ9A 1OFUA 3N2GA 4ZHQA 3CXCF 5FNVB 3JAMM 4WBNA 1VQOF 2LBWA 3PLAC 1W581 3T80A 5C8YB 1W5BA 4LNUA 1W40A
chains in the Genus database with same CATH topology
2KG4A 1ZWZA 3V3TA 2FC3A 1VQPF 4X3MA 1KD1H 1S72F 3SIVA 1M1KH 2LBXA 2ALEA 1VQ5F 1VQKF 1T0KB 1W41A 3CCVF 3CCUF 4X3LA 1VQ7F 5GANK 3NVKE 2HVYD 5HXUA 1YJNF 1KC8H 3CCQF 1X52A 2AIFA 3HJWC 3CG6A 3CD6F 4LCKA 4EI8A 1NMUB 3OBWA 5GAPK 1Q86H 5IT9M 4XCQA 2BO1A 3CCEF 1PXWA 1YITF 1W2BF 5HY2A 3N4YA 1K9MH 3VI6A 3O85A 4C4WC 3ON1A 1VQ8F 3J80M 1W3EX 1IPAA 1YJWF 3CCSF 3RA5A 5GIOC 3OW2F 3LWOC 1K8AH 1W42A 1E7KA 1VQ4F 1DT9A 3PAFA 1QVFF 2KTUA 4EI7A 1N8RH 3MCAB 3N4ZA 4TZZA 3CMAF 5GINC 1Q82H 1GO1A 3AGKA 2QA4F 1YI2F 2QEXF 3LWVC 5HY1A 2GLZA 3V7QA 3CPQA 2QI2A 3I55F 1K73H 1JJ2F 1KQSF 3CC2F 3JCMM 3CCRF 5DCVA 1X7PA 3D00A 3NK7A 3CCMF 3V7EA 1QVGF 1XBIA 3NVIB 3E1YA 3CMEF 1NJIH 5EO3A 4NQ3A 3LWQC 2WALA 2I6DA 5G4VC 5HXZA 3LWPC 4NUTA 1YIJF 4BW0B 1YJ9F 3E20B 2CZWA 1CN7A 1VQ6F 3GYQA 3FFMA 3NK6A 1VQMF 5FJ4C 3LWRC 3CCLF 1Q81H 4BVSA 5GIPC 2FGYA 2OTLF 1VQ9F 2OHWA 3J81M 3CC7F 2VGMA 1H7MA 3G6EF 2OTJF 1GO0A 1CK2A 3CPWF 4EI9A 3G4SF 3VMFB 1VQNF 2F9ZC 3I56F 3CC4F 3WXMB 1RA4A 3CCJF 5HY4A 5HY0A 2JNBA 3SIUA 1Q7YH 5A2QM 5HWEA 5EWRA 2KTVA 3OBYA 3HAXD 2VGNA 3RA6A 1X7OA 3LFOA 4BVTA 1VQLF 1RLGA 4BY9D 5FLXM 1M90H 1GZ0A 2OZBA 3CXCF 4BVRA 3JAMM 1VQOF 4BVQA 3IR9A 2LBWA 3G71F 3PLAC 5G4UC 1W40A 3NMUC 1YHQF 1SDSA 3J7AR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  1ZWZ A;  1KD1 H;  2FC3 A;  1VQP F;  4X3M A;  1S72 F;  3SIV A;  1M1K H;  2LBX A;  2ALE A;  1VQ5 F;  1VQK F;  1T0K B;  1W41 A;  3CCV F;  3CCU F;  4X3L A;  1VQ7 F;  5GAN K;  3NVK E;  2HVY D;  1YJN F;  1KC8 H;  3CCQ F;  1X52 A;  2AIF A;  3HJW C;  3CG6 A;  3CD6 F;  4LCK A;  1NMU B;  3OBW A;  5GAP K;  1Q86 H;  5IT9 M;  2BO1 A;  3CCE F;  1PXW A;  1YIT F;  1W2B F;  3N4Y A;  1K9M H;  3VI6 A;  3O85 A;  4C4W C;  3ON1 A;  1VQ8 F;  3J80 M;  1W3E X;  1IPA A;  1YJW F;  3CCS F;  3RA5 A;  5GIO C;  3OW2 F;  3LWO C;  1K8A H;  1W42 A;  1E7K A;  1VQ4 F;  1DT9 A;  3PAF A;  1QVF F;  2KTU A;  1N8R H;  3MCA B;  3N4Z A;  4TZZ A;  3CMA F;  5GIN C;  1Q82 H;  1GO1 A;  3AGK A;  2QA4 F;  1YI2 F;  2QEX F;  3LWV C;  3V7Q A;  3CPQ A;  2QI2 A;  3I55 F;  1K73 H;  1JJ2 F;  1KQS F;  3CC2 F;  3JCM M;  3CCR F;  5DCV A;  1X7P A;  3NK7 A;  3CCM F;  3V7E A;  1QVG F;  1XBI A;  3NVI B;  3E1Y A;  3CME F;  1NJI H;  5EO3 A;  3LWQ C;  2WAL A;  2I6D A;  5G4V C;  3LWP C;  4NUT A;  1YIJ F;  4BW0 B;  1YJ9 F;  3E20 B;  2CZW A;  1CN7 A;  1VQ6 F;  3GYQ A;  3FFM A;  3NK6 A;  1VQM F;  5FJ4 C;  3LWR C;  3CCL F;  1Q81 H;  5GIP C;  2OTL F;  1VQ9 F;  2OHW A;  3J81 M;  3CC7 F;  2VGM A;  1H7M A;  3G6E F;  2OTJ F;  1GO0 A;  1CK2 A;  3CPW F;  3G4S F;  3VMF B;  1VQN F;  3I56 F;  3CC4 F;  3WXM B;  1RA4 A;  3CCJ F;  2JNB A;  3SIU A;  1Q7Y H;  5A2Q M;  5EWR A;  2KTV A;  3OBY A;  3HAX D;  2VGN A;  3RA6 A;  1X7O A;  3LFO A;  1VQL F;  1RLG A;  4BY9 D;  5FLX M;  1M90 H;  1GZ0 A;  2OZB A;  3CXC F;  3JAM M;  1VQO F;  3IR9 A;  2LBW A;  3G71 F;  3PLA C;  5G4U C;  1W40 A;  3NMU C;  1YHQ F;  1SDS A;  3J7A R; 
#chains in the Genus database with same CATH topology
 2KG4 A;  3S0W A;  3RYI B;  5GON B;  4X3M A;  4X20 B;  2DT4 A;  5EB0 A;  1S72 F;  2MQE A;  2ALE A;  1QAH A;  1W41 A;  3CCV F;  1VQ7 F;  3M4S A;  5AVM A;  3CCQ F;  5IYZ B;  3M1X A;  3HJW C;  3CG6 A;  3CD6 F;  5IT9 M;  4XCQ A;  2GZL A;  3JAW B;  3JAS A;  1W2B F;  1FFX A;  3K12 A;  2UYP A;  3VI6 A;  3O85 A;  1VQ8 F;  1IPA A;  3CCS F;  3RA5 A;  3IKE A;  5GIO C;  3UT5 B;  3LWO C;  1W42 A;  4C8I A;  1E7K A;  3KHN A;  2V9Y A;  3HKE B;  1VH8 A;  4F6R A;  2IAF A;  3KJK A;  3F0E A;  2OTM A;  2VAW A;  1XV2 A;  4ZHV A;  2RB9 A;  4ZOL A;  1ODE A;  3N4Z A;  1XHO A;  2RHL A;  5GIN C;  3VO8 A;  3ZP7 A;  3AGK A;  1W55 A;  2QEX F;  4TUY B;  3ZO8 A;  2HP0 B;  3CPQ A;  3FPI A;  4B5C A;  2EWC A;  1KQS F;  3CC2 F;  3I3F A;  2BTU A;  1FNK A;  1Z5V A;  1YQN A;  4M8I A;  4C8E A;  5EB1 B;  1TUB A;  3HKB A;  3E1Y A;  3RYC A;  5EO3 A;  5LOV A;  3WJQ A;  3LWQ C;  4C81 A;  3KJJ A;  2I6D A;  1YGY A;  3JAT A;  4C82 A;  4U3J A;  2HS4 A;  5J2U A;  4YJ2 A;  1JFF B;  2HS0 A;  2L26 A;  2R75 1;  3FFM A;  3NK6 A;  1CLI A;  3CCL F;  1Q81 H;  2OHW A;  3G6E F;  1H7M A;  2UYK A;  1GO0 A;  1CK2 A;  3CPW F;  3I56 F;  3WXM B;  1RA4 A;  2HP3 A;  3GTZ A;  1TVK B;  5KX5 B;  4EB6 A;  3JAK B;  4X1I A;  4ZHW A;  5ITZ B;  5J2T B;  4DRX A;  2DYY A;  2CVL A;  3HAX D;  3RA6 A;  5LXT B;  3F6M A;  1X7O A;  2UZH A;  4X1Y B;  1M90 H;  3RYI A;  4C8G A;  1FNJ A;  1IV3 A;  2K1S A;  3E22 B;  3JAR A;  3G71 F;  5LYJ A;  1T0A A;  4I50 B;  5G4U C;  5CA0 A;  1J7H A;  3JAL B;  5LP6 B;  3C9R A;  1RQ2 A;  2LBX A;  1T0K B;  1VQ5 F;  3QHD A;  3IEW A;  3CCU F;  4X3L A;  2CWJ A;  2UYN B;  4G88 A;  3NVK E;  3RYF A;  4HNA A;  1KC8 H;  3RYH A;  1X52 A;  5JQG B;  4EI8 A;  5EYP A;  3CCE F;  1YIT F;  1RLU A;  5HY2 A;  3N4Y A;  1NQ3 A;  1K9M H;  4FFB A;  2G9I A;  3WGN A;  3CYP B;  4ERH A;  1U3P A;  3OW2 F;  1K8A H;  4O2A A;  2NMU A;  4O4I A;  5JVD B;  3L7Q A;  3N2K A;  3PAF A;  5KMG A;  3HKC A;  4BT6 A;  4EI7 A;  5JH7 A;  1N8R H;  4TV9 B;  3TD3 A;  1GO1 A;  5CA1 B;  2QA4 F;  4X1K B;  3LWV C;  5LA6 A;  2RHJ A;  1W5E A;  5HY1 A;  3S03 A;  2UYJ A;  4TV8 A;  3WGM A;  2YYE A;  5BMV A;  1W59 A;  2QI2 A;  3IEQ A;  3I55 F;  2HQS C;  4YJ3 B;  4ZI7 B;  4IHJ A;  3JCM M;  4ZHY B;  3ERN A;  4O4J B;  4IIJ A;  5CB4 B;  1XRG A;  4O4H B;  3NK7 A;  2PHN A;  1QVG F;  3NVI B;  1ONI A;  3P4E A;  4NWO B;  4NQ3 A;  1KNK A;  4BT5 A;  3HKD A;  3FBA A;  2Q1Y A;  1W57 A;  4G4Y A;  5IJ0 A;  2Z01 A;  1QU9 A;  2QTP A;  4G4W A;  1X25 A;  4I55 A;  3WGK A;  3D54 A;  4B45 A;  2AIZ P;  4BVS A;  3CC7 F;  3QUW A;  4O2B A;  5IJ9 B;  3F0G A;  3G4S F;  1VQN F;  3N2G B;  3K0T A;  3V4D A;  4WBN B;  3WPX A;  5HY0 A;  2IQQ A;  4ZHQ B;  4LNU B;  3P0Z A;  2PMP A;  4B46 A;  5HWE A;  2KTV A;  5EZY A;  3K2X A;  2HRY A;  2VGN A;  3IKF A;  1RLG A;  2ZOV A;  5FLX M;  3B6N A;  1GZ0 A;  2OZB A;  3C9S A;  3S0Y A;  1U3L A;  4BVR A;  4I4T A;  1SA0 A;  1W5F A;  4BVQ A;  4O4L B;  1YHQ F;  2AMT A;  1SDS A;  5LP6 C;  3JAS B;  2ZVY A;  1KD1 H;  5EIB C;  1IV2 A;  3RE3 A;  3SIV A;  1FFX B;  4G4X A;  4G4V A;  1VQK F;  1VK3 A;  5GAN K;  3C9U A;  3LME A;  2HVY D;  5FNV A;  2Z1T A;  3VCZ A;  5HXU A;  4LCK A;  1JN1 A;  5EAZ A;  4F6R B;  1NMU B;  3OBW A;  1Q86 H;  1U40 A;  5C8Y A;  2GVI A;  3VTI C;  5GON A;  5MN4 A;  3QTY A;  4X20 A;  4ZOL B;  2VXY A;  3KE1 A;  4C4W C;  3ON1 A;  3K14 A;  3MCQ A;  1YJW F;  5IYZ A;  3P10 A;  1H47 A;  4X1K A;  1DT9 A;  1QVF F;  3U0O A;  3JAW A;  3HKB B;  3RYC B;  3Q8H A;  1UFY A;  5LOV B;  3CMA F;  2H8E A;  1YI2 F;  2H6L A;  3S02 A;  2I6R A;  3JAT B;  3WGJ A;  4U3J B;  3CB2 A;  5J2U B;  2Q1X A;  4YJ2 B;  3V7Q A;  5HP7 A;  2YXZ A;  3UT5 A;  2H8C A;  1JJ2 F;  4KWE A;  2ZOD A;  3HKE A;  1KNJ A;  3CCR F;  5DCV A;  5JCO C;  3WPW A;  3MDO A;  3CCM F;  3V7E A;  3C9T A;  3CME F;  4DXD A;  3IMP A;  5G4V C;  3ELC A;  4TUY A;  1RQ7 A;  3VOB A;  2HP0 A;  1YJ9 F;  2CSL A;  3F0F A;  4U39 A;  5MN5 A;  4EB6 B;  4X1I B;  2B33 A;  1VQM F;  3LWR C;  2IG8 A;  4BT7 A;  4DRX B;  2FGY A;  3M84 A;  3C8L A;  2ZVZ A;  2Z1E A;  1OAP A;  1JD1 A;  4BT3 A;  4EI9 A;  2F9Z C;  3CC4 F;  2CHT A;  5HY4 A;  3JAR B;  3KIZ A;  2JNB A;  2CW4 A;  4E6E A;  5LYJ B;  5CA0 B;  1IV4 A;  1JFF A;  2HRU A;  1Q7Y H;  1SZQ A;  2Z1F A;  3OBY A;  3ESJ A;  1FSZ A;  4O4L A;  4BVT A;  1VQL F;  3RYF B;  4HNA B;  3RYH B;  1TVK A;  3IR9 A;  5KX5 A;  3HWU A;  4B62 A;  3VYU C;  3JAK A;  5EYP B;  3NMU C;  3J7A R;  5ITZ A;  5J2T A;  1ZWZ A;  3I7T A;  3V3T A;  2FC3 A;  2RHH A;  1VQP F;  4FFB B;  1M1K H;  5LXT A;  4RHA A;  3VIU A;  3BYQ A;  1JY8 A;  1W5A A;  3MBM A;  3JVH A;  4X1Y A;  5MN6 A;  2N48 A;  1YJN F;  3E22 A;  1Z5W A;  4BT2 A;  2AIF A;  4O2A B;  4O4I B;  3S06 A;  3LYB A;  3WGL A;  3ZP4 A;  5GAP K;  4I50 A;  2BO1 A;  3JAL A;  3N2K B;  5KMG B;  1PF5 A;  1PXW A;  3HKC B;  3F0D A;  5JH7 B;  4ZK7 A;  5LP6 A;  3MQW A;  3TD4 A;  3FD6 A;  1H48 A;  2P6Y A;  1W3E X;  1VHA A;  5LA6 B;  3J80 M;  3EOR A;  4TV8 B;  5BMV B;  2UYN A;  1VQV A;  4IHJ B;  5JQG A;  4IIJ B;  4PWT A;  2HX0 A;  3FD5 A;  1VQ4 F;  5EIB D;  2KTU A;  3OON A;  4R40 B;  3MCA B;  4TZZ A;  1Q82 H;  2RHO A;  2BTQ B;  3LDT A;  3WJR A;  4G4Z A;  3HKD B;  2W8B C;  3TD5 A;  2GLZ A;  3R0P A;  1U43 A;  5IJ0 B;  1K73 H;  2LBT A;  4I55 B;  4RQO A;  3VOA A;  1X7P A;  5JVD A;  3D00 A;  5HP8 A;  3DC2 A;  1XBI A;  2ZAU A;  3VYT C;  2KGW A;  1NJI H;  4O2B B;  3GHZ A;  2WAL A;  4TV9 A;  5CA1 A;  1QD9 A;  3S0H A;  5HXZ A;  3LWP C;  4NUT A;  1UI9 A;  1YIJ F;  4BW0 B;  1TUB B;  2Z1U A;  3VYS C;  3E20 B;  2CZW A;  4BT4 A;  1CN7 A;  4YJ3 A;  1VQ6 F;  3GYQ A;  3DDN A;  1IV1 A;  1GX1 A;  3ZOP A;  4ZI7 A;  4O4J A;  2HS3 A;  5FJ4 C;  5CB4 A;  2ZF8 A;  3HTN A;  4O4H A;  5GIP C;  2OTL F;  5EZY B;  1VQ9 F;  5JCO A;  3J81 M;  1Q8R A;  2VAP A;  2VGM A;  2BTO A;  3WJP A;  2R6R 1;  2OTJ F;  2LCA A;  3D01 A;  3VMF B;  3CCJ F;  4I4T B;  1SA0 B;  2CHS A;  1COM A;  3SIU A;  1DBF A;  5A2Q M;  5EWR A;  2VAM A;  5B8F A;  3CYQ A;  3LFO A;  1R1M A;  4BY9 D;  5IJ9 A;  1OFU A;  3N2G A;  4ZHQ A;  3CXC F;  5FNV B;  3JAM M;  4WBN A;  1VQO F;  2LBW A;  3PLA C;  1W58 1;  3T80 A;  5C8Y B;  1W5B A;  4LNU A;  1W40 A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  1ZWZ A;  3V3T A;  2FC3 A;  1VQP F;  4X3M A;  1KD1 H;  1S72 F;  3SIV A;  1M1K H;  2LBX A;  2ALE A;  1VQ5 F;  1VQK F;  1T0K B;  1W41 A;  3CCV F;  3CCU F;  4X3L A;  1VQ7 F;  5GAN K;  3NVK E;  2HVY D;  5HXU A;  1YJN F;  1KC8 H;  3CCQ F;  1X52 A;  2AIF A;  3HJW C;  3CG6 A;  3CD6 F;  4LCK A;  4EI8 A;  1NMU B;  3OBW A;  5GAP K;  1Q86 H;  5IT9 M;  4XCQ A;  2BO1 A;  3CCE F;  1PXW A;  1YIT F;  1W2B F;  5HY2 A;  3N4Y A;  1K9M H;  3VI6 A;  3O85 A;  4C4W C;  3ON1 A;  1VQ8 F;  3J80 M;  1W3E X;  1IPA A;  1YJW F;  3CCS F;  3RA5 A;  5GIO C;  3OW2 F;  3LWO C;  1K8A H;  1W42 A;  1E7K A;  1VQ4 F;  1DT9 A;  3PAF A;  1QVF F;  2KTU A;  4EI7 A;  1N8R H;  3MCA B;  3N4Z A;  4TZZ A;  3CMA F;  5GIN C;  1Q82 H;  1GO1 A;  3AGK A;  2QA4 F;  1YI2 F;  2QEX F;  3LWV C;  5HY1 A;  2GLZ A;  3V7Q A;  3CPQ A;  2QI2 A;  3I55 F;  1K73 H;  1JJ2 F;  1KQS F;  3CC2 F;  3JCM M;  3CCR F;  5DCV A;  1X7P A;  3D00 A;  3NK7 A;  3CCM F;  3V7E A;  1QVG F;  1XBI A;  3NVI B;  3E1Y A;  3CME F;  1NJI H;  5EO3 A;  4NQ3 A;  3LWQ C;  2WAL A;  2I6D A;  5G4V C;  5HXZ A;  3LWP C;  4NUT A;  1YIJ F;  4BW0 B;  1YJ9 F;  3E20 B;  2CZW A;  1CN7 A;  1VQ6 F;  3GYQ A;  3FFM A;  3NK6 A;  1VQM F;  5FJ4 C;  3LWR C;  3CCL F;  1Q81 H;  4BVS A;  5GIP C;  2FGY A;  2OTL F;  1VQ9 F;  2OHW A;  3J81 M;  3CC7 F;  2VGM A;  1H7M A;  3G6E F;  2OTJ F;  1GO0 A;  1CK2 A;  3CPW F;  4EI9 A;  3G4S F;  3VMF B;  1VQN F;  2F9Z C;  3I56 F;  3CC4 F;  3WXM B;  1RA4 A;  3CCJ F;  5HY4 A;  5HY0 A;  2JNB A;  3SIU A;  1Q7Y H;  5A2Q M;  5HWE A;  5EWR A;  2KTV A;  3OBY A;  3HAX D;  2VGN A;  3RA6 A;  1X7O A;  3LFO A;  4BVT A;  1VQL F;  1RLG A;  4BY9 D;  5FLX M;  1M90 H;  1GZ0 A;  2OZB A;  3CXC F;  4BVR A;  3JAM M;  1VQO F;  4BVQ A;  3IR9 A;  2LBW A;  3G71 F;  3PLA C;  5G4U C;  1W40 A;  3NMU C;  1YHQ F;  1SDS A;  3J7A R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...