3NVKE

Structural basis for substrate placement by an archaeal box c/d ribonucleoprotein particle
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nvkE00
3E20B 3LFOA 5GIPC 1Q81H 1KQSF 3CCEF 1YIJF 1YI2F 2I6DA 2KG4A 2WALA 3RA5A 3CCLF 2QA4F 1JJ2F 1VQNF 5DCVA 3WXMB 3CCRF 3NMUC 3NVIB 3LWPC 3SIVA 1W40A 1X7OA 1VQ5F 1W42A 3CMAF 1YJWF 2HVYD 1CK2A 3J81M 3N4ZA 3MCAB 3FFMA 3I55F 1YJNF 1K73H 5FJ4C 4BW0B 3IR9A 2OTLF 2CZWA 5GANK 2QI2A 1H7MA 3NK7A 3G71F 3CCVF 5G4VC 1VQLF 1KC8H 1KD1H 4TZZA 1T0KB 3LWQC 1VQ8F 3CXCF 3CCUF 2LBXA 5FLXM 3CC2F 2KTVA 3PLAC 1VQKF 2QEXF 1Q86H 3ON1A 4X3MA 3GYQA 1VQ6F 4BY9D 1QVFF 1GZ0A 3I56F 3HJWC 3PAFA 5GIOC 3AGKA 3CMEF 3LWOC 3OBYA 3OW2F 3J7AR 1X52A 3RA6A 3G6EF 3VMFB 1Q7YH 3OBWA 3CPWF 1E7KA 1GO0A 1W41A 3V7QA 2FC3A 5GAPK 3CCMF 3NVKE 5G4UC 1VQOF 1VQMF 3O85A 2VGMA 2BO1A 2OTJF 1M1KH 1YHQF 3CG6A 2OZBA 1DT9A 3VI6A 3CCJF 1GO1A 3N4YA 2ALEA 5IT9M 3CD6F 1N8RH 1K8AH 5A2QM 3LWRC 3HAXD 2OHWA 3J80M 1NMUB 1SDSA 4X3LA 3CPQA 1VQ7F 1CN7A 1XBIA 2LBWA 1RLGA 1IPAA 5EWRA 4NUTA 3G4SF 3LWVC 1M90H 1S72F 1YJ9F 1W3EX 1PXWA 1YITF 1NJIH 1VQPF 1VQ4F 3CC7F 2KTUA 3NK6A 1K9MH 3CC4F 1W2BF 3V7EA 3CCQF 2VGNA 2AIFA 2JNBA 3JCMM 3CCSF 1Q82H 1VQ9F 5EO3A 3JAMM 4LCKA 5GINC 3E1YA 4C4WC 1ZWZA 3SIUA 1RA4A 1QVGF 1X7PA
chains in the Genus database with same CATH superfamily
3E20B 5GIPC 4U3JA 1W5FA 1XV2A 5LP6C 2I6DA 1CLIA 5IYZA 5EIBC 4BVTA 3RYCB 3CCLF 2QA4F 5IJ9A 1SA0A 4G88A 1VQNF 4PWTA 3WXMB 3KJKA 3NVIB 1TUBA 3JALA 5HY0A 1W40A 3SIVA 4I50A 5CB4B 4X1KB 1OAPA 3FD6A 3QHDA 5JCOC 2DYYA 1YJNF 3HTNA 4BT2A 4O4JA 4BW0B 3F0FA 2QI2A 2UYNB 3NK7A 5HXUA 4TUYA 3JVHA 5HP8A 2IAFA 5CA1B 5G4VC 5LOVA 1W581 3JAWA 3HWUA 2KTVA 5LXTA 2YYEA 5MN6A 4B45A 3VO8A 3DC2A 2CW4A 5ITZB 2PHNA 3ELCA 4X20A 3KHNA 3F0DA 3P0ZA 3HKCB 1QAHA 1X52A 3WPWA 2HRYA 5CA0A 4BVSA 3VMFB 3VYSC 1VQVA 1W41A 3FD5A 1W57A 1NQ3A 3V7QA 5EYPB 4I4TB 3CCMF 5J2TA 5EZYA 5JQGA 4BVQA 3V3TA 5KMGB 2HX0A 3O85A 2VGMA 2CSLA 2NMUA 4BVRA 4YJ3A 4IIJB 1ONIA 3I7TA 2OTJF 2CVLA 1H48A 3CG6A 5JVDA 3WGJA 4KWEA 3N2KA 3N4YA 3WJQA 4DXDA 3C9UA 5JH7A 2GZLA 3CD6F 5KX5B 4LNUB 4O2AA 2B33A 4X3LA 3CPQA 1JD1A 4FFBB 4U39A 1VQ7F 1XBIA 1CN7A 3K0TA 2EWCA 4TV9A 2GVIA 3FPIA 4TV8A 4NUTA 4BT4A 3G4SF 2ZVZA 3JARA 3LWVC 2BTUA 1S72F 5LYJA 1W3EX 2VAPA 3D01A 2HQSC 4O4LB 5J2UB 1VQPF 3VOAA 1VK3A 3CC7F 2KTUA 1W5AA 2VGNA 4I55A 4M8IA 3JCMM 5LA6B 3OONA 1TVKA 4O2BB 4LCKA 5LP6A 3WGMA 1JFFB 1ZWZA 3F6MA 3QTYA 4G4VA 1JN1A 4I50B 3FBAA 1U3PA 4IHJB 4DRXB 2ZF8A 4O4JB 3VCZA 1X25A 2KG4A 1OFUA 3T80A 3S0YA 5IJ0A 3MDOA 4X1IB 4EI9A 5LOVB 3JASA 3S0HA 1CK2A 3GHZA 1IV4A 1FNKA 1Q8RA 1FFXA 3JAKA 3MCAB 3FFMA 1K73H 5FJ4C 2UYKA 2ZOVA 1QU9A 1W5EA 3G71F 4ZI7B 3HKCA 4O4LA 1KC8H 3F0GA 5C8YA 4F6RB 4TZZA 1VQ8F 2R6R1 4I55B 3BYQA 3PLAC 3RYIA 3GYQA 1GX1A 5LP6B 1GZ0A 4IIJA 3HJWC 5HWEA 2Z1EA 5IYZB 5GIOC 3AGKA 2Z1FA 4G4YA 3CMEF 4EB6B 2L26A 3OBWA 1E7KA 1TUBB 4IHJA 2FC3A 5GAPK 3WGLA 2HP0A 5AVMA 3IEWA 1Z5VA 4RHAA 3TD4A 2Z1UA 2BO1A 2I6RA 1RQ2A 3L7QA 3C9TA 4TV9B 1M1KH 3GTZA 3B6NA 4TUYB 1FNJA 1DT9A 3VI6A 5FNVA 1GO1A 4C8EA 4ZHYB 1IV3A 2AIZP 4HNAB 5HY2A 4X1YA 5IT9M 3LWRC 3HAXD 5LXTB 3CYPB 3J80M 2LBTA 2HP3A 4U3JB 3N2GB 4F6RA 3JATB 1RLGA 3ZP4A 5BMVA 2HS0A 2H8CA 1PXWA 5J2TB 5KMGA 1W2BF 3CCQF 4EI8A 2JNBA 3CCSF 3TD5A 1Q82H 1QD9A 4XCQA 1H47A 4YJ3B 3UT5B 3E1YA 4C4WC 1RA4A 1QVGF 3E22A 2FGYA 3LFOA 1Q81H 1FFXB 2P6YA 3CCEF 1IV1A 3CYQA 3D54A 2CHTA 1YI2F 5JH7B 5KX5A 2YXZA 2Q1XA 3IKEA 3F0EA 2UYPA 2MQEA 1VHAA 3NMUC 3LWPC 3M1XA 3CMAF 4TV8B 4X20B 3J81M 2RB9A 1UI9A 5CA0B 3RYIB 4E6EA 3CB2A 2CZWA 3RYHA 5EYPA 1KNKA 2GLZA 5GONB 2HS4A 1YGYA 3HKEB 2Q1YA 4O2BA 1VQLF 3P4EA 3K2XA 3Q8HA 3CCUF 1Z5WA 5FLXM 1DBFA 3LDTA 3CC2F 5IJ9B 5EIBD 2QEXF 3ON1A 2ZODA 4X3MA 1J7HA 3EORA 4ZOLB 4BY9D 3JALB 3C9SA 3PAFA 5MN4A 1SZQA 1U3LA 1RLUA 4X1KA 3LWOC 3OW2F 3J7AR 3RA6A 3G6EF 2RHHA 1Q7YH 5FNVB 3CPWF 3HKBA 5HXZA 4FFBA 4X1IA 3HKDA 3IKFA 5G4UC 2K1SA 3JAKB 2CWJA 5CA1A 3LYBA 3VYTC 2VAWA 2H8EA 3WJPA 1YQNA 2QTPA 2OZBA 4ZI7A 5EAZA 3VOBA 1JFFA 2ALEA 3P10A 1U40A 1SA0B 3S0WA 2LBWA 2BTOA 3V4DA 4ZHQA 3KE1A 1IPAA 5EWRA 2H6LA 4EB6A 2HRUA 2ZVYA 1YJ9F 4WBNB 1YITF 1NJIH 2HS3A 2KGWA 2Z1TA 4G4XA 3KIZA 3NK6A 3ESJA 3CC4F 2HP0B 3V7EA 2UYNA 4C82A 2AIFA 5JVDB 4C8GA 1VQ9F 1PF5A 3N2KB 3HKBB 2RHJA 2OTMA 3SIUA 3WGNA 3K14A 1FSZA 3JAWB 1KNJA 1X7PA 1KQSF 1YIJF 3R0PA 4O4HB 4X1YB 3IMPA 3VTIC 2DT4A 2WALA 3RA5A 1JJ2F 5LYJB 5GONA 1JY8A 4ZHWA 3S03A 5DCVA 3HKEA 3CCRF 3RYFB 3JATA 1X7OA 1VQ5F 4I4TA 1W42A 5BMVB 1YJWF 3RE3A 2HVYD 4ZK7A 5LA6A 4BT5A 3N4ZA 3D00A 2PMPA 4O4IB 3I55F 4ZOLA 5B8FA 2LCAA 3IR9A 2OTLF 4ERHA 5GANK 1W55A 3MQWA 4B46A 1H7MA 3RYCA 3WGKA 4YJ2A 2CHSA 3CCVF 5JCOA 2BTQB 3WJRA 4DRXA 1KD1H 1T0KB 5MN5A 4ZHVA 3LWQC 3CXCF 3M84A 2IG8A 2LBXA 4B5CA 1VQKF 1Q86H 2IQQA 3TD3A 5EB0A 1VQ6F 1QVFF 4BT7A 3I56F 3QUWA 3JASB 2ZAUA 3MCQA 3S06A 4C81A 1VH8A 2V9YA 3JARB 3OBYA 3U0OA 2Z01A 2AMTA 1W59A 3VIUA 3WPXA 3ZP7A 1COMA 1GO0A 5HY4A 5J2UA 3N2GA 3NVKE 4G4WA 1VQOF 1W5BA 1VQMF 4G4ZA 1UFYA 4NWOB 2RHLA 1TVKB 4NQ3A 1RQ7A 4RQOA 2UYJA 3RYFA 2VXYA 4ZHQB 1XRGA 2VAMA 1YHQF 2N48A 3C9RA 3CCJF 1R1MA 4BT3A 4WBNA 4O4IA 3VYUC 3M4SA 3UT5A 3IEQA 5EZYB 5JQGB 2G9IA 3ERNA 1N8RH 1K8AH 1IV2A 1ODEA 5A2QM 5CB4A 2UZHA 2OHWA 4YJ2B 3E22B 1NMUB 4R40B 1SDSA 1U43A 4BT6A 5IJ0B 5HP7A 2W8BC 4C8IA 5EB1B 3K12A 3I3FA 3ZO8A 1M90H 2R751 4B62A 3MBMA 4EI7A 3DDNA 1VQ4F 3HKDB 3LMEA 4O4HA 1K9MH 4LNUA 5HY1A 1T0AA 4O2AB 5EO3A 3JAMM 5GINC 3S02A 5ITZA 1XHOA 4HNAA 3ZOPA 5C8YB 3RYHB 2RHOA 3C8LA 2F9ZC 3KJJA
chains in the Genus database with same CATH topology
2FGYA 3E20B 3LFOA 5GIPC 1Q81H 1KQSF 3CCEF 1YIJF 1YI2F 2I6DA 2KG4A 2WALA 3RA5A 4BVTA 3CCLF 2QA4F 1JJ2F 1VQNF 5DCVA 3WXMB 3CCRF 3NMUC 3NVIB 5HY0A 3LWPC 3SIVA 1W40A 1X7OA 1VQ5F 4EI9A 1W42A 3CMAF 1YJWF 2HVYD 1CK2A 3J81M 3N4ZA 3D00A 3MCAB 3FFMA 3I55F 1YJNF 1K73H 5FJ4C 4BW0B 3IR9A 2OTLF 2CZWA 5GANK 2QI2A 1H7MA 2GLZA 3NK7A 5HXUA 3G71F 3CCVF 5G4VC 1VQLF 1KC8H 1KD1H 4TZZA 1T0KB 3LWQC 1VQ8F 3CXCF 3CCUF 2LBXA 5FLXM 3CC2F 2KTVA 3PLAC 1VQKF 2QEXF 1Q86H 3ON1A 4X3MA 3GYQA 1VQ6F 4BY9D 1QVFF 1GZ0A 3I56F 3HJWC 5HWEA 3PAFA 5GIOC 3AGKA 3CMEF 3LWOC 3OBYA 3OW2F 3J7AR 1X52A 3RA6A 4BVSA 3G6EF 3VMFB 1Q7YH 3OBWA 3CPWF 1E7KA 5HXZA 1GO0A 5HY4A 1W41A 3V7QA 2FC3A 5GAPK 3CCMF 3NVKE 5G4UC 4BVQA 1VQOF 3V3TA 1VQMF 3O85A 2VGMA 4BVRA 4NQ3A 2BO1A 2OTJF 1M1KH 1YHQF 3CG6A 2OZBA 1DT9A 3VI6A 3CCJF 1GO1A 3N4YA 5HY2A 2ALEA 5IT9M 3CD6F 1N8RH 1K8AH 5A2QM 3LWRC 3HAXD 2OHWA 3J80M 1NMUB 1SDSA 4X3LA 3CPQA 1VQ7F 1CN7A 1XBIA 2LBWA 1RLGA 1IPAA 5EWRA 4NUTA 3G4SF 3LWVC 1M90H 1S72F 1YJ9F 1W3EX 1PXWA 1YITF 1NJIH 4EI7A 1VQPF 1VQ4F 3CC7F 2KTUA 3NK6A 1K9MH 3CC4F 1W2BF 3V7EA 3CCQF 4EI8A 2VGNA 2AIFA 2JNBA 3JCMM 3CCSF 5HY1A 1Q82H 1VQ9F 4XCQA 5EO3A 3JAMM 4LCKA 5GINC 3E1YA 4C4WC 1ZWZA 3SIUA 2F9ZC 1RA4A 1QVGF 1X7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E20 B;  3LFO A;  5GIP C;  1Q81 H;  1KQS F;  3CCE F;  1YIJ F;  1YI2 F;  2I6D A;  2KG4 A;  2WAL A;  3RA5 A;  3CCL F;  2QA4 F;  1JJ2 F;  1VQN F;  5DCV A;  3WXM B;  3CCR F;  3NMU C;  3NVI B;  3LWP C;  3SIV A;  1W40 A;  1X7O A;  1VQ5 F;  1W42 A;  3CMA F;  1YJW F;  2HVY D;  1CK2 A;  3J81 M;  3N4Z A;  3MCA B;  3FFM A;  3I55 F;  1YJN F;  1K73 H;  5FJ4 C;  4BW0 B;  3IR9 A;  2OTL F;  2CZW A;  5GAN K;  2QI2 A;  1H7M A;  3NK7 A;  3G71 F;  3CCV F;  5G4V C;  1VQL F;  1KC8 H;  1KD1 H;  4TZZ A;  1T0K B;  3LWQ C;  1VQ8 F;  3CXC F;  3CCU F;  2LBX A;  5FLX M;  3CC2 F;  2KTV A;  3PLA C;  1VQK F;  2QEX F;  1Q86 H;  3ON1 A;  4X3M A;  3GYQ A;  1VQ6 F;  4BY9 D;  1QVF F;  1GZ0 A;  3I56 F;  3HJW C;  3PAF A;  5GIO C;  3AGK A;  3CME F;  3LWO C;  3OBY A;  3OW2 F;  3J7A R;  1X52 A;  3RA6 A;  3G6E F;  3VMF B;  1Q7Y H;  3OBW A;  3CPW F;  1E7K A;  1GO0 A;  1W41 A;  3V7Q A;  2FC3 A;  5GAP K;  3CCM F;  3NVK E;  5G4U C;  1VQO F;  1VQM F;  3O85 A;  2VGM A;  2BO1 A;  2OTJ F;  1M1K H;  1YHQ F;  3CG6 A;  2OZB A;  1DT9 A;  3VI6 A;  3CCJ F;  1GO1 A;  3N4Y A;  2ALE A;  5IT9 M;  3CD6 F;  1N8R H;  1K8A H;  5A2Q M;  3LWR C;  3HAX D;  2OHW A;  3J80 M;  1NMU B;  1SDS A;  4X3L A;  3CPQ A;  1VQ7 F;  1CN7 A;  1XBI A;  2LBW A;  1RLG A;  1IPA A;  5EWR A;  4NUT A;  3G4S F;  3LWV C;  1M90 H;  1S72 F;  1YJ9 F;  1W3E X;  1PXW A;  1YIT F;  1NJI H;  1VQP F;  1VQ4 F;  3CC7 F;  2KTU A;  3NK6 A;  1K9M H;  3CC4 F;  1W2B F;  3V7E A;  3CCQ F;  2VGN A;  2AIF A;  2JNB A;  3JCM M;  3CCS F;  1Q82 H;  1VQ9 F;  5EO3 A;  3JAM M;  4LCK A;  5GIN C;  3E1Y A;  4C4W C;  1ZWZ A;  3SIU A;  1RA4 A;  1QVG F;  1X7P A; 
#chains in the Genus database with same CATH topology
 3E20 B;  5GIP C;  4U3J A;  1W5F A;  1XV2 A;  5LP6 C;  2I6D A;  1CLI A;  5IYZ A;  5EIB C;  4BVT A;  3RYC B;  3CCL F;  2QA4 F;  5IJ9 A;  1SA0 A;  4G88 A;  1VQN F;  4PWT A;  3WXM B;  3KJK A;  3NVI B;  1TUB A;  3JAL A;  5HY0 A;  1W40 A;  3SIV A;  4I50 A;  5CB4 B;  4X1K B;  1OAP A;  3FD6 A;  3QHD A;  5JCO C;  2DYY A;  1YJN F;  3HTN A;  4BT2 A;  4O4J A;  4BW0 B;  3F0F A;  2QI2 A;  2UYN B;  3NK7 A;  5HXU A;  4TUY A;  3JVH A;  5HP8 A;  2IAF A;  5CA1 B;  5G4V C;  5LOV A;  1W58 1;  3JAW A;  3HWU A;  2KTV A;  5LXT A;  2YYE A;  5MN6 A;  4B45 A;  3VO8 A;  3DC2 A;  2CW4 A;  5ITZ B;  2PHN A;  3ELC A;  4X20 A;  3KHN A;  3F0D A;  3P0Z A;  3HKC B;  1QAH A;  1X52 A;  3WPW A;  2HRY A;  5CA0 A;  4BVS A;  3VMF B;  3VYS C;  1VQV A;  1W41 A;  3FD5 A;  1W57 A;  1NQ3 A;  3V7Q A;  5EYP B;  4I4T B;  3CCM F;  5J2T A;  5EZY A;  5JQG A;  4BVQ A;  3V3T A;  5KMG B;  2HX0 A;  3O85 A;  2VGM A;  2CSL A;  2NMU A;  4BVR A;  4YJ3 A;  4IIJ B;  1ONI A;  3I7T A;  2OTJ F;  2CVL A;  1H48 A;  3CG6 A;  5JVD A;  3WGJ A;  4KWE A;  3N2K A;  3N4Y A;  3WJQ A;  4DXD A;  3C9U A;  5JH7 A;  2GZL A;  3CD6 F;  5KX5 B;  4LNU B;  4O2A A;  2B33 A;  4X3L A;  3CPQ A;  1JD1 A;  4FFB B;  4U39 A;  1VQ7 F;  1XBI A;  1CN7 A;  3K0T A;  2EWC A;  4TV9 A;  2GVI A;  3FPI A;  4TV8 A;  4NUT A;  4BT4 A;  3G4S F;  2ZVZ A;  3JAR A;  3LWV C;  2BTU A;  1S72 F;  5LYJ A;  1W3E X;  2VAP A;  3D01 A;  2HQS C;  4O4L B;  5J2U B;  1VQP F;  3VOA A;  1VK3 A;  3CC7 F;  2KTU A;  1W5A A;  2VGN A;  4I55 A;  4M8I A;  3JCM M;  5LA6 B;  3OON A;  1TVK A;  4O2B B;  4LCK A;  5LP6 A;  3WGM A;  1JFF B;  1ZWZ A;  3F6M A;  3QTY A;  4G4V A;  1JN1 A;  4I50 B;  3FBA A;  1U3P A;  4IHJ B;  4DRX B;  2ZF8 A;  4O4J B;  3VCZ A;  1X25 A;  2KG4 A;  1OFU A;  3T80 A;  3S0Y A;  5IJ0 A;  3MDO A;  4X1I B;  4EI9 A;  5LOV B;  3JAS A;  3S0H A;  1CK2 A;  3GHZ A;  1IV4 A;  1FNK A;  1Q8R A;  1FFX A;  3JAK A;  3MCA B;  3FFM A;  1K73 H;  5FJ4 C;  2UYK A;  2ZOV A;  1QU9 A;  1W5E A;  3G71 F;  4ZI7 B;  3HKC A;  4O4L A;  1KC8 H;  3F0G A;  5C8Y A;  4F6R B;  4TZZ A;  1VQ8 F;  2R6R 1;  4I55 B;  3BYQ A;  3PLA C;  3RYI A;  3GYQ A;  1GX1 A;  5LP6 B;  1GZ0 A;  4IIJ A;  3HJW C;  5HWE A;  2Z1E A;  5IYZ B;  5GIO C;  3AGK A;  2Z1F A;  4G4Y A;  3CME F;  4EB6 B;  2L26 A;  3OBW A;  1E7K A;  1TUB B;  4IHJ A;  2FC3 A;  5GAP K;  3WGL A;  2HP0 A;  5AVM A;  3IEW A;  1Z5V A;  4RHA A;  3TD4 A;  2Z1U A;  2BO1 A;  2I6R A;  1RQ2 A;  3L7Q A;  3C9T A;  4TV9 B;  1M1K H;  3GTZ A;  3B6N A;  4TUY B;  1FNJ A;  1DT9 A;  3VI6 A;  5FNV A;  1GO1 A;  4C8E A;  4ZHY B;  1IV3 A;  2AIZ P;  4HNA B;  5HY2 A;  4X1Y A;  5IT9 M;  3LWR C;  3HAX D;  5LXT B;  3CYP B;  3J80 M;  2LBT A;  2HP3 A;  4U3J B;  3N2G B;  4F6R A;  3JAT B;  1RLG A;  3ZP4 A;  5BMV A;  2HS0 A;  2H8C A;  1PXW A;  5J2T B;  5KMG A;  1W2B F;  3CCQ F;  4EI8 A;  2JNB A;  3CCS F;  3TD5 A;  1Q82 H;  1QD9 A;  4XCQ A;  1H47 A;  4YJ3 B;  3UT5 B;  3E1Y A;  4C4W C;  1RA4 A;  1QVG F;  3E22 A;  2FGY A;  3LFO A;  1Q81 H;  1FFX B;  2P6Y A;  3CCE F;  1IV1 A;  3CYQ A;  3D54 A;  2CHT A;  1YI2 F;  5JH7 B;  5KX5 A;  2YXZ A;  2Q1X A;  3IKE A;  3F0E A;  2UYP A;  2MQE A;  1VHA A;  3NMU C;  3LWP C;  3M1X A;  3CMA F;  4TV8 B;  4X20 B;  3J81 M;  2RB9 A;  1UI9 A;  5CA0 B;  3RYI B;  4E6E A;  3CB2 A;  2CZW A;  3RYH A;  5EYP A;  1KNK A;  2GLZ A;  5GON B;  2HS4 A;  1YGY A;  3HKE B;  2Q1Y A;  4O2B A;  1VQL F;  3P4E A;  3K2X A;  3Q8H A;  3CCU F;  1Z5W A;  5FLX M;  1DBF A;  3LDT A;  3CC2 F;  5IJ9 B;  5EIB D;  2QEX F;  3ON1 A;  2ZOD A;  4X3M A;  1J7H A;  3EOR A;  4ZOL B;  4BY9 D;  3JAL B;  3C9S A;  3PAF A;  5MN4 A;  1SZQ A;  1U3L A;  1RLU A;  4X1K A;  3LWO C;  3OW2 F;  3J7A R;  3RA6 A;  3G6E F;  2RHH A;  1Q7Y H;  5FNV B;  3CPW F;  3HKB A;  5HXZ A;  4FFB A;  4X1I A;  3HKD A;  3IKF A;  5G4U C;  2K1S A;  3JAK B;  2CWJ A;  5CA1 A;  3LYB A;  3VYT C;  2VAW A;  2H8E A;  3WJP A;  1YQN A;  2QTP A;  2OZB A;  4ZI7 A;  5EAZ A;  3VOB A;  1JFF A;  2ALE A;  3P10 A;  1U40 A;  1SA0 B;  3S0W A;  2LBW A;  2BTO A;  3V4D A;  4ZHQ A;  3KE1 A;  1IPA A;  5EWR A;  2H6L A;  4EB6 A;  2HRU A;  2ZVY A;  1YJ9 F;  4WBN B;  1YIT F;  1NJI H;  2HS3 A;  2KGW A;  2Z1T A;  4G4X A;  3KIZ A;  3NK6 A;  3ESJ A;  3CC4 F;  2HP0 B;  3V7E A;  2UYN A;  4C82 A;  2AIF A;  5JVD B;  4C8G A;  1VQ9 F;  1PF5 A;  3N2K B;  3HKB B;  2RHJ A;  2OTM A;  3SIU A;  3WGN A;  3K14 A;  1FSZ A;  3JAW B;  1KNJ A;  1X7P A;  1KQS F;  1YIJ F;  3R0P A;  4O4H B;  4X1Y B;  3IMP A;  3VTI C;  2DT4 A;  2WAL A;  3RA5 A;  1JJ2 F;  5LYJ B;  5GON A;  1JY8 A;  4ZHW A;  3S03 A;  5DCV A;  3HKE A;  3CCR F;  3RYF B;  3JAT A;  1X7O A;  1VQ5 F;  4I4T A;  1W42 A;  5BMV B;  1YJW F;  3RE3 A;  2HVY D;  4ZK7 A;  5LA6 A;  4BT5 A;  3N4Z A;  3D00 A;  2PMP A;  4O4I B;  3I55 F;  4ZOL A;  5B8F A;  2LCA A;  3IR9 A;  2OTL F;  4ERH A;  5GAN K;  1W55 A;  3MQW A;  4B46 A;  1H7M A;  3RYC A;  3WGK A;  4YJ2 A;  2CHS A;  3CCV F;  5JCO A;  2BTQ B;  3WJR A;  4DRX A;  1KD1 H;  1T0K B;  5MN5 A;  4ZHV A;  3LWQ C;  3CXC F;  3M84 A;  2IG8 A;  2LBX A;  4B5C A;  1VQK F;  1Q86 H;  2IQQ A;  3TD3 A;  5EB0 A;  1VQ6 F;  1QVF F;  4BT7 A;  3I56 F;  3QUW A;  3JAS B;  2ZAU A;  3MCQ A;  3S06 A;  4C81 A;  1VH8 A;  2V9Y A;  3JAR B;  3OBY A;  3U0O A;  2Z01 A;  2AMT A;  1W59 A;  3VIU A;  3WPX A;  3ZP7 A;  1COM A;  1GO0 A;  5HY4 A;  5J2U A;  3N2G A;  3NVK E;  4G4W A;  1VQO F;  1W5B A;  1VQM F;  4G4Z A;  1UFY A;  4NWO B;  2RHL A;  1TVK B;  4NQ3 A;  1RQ7 A;  4RQO A;  2UYJ A;  3RYF A;  2VXY A;  4ZHQ B;  1XRG A;  2VAM A;  1YHQ F;  2N48 A;  3C9R A;  3CCJ F;  1R1M A;  4BT3 A;  4WBN A;  4O4I A;  3VYU C;  3M4S A;  3UT5 A;  3IEQ A;  5EZY B;  5JQG B;  2G9I A;  3ERN A;  1N8R H;  1K8A H;  1IV2 A;  1ODE A;  5A2Q M;  5CB4 A;  2UZH A;  2OHW A;  4YJ2 B;  3E22 B;  1NMU B;  4R40 B;  1SDS A;  1U43 A;  4BT6 A;  5IJ0 B;  5HP7 A;  2W8B C;  4C8I A;  5EB1 B;  3K12 A;  3I3F A;  3ZO8 A;  1M90 H;  2R75 1;  4B62 A;  3MBM A;  4EI7 A;  3DDN A;  1VQ4 F;  3HKD B;  3LME A;  4O4H A;  1K9M H;  4LNU A;  5HY1 A;  1T0A A;  4O2A B;  5EO3 A;  3JAM M;  5GIN C;  3S02 A;  5ITZ A;  1XHO A;  4HNA A;  3ZOP A;  5C8Y B;  3RYH B;  2RHO A;  3C8L A;  2F9Z C;  3KJJ A; 
#chains in the Genus database with same CATH homology
 2FGY A;  3E20 B;  3LFO A;  5GIP C;  1Q81 H;  1KQS F;  3CCE F;  1YIJ F;  1YI2 F;  2I6D A;  2KG4 A;  2WAL A;  3RA5 A;  4BVT A;  3CCL F;  2QA4 F;  1JJ2 F;  1VQN F;  5DCV A;  3WXM B;  3CCR F;  3NMU C;  3NVI B;  5HY0 A;  3LWP C;  3SIV A;  1W40 A;  1X7O A;  1VQ5 F;  4EI9 A;  1W42 A;  3CMA F;  1YJW F;  2HVY D;  1CK2 A;  3J81 M;  3N4Z A;  3D00 A;  3MCA B;  3FFM A;  3I55 F;  1YJN F;  1K73 H;  5FJ4 C;  4BW0 B;  3IR9 A;  2OTL F;  2CZW A;  5GAN K;  2QI2 A;  1H7M A;  2GLZ A;  3NK7 A;  5HXU A;  3G71 F;  3CCV F;  5G4V C;  1VQL F;  1KC8 H;  1KD1 H;  4TZZ A;  1T0K B;  3LWQ C;  1VQ8 F;  3CXC F;  3CCU F;  2LBX A;  5FLX M;  3CC2 F;  2KTV A;  3PLA C;  1VQK F;  2QEX F;  1Q86 H;  3ON1 A;  4X3M A;  3GYQ A;  1VQ6 F;  4BY9 D;  1QVF F;  1GZ0 A;  3I56 F;  3HJW C;  5HWE A;  3PAF A;  5GIO C;  3AGK A;  3CME F;  3LWO C;  3OBY A;  3OW2 F;  3J7A R;  1X52 A;  3RA6 A;  4BVS A;  3G6E F;  3VMF B;  1Q7Y H;  3OBW A;  3CPW F;  1E7K A;  5HXZ A;  1GO0 A;  5HY4 A;  1W41 A;  3V7Q A;  2FC3 A;  5GAP K;  3CCM F;  3NVK E;  5G4U C;  4BVQ A;  1VQO F;  3V3T A;  1VQM F;  3O85 A;  2VGM A;  4BVR A;  4NQ3 A;  2BO1 A;  2OTJ F;  1M1K H;  1YHQ F;  3CG6 A;  2OZB A;  1DT9 A;  3VI6 A;  3CCJ F;  1GO1 A;  3N4Y A;  5HY2 A;  2ALE A;  5IT9 M;  3CD6 F;  1N8R H;  1K8A H;  5A2Q M;  3LWR C;  3HAX D;  2OHW A;  3J80 M;  1NMU B;  1SDS A;  4X3L A;  3CPQ A;  1VQ7 F;  1CN7 A;  1XBI A;  2LBW A;  1RLG A;  1IPA A;  5EWR A;  4NUT A;  3G4S F;  3LWV C;  1M90 H;  1S72 F;  1YJ9 F;  1W3E X;  1PXW A;  1YIT F;  1NJI H;  4EI7 A;  1VQP F;  1VQ4 F;  3CC7 F;  2KTU A;  3NK6 A;  1K9M H;  3CC4 F;  1W2B F;  3V7E A;  3CCQ F;  4EI8 A;  2VGN A;  2AIF A;  2JNB A;  3JCM M;  3CCS F;  5HY1 A;  1Q82 H;  1VQ9 F;  4XCQ A;  5EO3 A;  3JAM M;  4LCK A;  5GIN C;  3E1Y A;  4C4W C;  1ZWZ A;  3SIU A;  2F9Z C;  1RA4 A;  1QVG F;  1X7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...