1H48A

The structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Synthase
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h48A00
2PMPA 3JVHA 3P10A 1IV2A 3FPIA 3IEWA 1H48A 1IV4A 3IKEA 3GHZA 1W55A 3K2XA 1U43A 3F0EA 3IEQA 3P0ZA 1KNKA 1U40A 1GX1A 3MBMA 1JY8A 3ELCA 1U3PA 3IKFA 1H47A 3F0GA 4C81A 4C82A 1JN1A 1U3LA 2GZLA 4C8IA 3F0DA 1W57A 3QHDA 3RE3A 1YQNA 4C8EA 4C8GA 1IV1A 3F6MA 3EORA 3B6NA 2UZHA 1KNJA 3KE1A 1IV3A 3ESJA 2AMTA 3FBAA 3K14A 3Q8HA 3T80A 3F0FA 5B8FA 1VHAA 1VH8A 3ERNA 1T0AA
chains in the Genus database with same CATH superfamily
3LWRC 3CCSF 2Z01A 1TUBA 5HY4A 2VGNA 4O4HA 4EB6B 3IEQA 1XRGA 3VTIC 5CB4B 3P0ZA 4ZHYB 4G4WA 1H7MA 3WGJA 5GAPK 4C82A 3TD4A 5LP6C 2DT4A 5GONB 3HJWC 3C9TA 3OW2F 3VCZA 5IJ9A 4C8EA 4C8GA 5LOVA 2VAWA 3V4DA 5JQGA 2RB9A 5AVMA 3C9RA 3DDNA 2VAMA 3HKCB 2I6DA 2LBWA 4TV9A 4ZHQA 5JH7B 2R751 5C8YA 1RA4A 2VGMA 5CA0A 1H48A 2RHOA 1X7OA 3HKEA 5ITZB 5LP6B 2RHJA 5MN4A 3CMAF 5IT9M 3BYQA 2Z1FA 5G4VC 4BT6A 2ZOVA 3ON1A 4U3JA 3CCEF 1VQKF 2YYEA 1VQ6F 1UFYA 1CLIA 5CA1B 1W42A 3FD5A 4O4LB 4B46A 3CC4F 5BMVB 2AMTA 3IR9A 4EB6A 3CMEF 1KNJA 3JALB 4X20B 4RHAA 2IG8A 3ZO8A 2ZAUA 4I55B 5MN6A 2AIFA 4X1IB 5GONA 1KNKA 3K12A 3S0YA 3NVKE 1X7PA 1YJWF 2KGWA 3CCRF 4BT3A 3KJJA 1OAPA 3I3FA 4YJ3B 3HKCA 5JVDB 4YJ2B 3HKDB 4TUYB 5EZYB 1K9MH 3RYIB 5EIBC 5JH7A 1JJ2F 2LBXA 3N2GA 3KE1A 4LNUB 5ITZA 5LP6A 1K73H 1ONIA 2AIZP 3JVHA 1VQ7F 2KTVA 1Q82H 1Q86H 1Q8RA 1VQPF 1X25A 2H8EA 5FLXM 5CA1A 3IKFA 3C9SA 3WGKA 4O4LA 3RYFB 4BT4A 3S06A 3JALA 4X3LA 1XHOA 3ESJA 3N2KB 4I55A 5IJ9B 1YGYA 5JQGB 1KC8H 1XV2A 4X1IA 2LBTA 1PXWA 2OTLF 3FD6A 3GHZA 4ZHQB 3N4ZA 1VQOF 4YJ3A 1W40A 5JVDA 4IHJB 4YJ2A 3WPWA 5CA0B 2PHNA 4TUYA 5EZYA 3RYIA 3G6EF 2L26A 2I6RA 5FJ4C 4LNUA 1UI9A 3JATB 1X52A 2CZWA 3I7TA 5HY2A 3MCAB 5GIOC 5GIPC 1VHAA 1YITF 4BW0B 1ZWZA 4DRXA 4E6EA 1QVFF 3CXCF 3M4SA 1QD9A 2VAPA 1YJ9F 3KHNA 1NJIH 4I50B 3RYCB 1COMA 3HTNA 4G4VA 3G71F 3RYFA 2OHWA 2Q1XA 2EWCA 1VK3A 4U39A 3N2KA 1PF5A 4ZHWA 2HVYD 3HAXD 3S03A 1IV3A 4I4TB 4B5CA 3CCLF 4B45A 1S72F 3NK7A 3J81M 3WGLA 3N2GB 2KTUA 3IEWA 4IHJA 2P6YA 3CYPB 1VQNF 5G4UC 3V3TA 4ERHA 1GX1A 2HS3A 3JATA 1VQLF 3NK6A 3P4EA 4PWTA 5HWEA 3PLAC 2OTJF 1K8AH 2W8BC 3JAMM 3LFOA 3CCJF 4I50A 3LWOC 3WPXA 1VH8A 3VYTC 1Z5WA 3RYCA 3CCVF 2ZVZA 3OBWA 4X1KA 2HRUA 3GTZA 3MCQA 2RHHA 1N8RH 2RHLA 1W55A 3OONA 3VIUA 2HP0B 3VYUC 3C9UA 3MBMA 1H47A 4TZZA 1W3EX 4BVTA 4O4IB 5IYZB 2H8CA 3V7QA 4I4TA 1TVKA 3VYSC 3ZP7A 3VMFB 3RA6A 3AGKA 3WGMA 1E7KA 5B8FA 1NQ3A 3S02A 2ZODA 5LA6B 2K1SA 4BT2A 4ZK7A 2ZVYA 4NUTA 4DRXB 3I56F 2G9IA 4EI8A 1JY8A 2B33A 4XCQA 2HQSC 4C81A 4BT5A 4RQOA 4C8IA 1W5EA 3ZP4A 1OFUA 5EO3A 3LWVC 2Z1UA 1QVGF 1GO1A 1Q7YH 1JD1A 1DT9A 1GO0A 1T0AA 3MDOA 1FSZA 2HP0A 3QTYA 3UT5B 3CD6F 3FPIA 3U0OA 1YHQF 2UYNB 1W5FA 2QI2A 2CW4A 4FFBB 4G4YA 4O4IA 4B62A 1W5AA 1CK2A 2OTMA 5IYZA 3E20B 3DC2A 2QTPA 3V7EA 3WJPA 2HS0A 1YQNA 2IAFA 5HXUA 2FC3A 3NVIB 4O2BB 1RQ2A 4TV8B 2UYPA 1SDSA 2JNBA 2VXYA 5LA6A 3E22B 4BVRA 1JFFA 3FBAA 3K14A 1W59A 3F0FA 3LWQC 2F9ZC 5HP7A 4G4ZA 1QAHA 1M90H 3ZOPA 2V9YA 4X3MA 3VOBA 1VQ8F 3JARA 4BY9D 1XBIA 3SIVA 1R1MA 4X1KB 5FNVB 5EYPB 5J2TB 1W581 4HNAB 3RA5A 1SZQA 3CPWF 2FGYA 3QUWA 3QHDA 2UYJA 4KWEA 4LCKA 4BVSA 1IV1A 5LXTA 3TD3A 2QA4F 3WGNA 4X1YB 2KG4A 2Z1EA 3WXMB 4EI9A 3UT5A 5KMGB 3SIUA 1TVKB 1SA0B 4ZI7B 3IMPA 5DCVA 2UYNA 5EB0A 4FFBA 3N4YA 1M1KH 4R40B 4G4XA 5JCOA 2LCAA 1Q81H 5HY0A 4ZHVA 3J7AR 5HXZA 4O2BA 3F0GA 4F6RB 4TV8A 3CPQA 3OBYA 3E22A 3LYBA 5LYJA 5J2UB 3JASB 2Z1TA 3G4SF 3LMEA 3EORA 2UZHA 2BTUA 4O2AB 2CWJA 3T80A 5KX5B 5EAZA 4M8IA 2R6R1 3RYHB 3D54A 5FNVA 5EYPA 3R0PA 1VQ9F 5J2TA 3CCQF 1RLGA 1VQ5F 4C4WC 1RLUA 4HNAA 1U40A 2CSLA 5A2QM 3NMUC 3J80M 3LWPC 1J7HA 3GYQA 1JN1A 5GANK 4IIJA 4EI7A 3CC2F 2GVIA 4X1YA 3D00A 5IJ0B 3PAFA 5GINC 2GLZA 5KMGA 1YIJF 2CHTA 1SA0A 3F6MA 4ZI7A 1YI2F 1FNJA 3Q8HA 5EB1B 3E1YA 3S0WA 1GZ0A 2ALEA 2BO1A 5CB4A 3FFMA 4WBNB 1IPAA 3JAKB 1FFXB 1VQ4F 1IV2A 1JFFB 2OZBA 1IV4A 3IKEA 5EWRA 4F6RA 3K2XA 1U43A 2N48A 3ELCA 1U3PA 3JAWB 4ZOLB 5HP8A 3JASA 2BTQB 3M84A 3VO8A 5J2UA 3CCUF 3S0HA 3JARB 1W2BF 2HX0A 4O2AA 4O4JB 1KQSF 5KX5A 1YJNF 1RQ7A 3TD5A 5HY1A 3VI6A 3VOAA 3RYHA 2CHSA 5JCOC 3CCMF 2QEXF 3WJQA 4BT7A 2ZF8A 2HRYA 1VQMF 3D01A 3JCMM 3HKBB 5LXTB 2PMPA 2HS4A 3K0TA 1Z5VA 2WALA 1W5BA 3O85A 3HWUA 4NWOB 3F0EA 4NQ3A 5MN5A 2DYYA 1TUBB 5IJ0A 2H6LA 4O4HB 1FNKA 2UYKA 2GZLA 1W41A 2IQQA 2Q1YA 2YXZA 5BMVA 3RE3A 1NMUB 4X20A 3CYQA 1CN7A 2MQEA 3KIZA 4WBNA 1VQVA 3JAKA 1FFXA 3L7QA 4DXDA 5LOVB 5LYJB 1DBFA 3CG6A 1KD1H 3P10A 2CVLA 3JAWA 3M1XA 4TV9B 4ZOLA 1QU9A 5C8YB 4BVQA 5EIBD 1ODEA 3HKEB 3HKDA 4O4JA 3I55F 1U3LA 3WJRA 3F0DA 3CC7F 1W57A 3CB2A 4G88A 3HKBA 4U3JB 3KJKA 4IIJB 3B6NA 3LDTA 1T0KB 2BTOA 3MQWA 3C8LA 2HP3A 2NMUA 3ERNA
chains in the Genus database with same CATH topology
2PMPA 3JVHA 3P10A 1IV2A 3FPIA 3IEWA 1H48A 1IV4A 3IKEA 3GHZA 1W55A 3K2XA 1U43A 3F0EA 3IEQA 3P0ZA 1KNKA 1U40A 1GX1A 3MBMA 1JY8A 3ELCA 1U3PA 3IKFA 1H47A 3F0GA 4C81A 4C82A 1JN1A 1U3LA 2GZLA 4C8IA 3F0DA 1W57A 3QHDA 3RE3A 1YQNA 4C8EA 4C8GA 1IV1A 3F6MA 3EORA 3B6NA 2UZHA 1KNJA 3KE1A 1IV3A 3ESJA 2AMTA 3FBAA 3K14A 3Q8HA 3T80A 3F0FA 5B8FA 1VHAA 1VH8A 3ERNA 1T0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMP A;  3JVH A;  3P10 A;  1IV2 A;  3FPI A;  3IEW A;  1H48 A;  1IV4 A;  3IKE A;  3GHZ A;  1W55 A;  3K2X A;  1U43 A;  3F0E A;  3IEQ A;  3P0Z A;  1KNK A;  1U40 A;  1GX1 A;  3MBM A;  1JY8 A;  3ELC A;  1U3P A;  3IKF A;  1H47 A;  3F0G A;  4C81 A;  4C82 A;  1JN1 A;  1U3L A;  2GZL A;  4C8I A;  3F0D A;  1W57 A;  3QHD A;  3RE3 A;  1YQN A;  4C8E A;  4C8G A;  1IV1 A;  3F6M A;  3EOR A;  3B6N A;  2UZH A;  1KNJ A;  3KE1 A;  1IV3 A;  3ESJ A;  2AMT A;  3FBA A;  3K14 A;  3Q8H A;  3T80 A;  3F0F A;  5B8F A;  1VHA A;  1VH8 A;  3ERN A;  1T0A A; 
#chains in the Genus database with same CATH topology
 3LWR C;  3CCS F;  2Z01 A;  1TUB A;  5HY4 A;  2VGN A;  4O4H A;  4EB6 B;  3IEQ A;  1XRG A;  3VTI C;  5CB4 B;  3P0Z A;  4ZHY B;  4G4W A;  1H7M A;  3WGJ A;  5GAP K;  4C82 A;  3TD4 A;  5LP6 C;  2DT4 A;  5GON B;  3HJW C;  3C9T A;  3OW2 F;  3VCZ A;  5IJ9 A;  4C8E A;  4C8G A;  5LOV A;  2VAW A;  3V4D A;  5JQG A;  2RB9 A;  5AVM A;  3C9R A;  3DDN A;  2VAM A;  3HKC B;  2I6D A;  2LBW A;  4TV9 A;  4ZHQ A;  5JH7 B;  2R75 1;  5C8Y A;  1RA4 A;  2VGM A;  5CA0 A;  1H48 A;  2RHO A;  1X7O A;  3HKE A;  5ITZ B;  5LP6 B;  2RHJ A;  5MN4 A;  3CMA F;  5IT9 M;  3BYQ A;  2Z1F A;  5G4V C;  4BT6 A;  2ZOV A;  3ON1 A;  4U3J A;  3CCE F;  1VQK F;  2YYE A;  1VQ6 F;  1UFY A;  1CLI A;  5CA1 B;  1W42 A;  3FD5 A;  4O4L B;  4B46 A;  3CC4 F;  5BMV B;  2AMT A;  3IR9 A;  4EB6 A;  3CME F;  1KNJ A;  3JAL B;  4X20 B;  4RHA A;  2IG8 A;  3ZO8 A;  2ZAU A;  4I55 B;  5MN6 A;  2AIF A;  4X1I B;  5GON A;  1KNK A;  3K12 A;  3S0Y A;  3NVK E;  1X7P A;  1YJW F;  2KGW A;  3CCR F;  4BT3 A;  3KJJ A;  1OAP A;  3I3F A;  4YJ3 B;  3HKC A;  5JVD B;  4YJ2 B;  3HKD B;  4TUY B;  5EZY B;  1K9M H;  3RYI B;  5EIB C;  5JH7 A;  1JJ2 F;  2LBX A;  3N2G A;  3KE1 A;  4LNU B;  5ITZ A;  5LP6 A;  1K73 H;  1ONI A;  2AIZ P;  3JVH A;  1VQ7 F;  2KTV A;  1Q82 H;  1Q86 H;  1Q8R A;  1VQP F;  1X25 A;  2H8E A;  5FLX M;  5CA1 A;  3IKF A;  3C9S A;  3WGK A;  4O4L A;  3RYF B;  4BT4 A;  3S06 A;  3JAL A;  4X3L A;  1XHO A;  3ESJ A;  3N2K B;  4I55 A;  5IJ9 B;  1YGY A;  5JQG B;  1KC8 H;  1XV2 A;  4X1I A;  2LBT A;  1PXW A;  2OTL F;  3FD6 A;  3GHZ A;  4ZHQ B;  3N4Z A;  1VQO F;  4YJ3 A;  1W40 A;  5JVD A;  4IHJ B;  4YJ2 A;  3WPW A;  5CA0 B;  2PHN A;  4TUY A;  5EZY A;  3RYI A;  3G6E F;  2L26 A;  2I6R A;  5FJ4 C;  4LNU A;  1UI9 A;  3JAT B;  1X52 A;  2CZW A;  3I7T A;  5HY2 A;  3MCA B;  5GIO C;  5GIP C;  1VHA A;  1YIT F;  4BW0 B;  1ZWZ A;  4DRX A;  4E6E A;  1QVF F;  3CXC F;  3M4S A;  1QD9 A;  2VAP A;  1YJ9 F;  3KHN A;  1NJI H;  4I50 B;  3RYC B;  1COM A;  3HTN A;  4G4V A;  3G71 F;  3RYF A;  2OHW A;  2Q1X A;  2EWC A;  1VK3 A;  4U39 A;  3N2K A;  1PF5 A;  4ZHW A;  2HVY D;  3HAX D;  3S03 A;  1IV3 A;  4I4T B;  4B5C A;  3CCL F;  4B45 A;  1S72 F;  3NK7 A;  3J81 M;  3WGL A;  3N2G B;  2KTU A;  3IEW A;  4IHJ A;  2P6Y A;  3CYP B;  1VQN F;  5G4U C;  3V3T A;  4ERH A;  1GX1 A;  2HS3 A;  3JAT A;  1VQL F;  3NK6 A;  3P4E A;  4PWT A;  5HWE A;  3PLA C;  2OTJ F;  1K8A H;  2W8B C;  3JAM M;  3LFO A;  3CCJ F;  4I50 A;  3LWO C;  3WPX A;  1VH8 A;  3VYT C;  1Z5W A;  3RYC A;  3CCV F;  2ZVZ A;  3OBW A;  4X1K A;  2HRU A;  3GTZ A;  3MCQ A;  2RHH A;  1N8R H;  2RHL A;  1W55 A;  3OON A;  3VIU A;  2HP0 B;  3VYU C;  3C9U A;  3MBM A;  1H47 A;  4TZZ A;  1W3E X;  4BVT A;  4O4I B;  5IYZ B;  2H8C A;  3V7Q A;  4I4T A;  1TVK A;  3VYS C;  3ZP7 A;  3VMF B;  3RA6 A;  3AGK A;  3WGM A;  1E7K A;  5B8F A;  1NQ3 A;  3S02 A;  2ZOD A;  5LA6 B;  2K1S A;  4BT2 A;  4ZK7 A;  2ZVY A;  4NUT A;  4DRX B;  3I56 F;  2G9I A;  4EI8 A;  1JY8 A;  2B33 A;  4XCQ A;  2HQS C;  4C81 A;  4BT5 A;  4RQO A;  4C8I A;  1W5E A;  3ZP4 A;  1OFU A;  5EO3 A;  3LWV C;  2Z1U A;  1QVG F;  1GO1 A;  1Q7Y H;  1JD1 A;  1DT9 A;  1GO0 A;  1T0A A;  3MDO A;  1FSZ A;  2HP0 A;  3QTY A;  3UT5 B;  3CD6 F;  3FPI A;  3U0O A;  1YHQ F;  2UYN B;  1W5F A;  2QI2 A;  2CW4 A;  4FFB B;  4G4Y A;  4O4I A;  4B62 A;  1W5A A;  1CK2 A;  2OTM A;  5IYZ A;  3E20 B;  3DC2 A;  2QTP A;  3V7E A;  3WJP A;  2HS0 A;  1YQN A;  2IAF A;  5HXU A;  2FC3 A;  3NVI B;  4O2B B;  1RQ2 A;  4TV8 B;  2UYP A;  1SDS A;  2JNB A;  2VXY A;  5LA6 A;  3E22 B;  4BVR A;  1JFF A;  3FBA A;  3K14 A;  1W59 A;  3F0F A;  3LWQ C;  2F9Z C;  5HP7 A;  4G4Z A;  1QAH A;  1M90 H;  3ZOP A;  2V9Y A;  4X3M A;  3VOB A;  1VQ8 F;  3JAR A;  4BY9 D;  1XBI A;  3SIV A;  1R1M A;  4X1K B;  5FNV B;  5EYP B;  5J2T B;  1W58 1;  4HNA B;  3RA5 A;  1SZQ A;  3CPW F;  2FGY A;  3QUW A;  3QHD A;  2UYJ A;  4KWE A;  4LCK A;  4BVS A;  1IV1 A;  5LXT A;  3TD3 A;  2QA4 F;  3WGN A;  4X1Y B;  2KG4 A;  2Z1E A;  3WXM B;  4EI9 A;  3UT5 A;  5KMG B;  3SIU A;  1TVK B;  1SA0 B;  4ZI7 B;  3IMP A;  5DCV A;  2UYN A;  5EB0 A;  4FFB A;  3N4Y A;  1M1K H;  4R40 B;  4G4X A;  5JCO A;  2LCA A;  1Q81 H;  5HY0 A;  4ZHV A;  3J7A R;  5HXZ A;  4O2B A;  3F0G A;  4F6R B;  4TV8 A;  3CPQ A;  3OBY A;  3E22 A;  3LYB A;  5LYJ A;  5J2U B;  3JAS B;  2Z1T A;  3G4S F;  3LME A;  3EOR A;  2UZH A;  2BTU A;  4O2A B;  2CWJ A;  3T80 A;  5KX5 B;  5EAZ A;  4M8I A;  2R6R 1;  3RYH B;  3D54 A;  5FNV A;  5EYP A;  3R0P A;  1VQ9 F;  5J2T A;  3CCQ F;  1RLG A;  1VQ5 F;  4C4W C;  1RLU A;  4HNA A;  1U40 A;  2CSL A;  5A2Q M;  3NMU C;  3J80 M;  3LWP C;  1J7H A;  3GYQ A;  1JN1 A;  5GAN K;  4IIJ A;  4EI7 A;  3CC2 F;  2GVI A;  4X1Y A;  3D00 A;  5IJ0 B;  3PAF A;  5GIN C;  2GLZ A;  5KMG A;  1YIJ F;  2CHT A;  1SA0 A;  3F6M A;  4ZI7 A;  1YI2 F;  1FNJ A;  3Q8H A;  5EB1 B;  3E1Y A;  3S0W A;  1GZ0 A;  2ALE A;  2BO1 A;  5CB4 A;  3FFM A;  4WBN B;  1IPA A;  3JAK B;  1FFX B;  1VQ4 F;  1IV2 A;  1JFF B;  2OZB A;  1IV4 A;  3IKE A;  5EWR A;  4F6R A;  3K2X A;  1U43 A;  2N48 A;  3ELC A;  1U3P A;  3JAW B;  4ZOL B;  5HP8 A;  3JAS A;  2BTQ B;  3M84 A;  3VO8 A;  5J2U A;  3CCU F;  3S0H A;  3JAR B;  1W2B F;  2HX0 A;  4O2A A;  4O4J B;  1KQS F;  5KX5 A;  1YJN F;  1RQ7 A;  3TD5 A;  5HY1 A;  3VI6 A;  3VOA A;  3RYH A;  2CHS A;  5JCO C;  3CCM F;  2QEX F;  3WJQ A;  4BT7 A;  2ZF8 A;  2HRY A;  1VQM F;  3D01 A;  3JCM M;  3HKB B;  5LXT B;  2PMP A;  2HS4 A;  3K0T A;  1Z5V A;  2WAL A;  1W5B A;  3O85 A;  3HWU A;  4NWO B;  3F0E A;  4NQ3 A;  5MN5 A;  2DYY A;  1TUB B;  5IJ0 A;  2H6L A;  4O4H B;  1FNK A;  2UYK A;  2GZL A;  1W41 A;  2IQQ A;  2Q1Y A;  2YXZ A;  5BMV A;  3RE3 A;  1NMU B;  4X20 A;  3CYQ A;  1CN7 A;  2MQE A;  3KIZ A;  4WBN A;  1VQV A;  3JAK A;  1FFX A;  3L7Q A;  4DXD A;  5LOV B;  5LYJ B;  1DBF A;  3CG6 A;  1KD1 H;  3P10 A;  2CVL A;  3JAW A;  3M1X A;  4TV9 B;  4ZOL A;  1QU9 A;  5C8Y B;  4BVQ A;  5EIB D;  1ODE A;  3HKE B;  3HKD A;  4O4J A;  3I55 F;  1U3L A;  3WJR A;  3F0D A;  3CC7 F;  1W57 A;  3CB2 A;  4G88 A;  3HKB A;  4U3J B;  3KJK A;  4IIJ B;  3B6N A;  3LDT A;  1T0K B;  2BTO A;  3MQW A;  3C8L A;  2HP3 A;  2NMU A;  3ERN A; 
#chains in the Genus database with same CATH homology
 2PMP A;  3JVH A;  3P10 A;  1IV2 A;  3FPI A;  3IEW A;  1H48 A;  1IV4 A;  3IKE A;  3GHZ A;  1W55 A;  3K2X A;  1U43 A;  3F0E A;  3IEQ A;  3P0Z A;  1KNK A;  1U40 A;  1GX1 A;  3MBM A;  1JY8 A;  3ELC A;  1U3P A;  3IKF A;  1H47 A;  3F0G A;  4C81 A;  4C82 A;  1JN1 A;  1U3L A;  2GZL A;  4C8I A;  3F0D A;  1W57 A;  3QHD A;  3RE3 A;  1YQN A;  4C8E A;  4C8G A;  1IV1 A;  3F6M A;  3EOR A;  3B6N A;  2UZH A;  1KNJ A;  3KE1 A;  1IV3 A;  3ESJ A;  2AMT A;  3FBA A;  3K14 A;  3Q8H A;  3T80 A;  3F0F A;  5B8F A;  1VHA A;  1VH8 A;  3ERN A;  1T0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...