1H48A

The structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
molecule tags Synthase
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h48A00
1KNKA 2AMTA 3ERNA 1T0AA 1IV1A 2PMPA 2UZHA 3FBAA 4C8IA 1U40A 1IV2A 3EORA 3IKFA 3Q8HA 1JY8A 1VH8A 1W57A 1KNJA 4C8GA 1H48A 3IEWA 3QHDA 3K14A 1IV4A 3F0DA 3MBMA 1VHAA 3JVHA 3K2XA 3F0GA 4C82A 4C8EA 3P0ZA 1H47A 2GZLA 3ESJA 3F0EA 3F6MA 3FPIA 1U43A 3T80A 3IKEA 1YQNA 3IEQA 3KE1A 3B6NA 1U3PA 3P10A 1GX1A 3F0FA 3RE3A 3ELCA 4C81A 3GHZA 1JN1A 5B8FA 1IV3A 1U3LA 1W55A
chains in the Genus database with same CATH superfamily
2Q1XA 2Z1UA 3LWQC 3S02A 3C8LA 4ZHYB 5LOVA 1FNJA 3WPWA 1J7HA 2KTVA 3WJQA 5LYJA 3BYQA 3MBMA 3ZO8A 2GLZA 4NWOB 2H8CA 3ESJA 5J2UB 3CCSF 3RYCA 2IG8A 3WJPA 2Z1EA 4KWEA 3CCJF 1GX1A 1X52A 2ZODA 1OAPA 3WXMB 4DRXA 1VQ5F 2QEXF 3RYFB 1U3LA 2RB9A 3RA6A 2L26A 5BMVA 3G71F 4G4ZA 3HKBB 1S72F 4B45A 3OW2F 3L7QA 5EAZA 2NMUA 3E20B 3HKCB 3MCAB 1Q86H 4F6RB 3CYQA 3K2XA 3JARB 3QUWA 1VQ8F 4EI9A 4IHJB 2I6DA 3P0ZA 3V7EA 1VQ6F 5KMGA 3C9UA 2CVLA 2HRYA 3G4SF 4YJ3B 3TD4A 3VOBA 4ZI7B 5LP6B 1XHOA 3IR9A 5JH7A 3AGKA 2R6R1 3WGJA 2ZVZA 2G9IA 1NJIH 1XBIA 3WGKA 3WGNA 2HX0A 4U3JA 4BT4A 1U40A 4X20B 5EB1B 4TV9A 2VAMA 4C8GA 5HY4A 5J2TB 3JATB 3S0YA 2Q1YA 1CN7A 2HS3A 3CD6F 1Z5VA 1H47A 5IJ9B 3FPIA 1YJ9F 3F6MA 3P10A 5EIBD 4BVSA 5EB0A 4R40B 2FC3A 4XCQA 5FNVB 4FFBB 3M4SA 1RQ7A 5J2UA 3CPWF 3HKEB 4ZHQB 3JAKB 1KQSF 4BT2A 3RYFA 3NK6A 5GANK 4RHAA 3KIZA 2V9YA 2CW4A 2DYYA 3HKBA 1YI2F 4BVQA 5LP6C 3KE1A 2RHHA 3S03A 3HKCA 1DT9A 4F6RA 3WGLA 4TZZA 4RQOA 5B8FA 5LA6B 1VQ9F 4IHJA 5HY2A 2PMPA 3LWVC 1YGYA 3CC4F 3CCQF 4ZI7A 2OHWA 1JY8A 3P4EA 5LP6A 2R751 3PLAC 3QHDA 1ONIA 2BTOA 5ITZB 1VQLF 1W5FA 5AVMA 3I3FA 4X1YB 5CA0B 1FSZA 2I6RA 4X20A 4U3JB 2AIZP 3LWOC 5J2TA 3JATA 2CHTA 3CMEF 5A2QM 2N48A 4X3MA 4O4IB 5LXTB 5FJ4C 2ZF8A 1YHQF 1W55A 5IJ9A 4LNUB 3C9SA 4G4WA 1TUBB 3LMEA 3E22B 1VH8A 3SIUA 3CYPB 2ZVYA 2PHNA 3JAMM 3FD5A 1RLGA 3OBYA 3KJKA 3LFOA 5FNVA 4FFBA 1H7MA 2KGWA 3S0HA 3F0EA 3FFMA 3GTZA 1RA4A 3HKEA 4ZHQA 2VGNA 1W5EA 1W5AA 3JAKA 1ZWZA 1NQ3A 1Q7YH 1K73H 2OTLF 4I50B 1PXWA 1M1KH 2QA4F 4M8IA 5G4VC 4DXDA 2RHOA 4BVTA 4BY9D 3VYSC 3EORA 5MN5A 3DC2A 2CZWA 1QAHA 1IV4A 4O4JB 5LA6A 4BT7A 4ERHA 3HWUA 5HWEA 1SDSA 4HNAB 5GAPK 3R0PA 5IJ0B 1UFYA 1YJNF 5ITZA 4X1IB 1VK3A 3J7AR 5HP8A 3ERNA 4X1YA 1T0AA 5CA0A 1IPAA 4C4WC 3FBAA 2YXZA 3J81M 1VQVA 3KHNA 2MQEA 2EWCA 2H6LA 2UYNB 1XRGA 3JASB 1FNKA 4YJ2B 4O4IA 3JCMM 5LXTA 2UYJA 3N4ZA 1VHAA 5FLXM 3F0GA 4LNUA 2QI2A 3CXCF 2OTJF 2GZLA 3HKDA 1TUBA 5IYZB 1RLUA 4IIJB 3E22A 3QTYA 1OFUA 4LCKA 5JVDB 4PWTA 3ZP4A 4TUYB 3GHZA 3VO8A 2CSLA 4X1KB 4B62A 3G6EF 3N4YA 5CA1B 1ODEA 3I7TA 2LBTA 2KG4A 2LBWA 4I50A 2HRUA 2RHLA 1X7OA 5EYPB 3UT5B 1PF5A 3ON1A 3RYHB 1VQKF 3K0TA 1VQ7F 2VXYA 3IEQA 5MN4A 3B6NA 2F9ZC 1SA0B 4G4YA 4O4JA 5C8YB 2P6YA 1FFXB 1W40A 3PAFA 4BT5A 1CK2A 3MDOA 3HAXD 4ZOLB 2K1SA 3CCMF 2ZAUA 5KX5B 4HNAA 3CPQA 2KTUA 5IJ0A 1JFFB 3D54A 3OBWA 3VI6A 5MN6A 3CCEF 1H48A 2HS0A 3K14A 3LDTA 2CHSA 4X1IA 4ZHVA 1K8AH 1QD9A 3NVKE 3TD3A 4C82A 4O4LB 2Z01A 3CB2A 1JD1A 1CLIA 3JAWA 1K9MH 1T0KB 3IMPA 4U39A 1U3PA 2UYNA 5JCOC 3JASA 3CC2F 4YJ2A 1W41A 1W5BA 2Z1FA 3V4DA 1QVFF 4B46A 1VQ4F 3M84A 1KNKA 2VGMA 2B33A 5HY0A 5IYZA 2UZHA 4IIJA 3U0OA 2BTUA 3HKDB 1IV2A 5JVDA 3Q8HA 3CCVF 3HJWC 5JCOA 4TUYA 1R1MA 4EI8A 2QTPA 2UYPA 4X1KA 2WALA 1YITF 5GIPC 2LBXA 5CA1A 1YIJF 3LWRC 4I55B 5DCVA 1GO1A 2Z1TA 2HP0B 3NK7A 1M90H 5EYPA 2IAFA 4ZHWA 4O2BB 3D00A 1RQ2A 3RE3A 3UT5A 3LYBA 3RYHA 5EO3A 3CCRF 5IT9M 1W42A 1VQNF 2HVYD 3IKFA 1SA0A 5C8YA 1FFXA 1W57A 4O2AB 4EB6B 5EIBC 2RHJA 1QU9A 1W581 1KC8H 3SIVA 1UI9A 4ZOLA 4BVRA 5JQGB 5KX5A 3S0WA 1YJWF 4TV8B 3VCZA 1JFFA 3TD5A 4C81A 3F0FA 4WBNB 4O4HB 3N2KB 4X3LA 4O4LA 1NMUB 3C9TA 1X7PA 1GZ0A 3NVIB 5CB4B 3FD6A 2HQSC 2ZOVA 3OONA 3JAWB 3LWPC 3N2GB 3RYIA 5EZYB 2H8EA 2OZBA 3CG6A 1Z5WA 1Q82H 2BO1A 3JALB 5G4UC 2VAWA 3V7QA 3VYUC 3J80M 3MQWA 2LCAA 1TVKB 5GONB 2W8BC 4BT6A 1COMA 3WJRA 3WPXA 4NQ3A 4NUTA 3ZOPA 5HP7A 4I55A 2HP0A 2GVIA 4G88A 4I4TB 3VMFB 1W2BF 3IEWA 3F0DA 3CCLF 3NMUC 4O2BA 1VQOF 3S06A 4B5CA 2CWJA 3KJJA 4EI7A 1Q81H 1U43A 1VQPF 1GO0A 3IKEA 3V3TA 3HTNA 4BT3A 3VOAA 3K12A 4O2AA 5LOVB 2OTMA 1N8RH 4EB6A 3VIUA 3DDNA 3WGMA 5LYJB 5JQGA 2HP3A 4G4VA 4C8IA 4TV8A 3O85A 3RYCB 1QVGF 2JNBA 4WBNA 1JJ2F 3GYQA 5HXUA 4O4HA 3N2KA 2HS4A 1W3EX 3ZP7A 4E6EA 4BW0B 4DRXB 3JVHA 3I56F 3RA5A 3VTIC 5BMVB 5CB4A 3T80A 3C9RA 1YQNA 3MCQA 3N2GA 3ELCA 1Q8RA 5EZYA 3JARA 1JN1A 4ZK7A 3RYIB 2AMTA 3JALA 4YJ3A 1IV1A 1X25A 5KMGB 3E1YA 3CMAF 3M1XA 4G4XA 1KNJA 5GINC 2VAPA 5JH7B 3I55F 1TVKA 5GONA 3CCUF 1VQMF 2YYEA 2DT4A 1DBFA 4C8EA 2IQQA 5HY1A 3D01A 2AIFA 2ALEA 5HXZA 3CC7F 1XV2A 5GIOC 1E7KA 4TV9B 2FGYA 4I4TA 2UYKA 1W59A 3VYTC 5EWRA 1SZQA 1IV3A 2BTQB 1KD1H
chains in the Genus database with same CATH topology
1KNKA 2AMTA 3ERNA 1T0AA 1IV1A 2PMPA 2UZHA 3FBAA 4C8IA 1U40A 1IV2A 3EORA 3IKFA 3Q8HA 1JY8A 1VH8A 1W57A 1KNJA 4C8GA 1H48A 3IEWA 3QHDA 3K14A 1IV4A 3F0DA 3MBMA 1VHAA 3JVHA 3K2XA 3F0GA 4C82A 4C8EA 3P0ZA 1H47A 2GZLA 3ESJA 3F0EA 3F6MA 3FPIA 1U43A 3T80A 3IKEA 1YQNA 3IEQA 3KE1A 3B6NA 1U3PA 3P10A 1GX1A 3F0FA 3RE3A 3ELCA 4C81A 3GHZA 1JN1A 5B8FA 1IV3A 1U3LA 1W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNK A;  2AMT A;  3ERN A;  1T0A A;  1IV1 A;  2PMP A;  2UZH A;  3FBA A;  4C8I A;  1U40 A;  1IV2 A;  3EOR A;  3IKF A;  3Q8H A;  1JY8 A;  1VH8 A;  1W57 A;  1KNJ A;  4C8G A;  1H48 A;  3IEW A;  3QHD A;  3K14 A;  1IV4 A;  3F0D A;  3MBM A;  1VHA A;  3JVH A;  3K2X A;  3F0G A;  4C82 A;  4C8E A;  3P0Z A;  1H47 A;  2GZL A;  3ESJ A;  3F0E A;  3F6M A;  3FPI A;  1U43 A;  3T80 A;  3IKE A;  1YQN A;  3IEQ A;  3KE1 A;  3B6N A;  1U3P A;  3P10 A;  1GX1 A;  3F0F A;  3RE3 A;  3ELC A;  4C81 A;  3GHZ A;  1JN1 A;  5B8F A;  1IV3 A;  1U3L A;  1W55 A; 
#chains in the Genus database with same CATH topology
 2Q1X A;  2Z1U A;  3LWQ C;  3S02 A;  3C8L A;  4ZHY B;  5LOV A;  1FNJ A;  3WPW A;  1J7H A;  2KTV A;  3WJQ A;  5LYJ A;  3BYQ A;  3MBM A;  3ZO8 A;  2GLZ A;  4NWO B;  2H8C A;  3ESJ A;  5J2U B;  3CCS F;  3RYC A;  2IG8 A;  3WJP A;  2Z1E A;  4KWE A;  3CCJ F;  1GX1 A;  1X52 A;  2ZOD A;  1OAP A;  3WXM B;  4DRX A;  1VQ5 F;  2QEX F;  3RYF B;  1U3L A;  2RB9 A;  3RA6 A;  2L26 A;  5BMV A;  3G71 F;  4G4Z A;  3HKB B;  1S72 F;  4B45 A;  3OW2 F;  3L7Q A;  5EAZ A;  2NMU A;  3E20 B;  3HKC B;  3MCA B;  1Q86 H;  4F6R B;  3CYQ A;  3K2X A;  3JAR B;  3QUW A;  1VQ8 F;  4EI9 A;  4IHJ B;  2I6D A;  3P0Z A;  3V7E A;  1VQ6 F;  5KMG A;  3C9U A;  2CVL A;  2HRY A;  3G4S F;  4YJ3 B;  3TD4 A;  3VOB A;  4ZI7 B;  5LP6 B;  1XHO A;  3IR9 A;  5JH7 A;  3AGK A;  2R6R 1;  3WGJ A;  2ZVZ A;  2G9I A;  1NJI H;  1XBI A;  3WGK A;  3WGN A;  2HX0 A;  4U3J A;  4BT4 A;  1U40 A;  4X20 B;  5EB1 B;  4TV9 A;  2VAM A;  4C8G A;  5HY4 A;  5J2T B;  3JAT B;  3S0Y A;  2Q1Y A;  1CN7 A;  2HS3 A;  3CD6 F;  1Z5V A;  1H47 A;  5IJ9 B;  3FPI A;  1YJ9 F;  3F6M A;  3P10 A;  5EIB D;  4BVS A;  5EB0 A;  4R40 B;  2FC3 A;  4XCQ A;  5FNV B;  4FFB B;  3M4S A;  1RQ7 A;  5J2U A;  3CPW F;  3HKE B;  4ZHQ B;  3JAK B;  1KQS F;  4BT2 A;  3RYF A;  3NK6 A;  5GAN K;  4RHA A;  3KIZ A;  2V9Y A;  2CW4 A;  2DYY A;  3HKB A;  1YI2 F;  4BVQ A;  5LP6 C;  3KE1 A;  2RHH A;  3S03 A;  3HKC A;  1DT9 A;  4F6R A;  3WGL A;  4TZZ A;  4RQO A;  5B8F A;  5LA6 B;  1VQ9 F;  4IHJ A;  5HY2 A;  2PMP A;  3LWV C;  1YGY A;  3CC4 F;  3CCQ F;  4ZI7 A;  2OHW A;  1JY8 A;  3P4E A;  5LP6 A;  2R75 1;  3PLA C;  3QHD A;  1ONI A;  2BTO A;  5ITZ B;  1VQL F;  1W5F A;  5AVM A;  3I3F A;  4X1Y B;  5CA0 B;  1FSZ A;  2I6R A;  4X20 A;  4U3J B;  2AIZ P;  3LWO C;  5J2T A;  3JAT A;  2CHT A;  3CME F;  5A2Q M;  2N48 A;  4X3M A;  4O4I B;  5LXT B;  5FJ4 C;  2ZF8 A;  1YHQ F;  1W55 A;  5IJ9 A;  4LNU B;  3C9S A;  4G4W A;  1TUB B;  3LME A;  3E22 B;  1VH8 A;  3SIU A;  3CYP B;  2ZVY A;  2PHN A;  3JAM M;  3FD5 A;  1RLG A;  3OBY A;  3KJK A;  3LFO A;  5FNV A;  4FFB A;  1H7M A;  2KGW A;  3S0H A;  3F0E A;  3FFM A;  3GTZ A;  1RA4 A;  3HKE A;  4ZHQ A;  2VGN A;  1W5E A;  1W5A A;  3JAK A;  1ZWZ A;  1NQ3 A;  1Q7Y H;  1K73 H;  2OTL F;  4I50 B;  1PXW A;  1M1K H;  2QA4 F;  4M8I A;  5G4V C;  4DXD A;  2RHO A;  4BVT A;  4BY9 D;  3VYS C;  3EOR A;  5MN5 A;  3DC2 A;  2CZW A;  1QAH A;  1IV4 A;  4O4J B;  5LA6 A;  4BT7 A;  4ERH A;  3HWU A;  5HWE A;  1SDS A;  4HNA B;  5GAP K;  3R0P A;  5IJ0 B;  1UFY A;  1YJN F;  5ITZ A;  4X1I B;  1VK3 A;  3J7A R;  5HP8 A;  3ERN A;  4X1Y A;  1T0A A;  5CA0 A;  1IPA A;  4C4W C;  3FBA A;  2YXZ A;  3J81 M;  1VQV A;  3KHN A;  2MQE A;  2EWC A;  2H6L A;  2UYN B;  1XRG A;  3JAS B;  1FNK A;  4YJ2 B;  4O4I A;  3JCM M;  5LXT A;  2UYJ A;  3N4Z A;  1VHA A;  5FLX M;  3F0G A;  4LNU A;  2QI2 A;  3CXC F;  2OTJ F;  2GZL A;  3HKD A;  1TUB A;  5IYZ B;  1RLU A;  4IIJ B;  3E22 A;  3QTY A;  1OFU A;  4LCK A;  5JVD B;  4PWT A;  3ZP4 A;  4TUY B;  3GHZ A;  3VO8 A;  2CSL A;  4X1K B;  4B62 A;  3G6E F;  3N4Y A;  5CA1 B;  1ODE A;  3I7T A;  2LBT A;  2KG4 A;  2LBW A;  4I50 A;  2HRU A;  2RHL A;  1X7O A;  5EYP B;  3UT5 B;  1PF5 A;  3ON1 A;  3RYH B;  1VQK F;  3K0T A;  1VQ7 F;  2VXY A;  3IEQ A;  5MN4 A;  3B6N A;  2F9Z C;  1SA0 B;  4G4Y A;  4O4J A;  5C8Y B;  2P6Y A;  1FFX B;  1W40 A;  3PAF A;  4BT5 A;  1CK2 A;  3MDO A;  3HAX D;  4ZOL B;  2K1S A;  3CCM F;  2ZAU A;  5KX5 B;  4HNA A;  3CPQ A;  2KTU A;  5IJ0 A;  1JFF B;  3D54 A;  3OBW A;  3VI6 A;  5MN6 A;  3CCE F;  1H48 A;  2HS0 A;  3K14 A;  3LDT A;  2CHS A;  4X1I A;  4ZHV A;  1K8A H;  1QD9 A;  3NVK E;  3TD3 A;  4C82 A;  4O4L B;  2Z01 A;  3CB2 A;  1JD1 A;  1CLI A;  3JAW A;  1K9M H;  1T0K B;  3IMP A;  4U39 A;  1U3P A;  2UYN A;  5JCO C;  3JAS A;  3CC2 F;  4YJ2 A;  1W41 A;  1W5B A;  2Z1F A;  3V4D A;  1QVF F;  4B46 A;  1VQ4 F;  3M84 A;  1KNK A;  2VGM A;  2B33 A;  5HY0 A;  5IYZ A;  2UZH A;  4IIJ A;  3U0O A;  2BTU A;  3HKD B;  1IV2 A;  5JVD A;  3Q8H A;  3CCV F;  3HJW C;  5JCO A;  4TUY A;  1R1M A;  4EI8 A;  2QTP A;  2UYP A;  4X1K A;  2WAL A;  1YIT F;  5GIP C;  2LBX A;  5CA1 A;  1YIJ F;  3LWR C;  4I55 B;  5DCV A;  1GO1 A;  2Z1T A;  2HP0 B;  3NK7 A;  1M90 H;  5EYP A;  2IAF A;  4ZHW A;  4O2B B;  3D00 A;  1RQ2 A;  3RE3 A;  3UT5 A;  3LYB A;  3RYH A;  5EO3 A;  3CCR F;  5IT9 M;  1W42 A;  1VQN F;  2HVY D;  3IKF A;  1SA0 A;  5C8Y A;  1FFX A;  1W57 A;  4O2A B;  4EB6 B;  5EIB C;  2RHJ A;  1QU9 A;  1W58 1;  1KC8 H;  3SIV A;  1UI9 A;  4ZOL A;  4BVR A;  5JQG B;  5KX5 A;  3S0W A;  1YJW F;  4TV8 B;  3VCZ A;  1JFF A;  3TD5 A;  4C81 A;  3F0F A;  4WBN B;  4O4H B;  3N2K B;  4X3L A;  4O4L A;  1NMU B;  3C9T A;  1X7P A;  1GZ0 A;  3NVI B;  5CB4 B;  3FD6 A;  2HQS C;  2ZOV A;  3OON A;  3JAW B;  3LWP C;  3N2G B;  3RYI A;  5EZY B;  2H8E A;  2OZB A;  3CG6 A;  1Z5W A;  1Q82 H;  2BO1 A;  3JAL B;  5G4U C;  2VAW A;  3V7Q A;  3VYU C;  3J80 M;  3MQW A;  2LCA A;  1TVK B;  5GON B;  2W8B C;  4BT6 A;  1COM A;  3WJR A;  3WPX A;  4NQ3 A;  4NUT A;  3ZOP A;  5HP7 A;  4I55 A;  2HP0 A;  2GVI A;  4G88 A;  4I4T B;  3VMF B;  1W2B F;  3IEW A;  3F0D A;  3CCL F;  3NMU C;  4O2B A;  1VQO F;  3S06 A;  4B5C A;  2CWJ A;  3KJJ A;  4EI7 A;  1Q81 H;  1U43 A;  1VQP F;  1GO0 A;  3IKE A;  3V3T A;  3HTN A;  4BT3 A;  3VOA A;  3K12 A;  4O2A A;  5LOV B;  2OTM A;  1N8R H;  4EB6 A;  3VIU A;  3DDN A;  3WGM A;  5LYJ B;  5JQG A;  2HP3 A;  4G4V A;  4C8I A;  4TV8 A;  3O85 A;  3RYC B;  1QVG F;  2JNB A;  4WBN A;  1JJ2 F;  3GYQ A;  5HXU A;  4O4H A;  3N2K A;  2HS4 A;  1W3E X;  3ZP7 A;  4E6E A;  4BW0 B;  4DRX B;  3JVH A;  3I56 F;  3RA5 A;  3VTI C;  5BMV B;  5CB4 A;  3T80 A;  3C9R A;  1YQN A;  3MCQ A;  3N2G A;  3ELC A;  1Q8R A;  5EZY A;  3JAR A;  1JN1 A;  4ZK7 A;  3RYI B;  2AMT A;  3JAL A;  4YJ3 A;  1IV1 A;  1X25 A;  5KMG B;  3E1Y A;  3CMA F;  3M1X A;  4G4X A;  1KNJ A;  5GIN C;  2VAP A;  5JH7 B;  3I55 F;  1TVK A;  5GON A;  3CCU F;  1VQM F;  2YYE A;  2DT4 A;  1DBF A;  4C8E A;  2IQQ A;  5HY1 A;  3D01 A;  2AIF A;  2ALE A;  5HXZ A;  3CC7 F;  1XV2 A;  5GIO C;  1E7K A;  4TV9 B;  2FGY A;  4I4T A;  2UYK A;  1W59 A;  3VYT C;  5EWR A;  1SZQ A;  1IV3 A;  2BTQ B;  1KD1 H; 
#chains in the Genus database with same CATH homology
 1KNK A;  2AMT A;  3ERN A;  1T0A A;  1IV1 A;  2PMP A;  2UZH A;  3FBA A;  4C8I A;  1U40 A;  1IV2 A;  3EOR A;  3IKF A;  3Q8H A;  1JY8 A;  1VH8 A;  1W57 A;  1KNJ A;  4C8G A;  1H48 A;  3IEW A;  3QHD A;  3K14 A;  1IV4 A;  3F0D A;  3MBM A;  1VHA A;  3JVH A;  3K2X A;  3F0G A;  4C82 A;  4C8E A;  3P0Z A;  1H47 A;  2GZL A;  3ESJ A;  3F0E A;  3F6M A;  3FPI A;  1U43 A;  3T80 A;  3IKE A;  1YQN A;  3IEQ A;  3KE1 A;  3B6N A;  1U3P A;  3P10 A;  1GX1 A;  3F0F A;  3RE3 A;  3ELC A;  4C81 A;  3GHZ A;  1JN1 A;  5B8F A;  1IV3 A;  1U3L A;  1W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...