1H48A

The structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL-2,4-CYCLODIPHOSPHATE SYNTHASE
molecule tags Synthase
source organism Escherichia coli
publication title The Identification of Isoprenoids that Bind in the Intersubunit Cavity of Escherichia Coli 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase by Complementary Biophysical Methods
pubmed doi rcsb
total genus 51
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1h48A00
3P0ZA 3F0DA 3F0GA 1JN1A 1U3PA 4C8IA 1GX1A 3F0EA 3MBMA 1JY8A 1U40A 3ELCA 3F6MA 5B8FA 1YQNA 1T0AA 1VHAA 3K14A 3T80A 3JVHA 4C8GA 3K2XA 1H48A 3KE1A 1W57A 1U3LA 4C81A 2GZLA 1VH8A 3GHZA 1IV4A 1H47A 3P10A 3F0FA 3IEQA 1IV2A 2AMTA 2PMPA 3IEWA 3QHDA 4C8EA 3EORA 3Q8HA 1U43A 1W55A 3FPIA 1IV1A 1IV3A 3ESJA 3IKEA 4C82A 3IKFA 3FBAA 1KNJA 3RE3A 1KNKA 3ERNA 2UZHA 3B6NA
chains in the Genus database with same CATH superfamily
3WGKA 1W2BF 5EZYB 5EZYA 1GX1A 2Z1FA 3F0EA 2QTPA 1FNKA 1GO1A 3S06A 3JAKA 4EB6B 3J80M 5GAPK 3CCQF 3KJKA 3JAMM 5LP6C 3F0FA 5IJ9B 2PMPA 3IEWA 5IJ0B 2EWCA 3CCVF 5HP8A 3LFOA 4B46A 5JVDA 1RQ2A 3WJQA 5JQGA 5KMGA 3DDNA 2VXYA 3MQWA 3M4SA 1XBIA 3RE3A 2HQSC 3RYCB 1ZWZA 3JATA 1PF5A 1OAPA 1X7OA 4F6RA 3HJWC 1E7KA 2MQEA 2W8BC 3WGJA 1QU9A 1CN7A 4I55B 2NMUA 2OTMA 5FNVA 1YQNA 4PWTA 3MCQA 1T0AA 5LYJB 1VK3A 2GZLA 4O4IB 4ZI7B 1SA0B 3P4EA 4EI9A 5CB4B 1XRGA 4IHJA 4NUTA 2RHHA 3NK6A 1UI9A 2HX0A 4IIJB 3VYSC 3FD6A 1IV3A 1TUBB 2UYJA 3C8LA 3QTYA 3HKBB 4X1IB 1KC8H 1J7HA 3CD6F 1SZQA 4EI8A 4BVTA 5JH7B 5J2TA 3ELCA 5LXTB 4TV8A 4YJ2B 3K2XA 1X25A 3CXCF 3GHZA 2HRUA 1QAHA 1VQPF 3VO8A 2I6DA 3D00A 1IPAA 3RYIA 2CHSA 2HS0A 3MCAB 3S02A 1VQ9F 2OTJF 3JALB 3LWQC 4X3LA 2KTUA 1VQNF 1W3EX 4I50A 5JH7A 4RQOA 3E1YA 4U3JB 1COMA 3OBWA 4X1IA 3IR9A 3LMEA 1TUBA 3C9UA 3CYQA 2FGYA 3CCSF 4BT5A 1PXWA 1GO0A 5GIPC 3VI6A 1H47A 2ZODA 3GYQA 2OZBA 3V7QA 4O4JB 3TD5A 1SA0A 3Q8HA 3I55F 5EYPA 5MN6A 1W59A 2BTQB 5G4UC 3RA5A 2ZVZA 1XV2A 3IKFA 2ZOVA 2LBWA 4I55A 5HXUA 3WPWA 2VAPA 3P0ZA 3F0GA 2YXZA 1X52A 2AIFA 2BO1A 4F6RB 2V9YA 3WGLA 2CW4A 3C9SA 5B8FA 2UYNB 1VQ5F 1FFXA 2VAWA 3ZP7A 4NWOB 3GTZA 1Z5VA 5JQGB 5KMGB 3D54A 1X7PA 3TD4A 1U3LA 1K8AH 4DXDA 2CZWA 5IJ0A 1JFFA 2VGMA 3CYPB 4B45A 2H8EA 3JAWB 3J81M 4ZHWA 4O2BB 1NJIH 2RHJA 4ZHYB 4EB6A 1VQKF 5HY0A 1VQOF 1FSZA 2LCAA 2IG8A 4C4WC 2AIZP 5HY4A 5DCVA 1VQ7F 1R1MA 5HY2A 3SIVA 5EB0A 5MN4A 2QEXF 5ITZA 3N2GB 4YJ3B 3E22A 5LP6B 1DBFA 3LWPC 3HKDB 2B33A 3G71F 3CC4F 4X1KA 3E20B 3S0WA 2AMTA 4LNUA 3S03A 3WJRA 2HS3A 5C8YA 1Q82H 2P6YA 4X3MA 3CB2A 3ESJA 1JD1A 4BVQA 3KJJA 2Z1EA 2UZHA 5MN5A 3VOAA 4ZHVA 1N8RH 2KG4A 3DC2A 2BTOA 1CK2A 2Z1UA 3K0TA 2FC3A 4O2AB 3N4ZA 3PAFA 4FFBB 3UT5A 1H48A 1TVKA 1ODEA 1YGYA 4TV9A 3HKCA 3IEQA 4DRXA 4X1YB 5EB1B 3RYFB 1U43A 3JARA 3WJPA 3IKEA 3D01A 3C9TA 2VAMA 3N2KA 2LBTA 3NMUC 4G4XA 4X20B 1U3PA 5IYZA 4G4WA 2HP3A 1GZ0A 5IT9M 3CPQA 3VMFB 3WGNA 3CCRF 1W57A 4BVRA 2HP0A 1VH8A 5BMVA 1S72F 4ERHA 3JASA 3CCLF 4TZZA 3R0PA 5HP7A 1W5FA 1NMUB 5CA0B 3KHNA 2WALA 2QA4F 4BW0B 2R6R1 3VTIC 2HS4A 2CHTA 3CCMF 2R751 3FFMA 4G4YA 3ERNA 2ZVYA 3OBYA 4XCQA 3VCZA 3U0OA 5GONA 3KIZA 5GONB 1QVGF 3L7QA 4RHAA 1QVFF 2ZF8A 4I4TB 4LCKA 2IQQA 2GVIA 4BY9D 1Q86H 4ZHQB 1M1KH 4WBNB 3G6EF 3PLAC 3O85A 1DT9A 4BT4A 3LWRC 5BMVB 1W40A 1W55A 2ALEA 2HP0B 2KTVA 5J2UB 4BVSA 4C82A 1RLUA 3CPWF 2K1SA 3IMPA 4U39A 4O4LA 4C8IA 3RYHB 2H8CA 4HNAB 5KX5A 2KGWA 3JCMM 5FJ4C 5EWRA 2RB9A 5AVMA 4TUYB 1YIJF 2QI2A 3T80A 3VYTC 1RLGA 3CC2F 3N4YA 1IV4A 2Q1XA 1K9MH 1IV2A 3HKEA 2I6RA 4NQ3A 1VQ6F 4X1YA 4DRXB 5GIOC 2RHLA 3HKCB 2Q1YA 4TV9B 2BTUA 4O4HA 1W5EA 1T0KB 2G9IA 3FBAA 4ZOLA 1KNKA 1VQLF 5CA1A 5JCOA 1U40A 3ZP4A 4BT3A 1VQ4F 5LOVA 3JVHA 3VIUA 3KE1A 1K73H 1YJNF 5HY1A 1W581 3P10A 4BT6A 1YITF 5LA6A 2YYEA 5LA6B 3CG6A 4LNUB 2OTLF 2CVLA 3LDTA 3OONA 4X1KB 1QD9A 3HKDA 5GANK 1W5AA 1IV1A 3CMEF 5LP6A 3M84A 3N2GA 5LOVB 5ITZB 5EIBC 2N48A 2UYKA 5CA1B 3F6MA 5HXZA 4ZOLB 5FLXM 3ZOPA 5EIBD 3K14A 4O4HB 1YJWF 4O2BA 4M8IA 3HKEB 3LYBA 1KQSF 3QHDA 3JAWA 1JFFB 3I56F 2F9ZC 2CWJA 2L26A 3FPIA 4TUYA 1ONIA 1OFUA 5A2QM 4G4ZA 3V4DA 4HNAA 1FFXB 5KX5B 3RYHA 2UYNA 4O4LB 5GINC 2CSLA 3I7TA 5J2UA 1CLIA 3HTNA 3HAXD 1VQVA 1Q8RA 4BT2A 1Z5WA 5EYPB 1YHQF 1W5BA 4O4JA 4WBNA 2LBXA 1RA4A 3VYUC 2DYYA 2PHNA 4ZHQA 1W42A 4I4TA 4EI7A 1YI2F 3TD3A 1M90H 2DT4A 1Q81H 3K12A 3CCJF 1H7MA 3LWOC 3C9RA 1JY8A 1YJ9F 3FD5A 5EAZA 4U3JA 4G4VA 4I50B 1NQ3A 3JALA 4BT7A 3QUWA 4KWEA 4C81A 3RYIB 5CA0A 3JASB 3HWUA 3CC7F 3M1XA 4YJ2A 3NVIB 3ZO8A 4ZK7A 1VQMF 4TV8B 5LXTA 1UFYA 3F0DA 5IYZB 1JN1A 4X20A 5J2TB 3G4SF 3MBMA 3SIUA 3BYQA 3N2KB 3HKBA 2Z1TA 3V7EA 4C8GA 1FNJA 5EO3A 2ZAUA 3JARB 3CCUF 4IIJA 2HRYA 3RYFA 2IAFA 2UYPA 4IHJB 4C8EA 5CB4A 4B62A 1TVKB 3S0YA 1KD1H 4O4IA 4ZI7A 3J7AR 4FFBA 3S0HA 3UT5B 3WPXA 5LYJA 5JCOC 4O2AA 1W41A 2VGNA 2GLZA 3B6NA 5FNVB 4B5CA 3OW2F 3CMAF 2JNBA 1VQ8F 3AGKA 3MDOA 3NK7A 3LWVC 3RA6A 5G4VC 2H6LA 3JATB 2OHWA 3WXMB 3RYCA 1Q7YH 4G88A 4E6EA 1VHAA 5HWEA 2Z01A 5C8YB 1SDSA 2HVYD 5JVDB 1JJ2F 2RHOA 3NVKE 3V3TA 3EORA 5IJ9A 3VOBA 3I3FA 1XHOA 3E22B 4YJ3A 4R40B 3CCEF 3WGMA 3JAKB 1KNJA 1RQ7A 3ON1A
chains in the Genus database with same CATH topology
3P0ZA 3F0DA 3F0GA 1JN1A 1U3PA 4C8IA 1GX1A 3F0EA 3MBMA 1JY8A 1U40A 3ELCA 3F6MA 5B8FA 1YQNA 1T0AA 1VHAA 3K14A 3T80A 3JVHA 4C8GA 3K2XA 1H48A 3KE1A 1W57A 1U3LA 4C81A 2GZLA 1VH8A 3GHZA 1IV4A 1H47A 3P10A 3F0FA 3IEQA 1IV2A 2AMTA 2PMPA 3IEWA 3QHDA 4C8EA 3EORA 3Q8HA 1U43A 1W55A 3FPIA 1IV1A 1IV3A 3ESJA 3IKEA 4C82A 3IKFA 3FBAA 1KNJA 3RE3A 1KNKA 3ERNA 2UZHA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P0Z A;  3F0D A;  3F0G A;  1JN1 A;  1U3P A;  4C8I A;  1GX1 A;  3F0E A;  3MBM A;  1JY8 A;  1U40 A;  3ELC A;  3F6M A;  5B8F A;  1YQN A;  1T0A A;  1VHA A;  3K14 A;  3T80 A;  3JVH A;  4C8G A;  3K2X A;  1H48 A;  3KE1 A;  1W57 A;  1U3L A;  4C81 A;  2GZL A;  1VH8 A;  3GHZ A;  1IV4 A;  1H47 A;  3P10 A;  3F0F A;  3IEQ A;  1IV2 A;  2AMT A;  2PMP A;  3IEW A;  3QHD A;  4C8E A;  3EOR A;  3Q8H A;  1U43 A;  1W55 A;  3FPI A;  1IV1 A;  1IV3 A;  3ESJ A;  3IKE A;  4C82 A;  3IKF A;  3FBA A;  1KNJ A;  3RE3 A;  1KNK A;  3ERN A;  2UZH A;  3B6N A; 
#chains in the Genus database with same CATH topology
 3WGK A;  1W2B F;  5EZY B;  5EZY A;  1GX1 A;  2Z1F A;  3F0E A;  2QTP A;  1FNK A;  1GO1 A;  3S06 A;  3JAK A;  4EB6 B;  3J80 M;  5GAP K;  3CCQ F;  3KJK A;  3JAM M;  5LP6 C;  3F0F A;  5IJ9 B;  2PMP A;  3IEW A;  5IJ0 B;  2EWC A;  3CCV F;  5HP8 A;  3LFO A;  4B46 A;  5JVD A;  1RQ2 A;  3WJQ A;  5JQG A;  5KMG A;  3DDN A;  2VXY A;  3MQW A;  3M4S A;  1XBI A;  3RE3 A;  2HQS C;  3RYC B;  1ZWZ A;  3JAT A;  1PF5 A;  1OAP A;  1X7O A;  4F6R A;  3HJW C;  1E7K A;  2MQE A;  2W8B C;  3WGJ A;  1QU9 A;  1CN7 A;  4I55 B;  2NMU A;  2OTM A;  5FNV A;  1YQN A;  4PWT A;  3MCQ A;  1T0A A;  5LYJ B;  1VK3 A;  2GZL A;  4O4I B;  4ZI7 B;  1SA0 B;  3P4E A;  4EI9 A;  5CB4 B;  1XRG A;  4IHJ A;  4NUT A;  2RHH A;  3NK6 A;  1UI9 A;  2HX0 A;  4IIJ B;  3VYS C;  3FD6 A;  1IV3 A;  1TUB B;  2UYJ A;  3C8L A;  3QTY A;  3HKB B;  4X1I B;  1KC8 H;  1J7H A;  3CD6 F;  1SZQ A;  4EI8 A;  4BVT A;  5JH7 B;  5J2T A;  3ELC A;  5LXT B;  4TV8 A;  4YJ2 B;  3K2X A;  1X25 A;  3CXC F;  3GHZ A;  2HRU A;  1QAH A;  1VQP F;  3VO8 A;  2I6D A;  3D00 A;  1IPA A;  3RYI A;  2CHS A;  2HS0 A;  3MCA B;  3S02 A;  1VQ9 F;  2OTJ F;  3JAL B;  3LWQ C;  4X3L A;  2KTU A;  1VQN F;  1W3E X;  4I50 A;  5JH7 A;  4RQO A;  3E1Y A;  4U3J B;  1COM A;  3OBW A;  4X1I A;  3IR9 A;  3LME A;  1TUB A;  3C9U A;  3CYQ A;  2FGY A;  3CCS F;  4BT5 A;  1PXW A;  1GO0 A;  5GIP C;  3VI6 A;  1H47 A;  2ZOD A;  3GYQ A;  2OZB A;  3V7Q A;  4O4J B;  3TD5 A;  1SA0 A;  3Q8H A;  3I55 F;  5EYP A;  5MN6 A;  1W59 A;  2BTQ B;  5G4U C;  3RA5 A;  2ZVZ A;  1XV2 A;  3IKF A;  2ZOV A;  2LBW A;  4I55 A;  5HXU A;  3WPW A;  2VAP A;  3P0Z A;  3F0G A;  2YXZ A;  1X52 A;  2AIF A;  2BO1 A;  4F6R B;  2V9Y A;  3WGL A;  2CW4 A;  3C9S A;  5B8F A;  2UYN B;  1VQ5 F;  1FFX A;  2VAW A;  3ZP7 A;  4NWO B;  3GTZ A;  1Z5V A;  5JQG B;  5KMG B;  3D54 A;  1X7P A;  3TD4 A;  1U3L A;  1K8A H;  4DXD A;  2CZW A;  5IJ0 A;  1JFF A;  2VGM A;  3CYP B;  4B45 A;  2H8E A;  3JAW B;  3J81 M;  4ZHW A;  4O2B B;  1NJI H;  2RHJ A;  4ZHY B;  4EB6 A;  1VQK F;  5HY0 A;  1VQO F;  1FSZ A;  2LCA A;  2IG8 A;  4C4W C;  2AIZ P;  5HY4 A;  5DCV A;  1VQ7 F;  1R1M A;  5HY2 A;  3SIV A;  5EB0 A;  5MN4 A;  2QEX F;  5ITZ A;  3N2G B;  4YJ3 B;  3E22 A;  5LP6 B;  1DBF A;  3LWP C;  3HKD B;  2B33 A;  3G71 F;  3CC4 F;  4X1K A;  3E20 B;  3S0W A;  2AMT A;  4LNU A;  3S03 A;  3WJR A;  2HS3 A;  5C8Y A;  1Q82 H;  2P6Y A;  4X3M A;  3CB2 A;  3ESJ A;  1JD1 A;  4BVQ A;  3KJJ A;  2Z1E A;  2UZH A;  5MN5 A;  3VOA A;  4ZHV A;  1N8R H;  2KG4 A;  3DC2 A;  2BTO A;  1CK2 A;  2Z1U A;  3K0T A;  2FC3 A;  4O2A B;  3N4Z A;  3PAF A;  4FFB B;  3UT5 A;  1H48 A;  1TVK A;  1ODE A;  1YGY A;  4TV9 A;  3HKC A;  3IEQ A;  4DRX A;  4X1Y B;  5EB1 B;  3RYF B;  1U43 A;  3JAR A;  3WJP A;  3IKE A;  3D01 A;  3C9T A;  2VAM A;  3N2K A;  2LBT A;  3NMU C;  4G4X A;  4X20 B;  1U3P A;  5IYZ A;  4G4W A;  2HP3 A;  1GZ0 A;  5IT9 M;  3CPQ A;  3VMF B;  3WGN A;  3CCR F;  1W57 A;  4BVR A;  2HP0 A;  1VH8 A;  5BMV A;  1S72 F;  4ERH A;  3JAS A;  3CCL F;  4TZZ A;  3R0P A;  5HP7 A;  1W5F A;  1NMU B;  5CA0 B;  3KHN A;  2WAL A;  2QA4 F;  4BW0 B;  2R6R 1;  3VTI C;  2HS4 A;  2CHT A;  3CCM F;  2R75 1;  3FFM A;  4G4Y A;  3ERN A;  2ZVY A;  3OBY A;  4XCQ A;  3VCZ A;  3U0O A;  5GON A;  3KIZ A;  5GON B;  1QVG F;  3L7Q A;  4RHA A;  1QVF F;  2ZF8 A;  4I4T B;  4LCK A;  2IQQ A;  2GVI A;  4BY9 D;  1Q86 H;  4ZHQ B;  1M1K H;  4WBN B;  3G6E F;  3PLA C;  3O85 A;  1DT9 A;  4BT4 A;  3LWR C;  5BMV B;  1W40 A;  1W55 A;  2ALE A;  2HP0 B;  2KTV A;  5J2U B;  4BVS A;  4C82 A;  1RLU A;  3CPW F;  2K1S A;  3IMP A;  4U39 A;  4O4L A;  4C8I A;  3RYH B;  2H8C A;  4HNA B;  5KX5 A;  2KGW A;  3JCM M;  5FJ4 C;  5EWR A;  2RB9 A;  5AVM A;  4TUY B;  1YIJ F;  2QI2 A;  3T80 A;  3VYT C;  1RLG A;  3CC2 F;  3N4Y A;  1IV4 A;  2Q1X A;  1K9M H;  1IV2 A;  3HKE A;  2I6R A;  4NQ3 A;  1VQ6 F;  4X1Y A;  4DRX B;  5GIO C;  2RHL A;  3HKC B;  2Q1Y A;  4TV9 B;  2BTU A;  4O4H A;  1W5E A;  1T0K B;  2G9I A;  3FBA A;  4ZOL A;  1KNK A;  1VQL F;  5CA1 A;  5JCO A;  1U40 A;  3ZP4 A;  4BT3 A;  1VQ4 F;  5LOV A;  3JVH A;  3VIU A;  3KE1 A;  1K73 H;  1YJN F;  5HY1 A;  1W58 1;  3P10 A;  4BT6 A;  1YIT F;  5LA6 A;  2YYE A;  5LA6 B;  3CG6 A;  4LNU B;  2OTL F;  2CVL A;  3LDT A;  3OON A;  4X1K B;  1QD9 A;  3HKD A;  5GAN K;  1W5A A;  1IV1 A;  3CME F;  5LP6 A;  3M84 A;  3N2G A;  5LOV B;  5ITZ B;  5EIB C;  2N48 A;  2UYK A;  5CA1 B;  3F6M A;  5HXZ A;  4ZOL B;  5FLX M;  3ZOP A;  5EIB D;  3K14 A;  4O4H B;  1YJW F;  4O2B A;  4M8I A;  3HKE B;  3LYB A;  1KQS F;  3QHD A;  3JAW A;  1JFF B;  3I56 F;  2F9Z C;  2CWJ A;  2L26 A;  3FPI A;  4TUY A;  1ONI A;  1OFU A;  5A2Q M;  4G4Z A;  3V4D A;  4HNA A;  1FFX B;  5KX5 B;  3RYH A;  2UYN A;  4O4L B;  5GIN C;  2CSL A;  3I7T A;  5J2U A;  1CLI A;  3HTN A;  3HAX D;  1VQV A;  1Q8R A;  4BT2 A;  1Z5W A;  5EYP B;  1YHQ F;  1W5B A;  4O4J A;  4WBN A;  2LBX A;  1RA4 A;  3VYU C;  2DYY A;  2PHN A;  4ZHQ A;  1W42 A;  4I4T A;  4EI7 A;  1YI2 F;  3TD3 A;  1M90 H;  2DT4 A;  1Q81 H;  3K12 A;  3CCJ F;  1H7M A;  3LWO C;  3C9R A;  1JY8 A;  1YJ9 F;  3FD5 A;  5EAZ A;  4U3J A;  4G4V A;  4I50 B;  1NQ3 A;  3JAL A;  4BT7 A;  3QUW A;  4KWE A;  4C81 A;  3RYI B;  5CA0 A;  3JAS B;  3HWU A;  3CC7 F;  3M1X A;  4YJ2 A;  3NVI B;  3ZO8 A;  4ZK7 A;  1VQM F;  4TV8 B;  5LXT A;  1UFY A;  3F0D A;  5IYZ B;  1JN1 A;  4X20 A;  5J2T B;  3G4S F;  3MBM A;  3SIU A;  3BYQ A;  3N2K B;  3HKB A;  2Z1T A;  3V7E A;  4C8G A;  1FNJ A;  5EO3 A;  2ZAU A;  3JAR B;  3CCU F;  4IIJ A;  2HRY A;  3RYF A;  2IAF A;  2UYP A;  4IHJ B;  4C8E A;  5CB4 A;  4B62 A;  1TVK B;  3S0Y A;  1KD1 H;  4O4I A;  4ZI7 A;  3J7A R;  4FFB A;  3S0H A;  3UT5 B;  3WPX A;  5LYJ A;  5JCO C;  4O2A A;  1W41 A;  2VGN A;  2GLZ A;  3B6N A;  5FNV B;  4B5C A;  3OW2 F;  3CMA F;  2JNB A;  1VQ8 F;  3AGK A;  3MDO A;  3NK7 A;  3LWV C;  3RA6 A;  5G4V C;  2H6L A;  3JAT B;  2OHW A;  3WXM B;  3RYC A;  1Q7Y H;  4G88 A;  4E6E A;  1VHA A;  5HWE A;  2Z01 A;  5C8Y B;  1SDS A;  2HVY D;  5JVD B;  1JJ2 F;  2RHO A;  3NVK E;  3V3T A;  3EOR A;  5IJ9 A;  3VOB A;  3I3F A;  1XHO A;  3E22 B;  4YJ3 A;  4R40 B;  3CCE F;  3WGM A;  3JAK B;  1KNJ A;  1RQ7 A;  3ON1 A; 
#chains in the Genus database with same CATH homology
 3P0Z A;  3F0D A;  3F0G A;  1JN1 A;  1U3P A;  4C8I A;  1GX1 A;  3F0E A;  3MBM A;  1JY8 A;  1U40 A;  3ELC A;  3F6M A;  5B8F A;  1YQN A;  1T0A A;  1VHA A;  3K14 A;  3T80 A;  3JVH A;  4C8G A;  3K2X A;  1H48 A;  3KE1 A;  1W57 A;  1U3L A;  4C81 A;  2GZL A;  1VH8 A;  3GHZ A;  1IV4 A;  1H47 A;  3P10 A;  3F0F A;  3IEQ A;  1IV2 A;  2AMT A;  2PMP A;  3IEW A;  3QHD A;  4C8E A;  3EOR A;  3Q8H A;  1U43 A;  1W55 A;  3FPI A;  1IV1 A;  1IV3 A;  3ESJ A;  3IKE A;  4C82 A;  3IKF A;  3FBA A;  1KNJ A;  3RE3 A;  1KNK A;  3ERN A;  2UZH A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...