3KE1A

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment-nucleoside fusion d000161829
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
150
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 51
structure length 150
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ke1A00
1KNJA 2PMPA 1KNKA 3GHZA 3F0FA 1T0AA 3B6NA 2GZLA 3F0GA 3FBAA 3K2XA 3Q8HA 3IEWA 3ELCA 1YQNA 2AMTA 3JVHA 3FPIA 3P10A 4C8GA 4C81A 1H47A 3P0ZA 3QHDA 3IEQA 3ESJA 3RE3A 1IV4A 4C8EA 1H48A 3ERNA 1GX1A 3KE1A 1VHAA 3K14A 1JN1A 1W55A 1W57A 1U40A 3F0EA 3IKFA 1IV3A 1U3PA 3F6MA 4C82A 3T80A 4C8IA 3IKEA 1IV2A 5B8FA 1VH8A 1U43A 3F0DA 1U3LA 1JY8A 3MBMA 3EORA 2UZHA 1IV1A
chains in the Genus database with same CATH superfamily
1FFXB 2RHHA 3I3FA 4EI8A 4EI7A 5J2TB 4ZI7B 4X1KA 5GINC 3LDTA 1YQNA 3M4SA 2H8CA 2Z1TA 3RE3A 4LNUB 2AIZP 3LWQC 1PXWA 5CA1B 2UYNB 5JVDB 4I4TA 4LNUA 4RHAA 5IT9M 2FGYA 1IV3A 1Q7YH 3JARB 4O4HA 3VTIC 1X52A 1TVKA 4I55B 4E6EA 3DC2A 4G4WA 1KNKA 4WBNA 3RYFA 3RYCB 4ZK7A 1K8AH 1JFFB 1H7MA 3N2KA 1DT9A 3CG6A 5EZYB 4X1KB 3P0ZA 3SIUA 1KQSF 4I50B 3U0OA 1RLGA 3RYHB 1PF5A 3C9RA 5IJ0B 3JCMM 1VHAA 1QVFF 2H8EA 3JAMM 4TV8B 3WGJA 3E22B 3LFOA 4X3LA 4C8IA 3FD6A 3KHNA 5FJ4C 3JARA 5HP7A 3HKBB 4X20A 4F6RB 3B6NA 3FBAA 3V7EA 1VQ8F 1OFUA 1JJ2F 4M8IA 1W581 3OONA 3CB2A 2CSLA 4X1IB 3VCZA 1UI9A 3RYIA 4BT3A 4BVQA 1YJWF 2IG8A 1W41A 4TZZA 1Q81H 3VOBA 1W5BA 2YYEA 3OBWA 3S0WA 1X7PA 1VQKF 3WPXA 4U3JB 3RA5A 5HXUA 3G6EF 3KJJA 5BMVA 3OBYA 2Q1YA 2BTUA 1W5FA 3WJRA 4TV9B 3J80M 2P6YA 3UT5B 5IYZB 1VQPF 5GAPK 3JASB 3CMAF 3K12A 3WPWA 2UYNA 4NQ3A 4ZHYB 2DT4A 4PWTA 3MDOA 4DXDA 5CA0B 3NMUC 2B33A 5KMGA 3K14A 1VQ9F 2KGWA 2HS3A 3T80A 5LP6A 5HWEA 3J7AR 2V9YA 1FFXA 3MBMA 4I4TB 3PLAC 5JCOA 5C8YA 4BVTA 5JQGA 5BMVB 4X3MA 4O2BB 3Q8HA 2HX0A 3IEWA 3PAFA 1CLIA 4BT7A 3S0HA 4ZOLA 4C81A 1K9MH 5LA6A 3UT5A 2YXZA 5IYZA 3R0PA 4C8EA 3CCLF 3HKCB 3HAXD 5HY2A 1YGYA 1YJNF 4O2AB 1W3EX 1W57A 3OW2F 1CK2A 3JAKA 2L26A 1KC8H 5HY1A 4O2AA 2DYYA 3JAKB 3RYHA 1JY8A 4HNAB 1YHQF 3G71F 2IQQA 3CMEF 5IJ9B 4BVRA 2QEXF 5EZYA 1GZ0A 2KTUA 1R1MA 2EWCA 1Q8RA 3E22A 3M1XA 2HP0A 3CC4F 1W5EA 3CCVF 2RB9A 3ZO8A 5C8YB 5EB1B 3S0YA 3E1YA 2LBWA 2W8BC 5EIBC 4O4LB 1U40A 1NJIH 1QAHA 2HP3A 2OTMA 4IIJA 3JATB 4C82A 4TV9A 2RHOA 3V4DA 5CA1A 3AGKA 3VMFB 2VAMA 2VGNA 3EORA 3RYCA 2N48A 2UZHA 4YJ2B 5MN4A 5G4VC 1VQ7F 5CB4A 3I56F 4C4WC 1T0AA 4I50A 2VAWA 3CC7F 3S06A 3TD5A 3HKDA 1W40A 3FPIA 3HJWC 2UYPA 3QHDA 2OTLF 5HY0A 1S72F 3ERNA 3HWUA 5EYPB 5LP6C 3VIUA 2ZAUA 4XCQA 3WGLA 4IHJB 4U39A 4B46A 2HP0B 2OHWA 3DDNA 4O4HB 4I55A 3L7QA 1YIJF 4IIJB 2Z1EA 3I7TA 3QTYA 1IV2A 5EIBD 2HRYA 2KTVA 4LCKA 3V7QA 1KNJA 5ITZB 1VQOF 3F0FA 1XHOA 1NQ3A 3CCRF 4G4YA 3G4SF 2K1SA 4C8GA 4O4IA 3N4YA 1QU9A 3LYBA 1W59A 1W2BF 2GVIA 5J2UA 4B5CA 3HKDB 4EB6A 3LWVC 5EB0A 5EWRA 1X25A 2LBTA 4ZHWA 5EYPA 5JQGB 3NK6A 3VO8A 2VXYA 5MN5A 3RA6A 2ZVZA 3JAWA 4NWOB 3GHZA 2LCAA 3NVKE 3HTNA 5G4UC 3FFMA 1SA0A 3ELCA 3ON1A 5GIPC 5GANK 3LWOC 1UFYA 4O4IB 3RYFB 4B62A 1XBIA 3K0TA 2BO1A 5GONB 4G4VA 3JALA 1RQ7A 5LXTB 2HQSC 3F6MA 5J2TA 2HRUA 2NMUA 2I6RA 2ZVYA 4HNAA 1VQ6F 1VH8A 1U43A 3D00A 4DRXB 3P4EA 3NK7A 1IPAA 5FNVB 2PMPA 3S03A 2ZOVA 1KD1H 1ODEA 3N4ZA 5LYJB 2UYJA 4FFBB 5LYJA 4FFBA 5KX5A 4ZHVA 5JH7B 1GO0A 3KE1A 1YJ9F 4YJ3A 3CXCF 2BTQB 3D01A 1SDSA 4R40B 3C9SA 4BT2A 4WBNB 5JCOC 2GLZA 2F9ZC 3VYSC 2Z01A 1M90H 4G4ZA 3HKCA 1X7OA 5B8FA 4RQOA 3MQWA 5LXTA 3JALB 3WGMA 4BT5A 1Z5VA 1ZWZA 3F0GA 3WGKA 3C9TA 3CCSF 4O4JA 5EO3A 3QUWA 1W42A 3HKEA 4BW0B 2WALA 1IV4A 5IJ0A 3WJQA 3IMPA 3BYQA 2QI2A 3HKBA 3JAWB 2KG4A 3F0EA 1FNJA 3IKFA 3ZP7A 1VQ4F 3NVIB 3N2GB 1JD1A 3TD4A 4G4XA 2HS4A 2HS0A 3VYTC 4YJ2A 5CA0A 4YJ3B 5CB4B 2JNBA 3CCMF 2CVLA 3GTZA 1IV1A 4TUYB 4EB6B 1TVKB 2BTOA 3JATA 3K2XA 3VYUC 5LP6B 1M1KH 1VQLF 5HY4A 4G88A 2VGMA 3CYPB 2Q1XA 4BVSA 3IEQA 3J81M 2H6LA 4X1YA 2Z1FA 4O2BA 4O4JB 4X1YB 1RA4A 5LOVA 1ONIA 1Q82H 5ITZA 1GO1A 4O4LA 1VK3A 4X20B 4F6RA 1YI2F 5GONA 1TUBB 1N8RH 3S02A 5EAZA 4NUTA 2PHNA 3GYQA 4ZHQA 2GZLA 2AIFA 2MQEA 2OZBA 3JASA 5MN6A 3E20B 1H47A 3M84A 1SZQA 5KX5B 1T0KB 5IJ9A 5J2UB 3CC2F 4BT4A 2ZODA 1W55A 2UYKA 1FNKA 3I55F 2HVYD 3CCQF 2OTJF 4U3JA 5FLXM 1QD9A 3LWRC 3MCQA 3D54A 5FNVA 2CWJA 2QA4F 5AVMA 2I6DA 3IR9A 5LA6B 2VAPA 3RYIB 2Z1UA 4BY9D 1JFFA 1OAPA 2AMTA 3JVHA 3KJKA 2CHTA 3V3TA 5GIOC 3ESJA 1TUBA 5KMGB 1Q86H 5HP8A 1GX1A 1RLUA 4ZI7A 3O85A 1JN1A 1SA0B 1E7KA 3SIVA 3C9UA 3CYQA 3F0DA 3KIZA 3WGNA 4IHJA 3CD6F 1RQ2A 3N2GA 1XV2A 3CCJF 4EI9A 1DBFA 2R751 2LBXA 3MCAB 3CCUF 3CPWF 3CPQA 1CN7A 3C8LA 3VI6A 1H48A 4X1IA 2G9IA 1VQMF 5A2QM 2RHJA 1W5AA 4B45A 4DRXA 1VQNF 1YITF 1K73H 1FSZA 5HXZA 1U3LA 3IKEA 5LOVB 3CCEF 2FC3A 4KWEA 4TV8A 5JVDA 1VQ5F 2ALEA 1VQVA 3HKEB 2IAFA 3VOAA 2RHLA 3P10A 1COMA 2CHSA 3LMEA 1NMUB 3WJPA 5JH7A 3WXMB 1XRGA 2R6R1 2CW4A 3TD3A 4ERHA 2CZWA 3ZP4A 3FD5A 4ZOLB 4TUYA 1QVGF 1Z5WA 3ZOPA 1U3PA 4BT6A 3N2KB 3LWPC 1J7HA 5DCVA 2ZF8A 4ZHQB 2QTPA
chains in the Genus database with same CATH topology
1KNJA 2PMPA 1KNKA 3GHZA 3F0FA 1T0AA 3B6NA 2GZLA 3F0GA 3FBAA 3K2XA 3Q8HA 3IEWA 3ELCA 1YQNA 2AMTA 3JVHA 3FPIA 3P10A 4C8GA 4C81A 1H47A 3P0ZA 3QHDA 3IEQA 3ESJA 3RE3A 1IV4A 4C8EA 1H48A 3ERNA 1GX1A 3KE1A 1VHAA 3K14A 1JN1A 1W55A 1W57A 1U40A 3F0EA 3IKFA 1IV3A 1U3PA 3F6MA 4C82A 3T80A 4C8IA 3IKEA 1IV2A 5B8FA 1VH8A 1U43A 3F0DA 1U3LA 1JY8A 3MBMA 3EORA 2UZHA 1IV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNJ A;  2PMP A;  1KNK A;  3GHZ A;  3F0F A;  1T0A A;  3B6N A;  2GZL A;  3F0G A;  3FBA A;  3K2X A;  3Q8H A;  3IEW A;  3ELC A;  1YQN A;  2AMT A;  3JVH A;  3FPI A;  3P10 A;  4C8G A;  4C81 A;  1H47 A;  3P0Z A;  3QHD A;  3IEQ A;  3ESJ A;  3RE3 A;  1IV4 A;  4C8E A;  1H48 A;  3ERN A;  1GX1 A;  3KE1 A;  1VHA A;  3K14 A;  1JN1 A;  1W55 A;  1W57 A;  1U40 A;  3F0E A;  3IKF A;  1IV3 A;  1U3P A;  3F6M A;  4C82 A;  3T80 A;  4C8I A;  3IKE A;  1IV2 A;  5B8F A;  1VH8 A;  1U43 A;  3F0D A;  1U3L A;  1JY8 A;  3MBM A;  3EOR A;  2UZH A;  1IV1 A; 
#chains in the Genus database with same CATH topology
 1FFX B;  2RHH A;  3I3F A;  4EI8 A;  4EI7 A;  5J2T B;  4ZI7 B;  4X1K A;  5GIN C;  3LDT A;  1YQN A;  3M4S A;  2H8C A;  2Z1T A;  3RE3 A;  4LNU B;  2AIZ P;  3LWQ C;  1PXW A;  5CA1 B;  2UYN B;  5JVD B;  4I4T A;  4LNU A;  4RHA A;  5IT9 M;  2FGY A;  1IV3 A;  1Q7Y H;  3JAR B;  4O4H A;  3VTI C;  1X52 A;  1TVK A;  4I55 B;  4E6E A;  3DC2 A;  4G4W A;  1KNK A;  4WBN A;  3RYF A;  3RYC B;  4ZK7 A;  1K8A H;  1JFF B;  1H7M A;  3N2K A;  1DT9 A;  3CG6 A;  5EZY B;  4X1K B;  3P0Z A;  3SIU A;  1KQS F;  4I50 B;  3U0O A;  1RLG A;  3RYH B;  1PF5 A;  3C9R A;  5IJ0 B;  3JCM M;  1VHA A;  1QVF F;  2H8E A;  3JAM M;  4TV8 B;  3WGJ A;  3E22 B;  3LFO A;  4X3L A;  4C8I A;  3FD6 A;  3KHN A;  5FJ4 C;  3JAR A;  5HP7 A;  3HKB B;  4X20 A;  4F6R B;  3B6N A;  3FBA A;  3V7E A;  1VQ8 F;  1OFU A;  1JJ2 F;  4M8I A;  1W58 1;  3OON A;  3CB2 A;  2CSL A;  4X1I B;  3VCZ A;  1UI9 A;  3RYI A;  4BT3 A;  4BVQ A;  1YJW F;  2IG8 A;  1W41 A;  4TZZ A;  1Q81 H;  3VOB A;  1W5B A;  2YYE A;  3OBW A;  3S0W A;  1X7P A;  1VQK F;  3WPX A;  4U3J B;  3RA5 A;  5HXU A;  3G6E F;  3KJJ A;  5BMV A;  3OBY A;  2Q1Y A;  2BTU A;  1W5F A;  3WJR A;  4TV9 B;  3J80 M;  2P6Y A;  3UT5 B;  5IYZ B;  1VQP F;  5GAP K;  3JAS B;  3CMA F;  3K12 A;  3WPW A;  2UYN A;  4NQ3 A;  4ZHY B;  2DT4 A;  4PWT A;  3MDO A;  4DXD A;  5CA0 B;  3NMU C;  2B33 A;  5KMG A;  3K14 A;  1VQ9 F;  2KGW A;  2HS3 A;  3T80 A;  5LP6 A;  5HWE A;  3J7A R;  2V9Y A;  1FFX A;  3MBM A;  4I4T B;  3PLA C;  5JCO A;  5C8Y A;  4BVT A;  5JQG A;  5BMV B;  4X3M A;  4O2B B;  3Q8H A;  2HX0 A;  3IEW A;  3PAF A;  1CLI A;  4BT7 A;  3S0H A;  4ZOL A;  4C81 A;  1K9M H;  5LA6 A;  3UT5 A;  2YXZ A;  5IYZ A;  3R0P A;  4C8E A;  3CCL F;  3HKC B;  3HAX D;  5HY2 A;  1YGY A;  1YJN F;  4O2A B;  1W3E X;  1W57 A;  3OW2 F;  1CK2 A;  3JAK A;  2L26 A;  1KC8 H;  5HY1 A;  4O2A A;  2DYY A;  3JAK B;  3RYH A;  1JY8 A;  4HNA B;  1YHQ F;  3G71 F;  2IQQ A;  3CME F;  5IJ9 B;  4BVR A;  2QEX F;  5EZY A;  1GZ0 A;  2KTU A;  1R1M A;  2EWC A;  1Q8R A;  3E22 A;  3M1X A;  2HP0 A;  3CC4 F;  1W5E A;  3CCV F;  2RB9 A;  3ZO8 A;  5C8Y B;  5EB1 B;  3S0Y A;  3E1Y A;  2LBW A;  2W8B C;  5EIB C;  4O4L B;  1U40 A;  1NJI H;  1QAH A;  2HP3 A;  2OTM A;  4IIJ A;  3JAT B;  4C82 A;  4TV9 A;  2RHO A;  3V4D A;  5CA1 A;  3AGK A;  3VMF B;  2VAM A;  2VGN A;  3EOR A;  3RYC A;  2N48 A;  2UZH A;  4YJ2 B;  5MN4 A;  5G4V C;  1VQ7 F;  5CB4 A;  3I56 F;  4C4W C;  1T0A A;  4I50 A;  2VAW A;  3CC7 F;  3S06 A;  3TD5 A;  3HKD A;  1W40 A;  3FPI A;  3HJW C;  2UYP A;  3QHD A;  2OTL F;  5HY0 A;  1S72 F;  3ERN A;  3HWU A;  5EYP B;  5LP6 C;  3VIU A;  2ZAU A;  4XCQ A;  3WGL A;  4IHJ B;  4U39 A;  4B46 A;  2HP0 B;  2OHW A;  3DDN A;  4O4H B;  4I55 A;  3L7Q A;  1YIJ F;  4IIJ B;  2Z1E A;  3I7T A;  3QTY A;  1IV2 A;  5EIB D;  2HRY A;  2KTV A;  4LCK A;  3V7Q A;  1KNJ A;  5ITZ B;  1VQO F;  3F0F A;  1XHO A;  1NQ3 A;  3CCR F;  4G4Y A;  3G4S F;  2K1S A;  4C8G A;  4O4I A;  3N4Y A;  1QU9 A;  3LYB A;  1W59 A;  1W2B F;  2GVI A;  5J2U A;  4B5C A;  3HKD B;  4EB6 A;  3LWV C;  5EB0 A;  5EWR A;  1X25 A;  2LBT A;  4ZHW A;  5EYP A;  5JQG B;  3NK6 A;  3VO8 A;  2VXY A;  5MN5 A;  3RA6 A;  2ZVZ A;  3JAW A;  4NWO B;  3GHZ A;  2LCA A;  3NVK E;  3HTN A;  5G4U C;  3FFM A;  1SA0 A;  3ELC A;  3ON1 A;  5GIP C;  5GAN K;  3LWO C;  1UFY A;  4O4I B;  3RYF B;  4B62 A;  1XBI A;  3K0T A;  2BO1 A;  5GON B;  4G4V A;  3JAL A;  1RQ7 A;  5LXT B;  2HQS C;  3F6M A;  5J2T A;  2HRU A;  2NMU A;  2I6R A;  2ZVY A;  4HNA A;  1VQ6 F;  1VH8 A;  1U43 A;  3D00 A;  4DRX B;  3P4E A;  3NK7 A;  1IPA A;  5FNV B;  2PMP A;  3S03 A;  2ZOV A;  1KD1 H;  1ODE A;  3N4Z A;  5LYJ B;  2UYJ A;  4FFB B;  5LYJ A;  4FFB A;  5KX5 A;  4ZHV A;  5JH7 B;  1GO0 A;  3KE1 A;  1YJ9 F;  4YJ3 A;  3CXC F;  2BTQ B;  3D01 A;  1SDS A;  4R40 B;  3C9S A;  4BT2 A;  4WBN B;  5JCO C;  2GLZ A;  2F9Z C;  3VYS C;  2Z01 A;  1M90 H;  4G4Z A;  3HKC A;  1X7O A;  5B8F A;  4RQO A;  3MQW A;  5LXT A;  3JAL B;  3WGM A;  4BT5 A;  1Z5V A;  1ZWZ A;  3F0G A;  3WGK A;  3C9T A;  3CCS F;  4O4J A;  5EO3 A;  3QUW A;  1W42 A;  3HKE A;  4BW0 B;  2WAL A;  1IV4 A;  5IJ0 A;  3WJQ A;  3IMP A;  3BYQ A;  2QI2 A;  3HKB A;  3JAW B;  2KG4 A;  3F0E A;  1FNJ A;  3IKF A;  3ZP7 A;  1VQ4 F;  3NVI B;  3N2G B;  1JD1 A;  3TD4 A;  4G4X A;  2HS4 A;  2HS0 A;  3VYT C;  4YJ2 A;  5CA0 A;  4YJ3 B;  5CB4 B;  2JNB A;  3CCM F;  2CVL A;  3GTZ A;  1IV1 A;  4TUY B;  4EB6 B;  1TVK B;  2BTO A;  3JAT A;  3K2X A;  3VYU C;  5LP6 B;  1M1K H;  1VQL F;  5HY4 A;  4G88 A;  2VGM A;  3CYP B;  2Q1X A;  4BVS A;  3IEQ A;  3J81 M;  2H6L A;  4X1Y A;  2Z1F A;  4O2B A;  4O4J B;  4X1Y B;  1RA4 A;  5LOV A;  1ONI A;  1Q82 H;  5ITZ A;  1GO1 A;  4O4L A;  1VK3 A;  4X20 B;  4F6R A;  1YI2 F;  5GON A;  1TUB B;  1N8R H;  3S02 A;  5EAZ A;  4NUT A;  2PHN A;  3GYQ A;  4ZHQ A;  2GZL A;  2AIF A;  2MQE A;  2OZB A;  3JAS A;  5MN6 A;  3E20 B;  1H47 A;  3M84 A;  1SZQ A;  5KX5 B;  1T0K B;  5IJ9 A;  5J2U B;  3CC2 F;  4BT4 A;  2ZOD A;  1W55 A;  2UYK A;  1FNK A;  3I55 F;  2HVY D;  3CCQ F;  2OTJ F;  4U3J A;  5FLX M;  1QD9 A;  3LWR C;  3MCQ A;  3D54 A;  5FNV A;  2CWJ A;  2QA4 F;  5AVM A;  2I6D A;  3IR9 A;  5LA6 B;  2VAP A;  3RYI B;  2Z1U A;  4BY9 D;  1JFF A;  1OAP A;  2AMT A;  3JVH A;  3KJK A;  2CHT A;  3V3T A;  5GIO C;  3ESJ A;  1TUB A;  5KMG B;  1Q86 H;  5HP8 A;  1GX1 A;  1RLU A;  4ZI7 A;  3O85 A;  1JN1 A;  1SA0 B;  1E7K A;  3SIV A;  3C9U A;  3CYQ A;  3F0D A;  3KIZ A;  3WGN A;  4IHJ A;  3CD6 F;  1RQ2 A;  3N2G A;  1XV2 A;  3CCJ F;  4EI9 A;  1DBF A;  2R75 1;  2LBX A;  3MCA B;  3CCU F;  3CPW F;  3CPQ A;  1CN7 A;  3C8L A;  3VI6 A;  1H48 A;  4X1I A;  2G9I A;  1VQM F;  5A2Q M;  2RHJ A;  1W5A A;  4B45 A;  4DRX A;  1VQN F;  1YIT F;  1K73 H;  1FSZ A;  5HXZ A;  1U3L A;  3IKE A;  5LOV B;  3CCE F;  2FC3 A;  4KWE A;  4TV8 A;  5JVD A;  1VQ5 F;  2ALE A;  1VQV A;  3HKE B;  2IAF A;  3VOA A;  2RHL A;  3P10 A;  1COM A;  2CHS A;  3LME A;  1NMU B;  3WJP A;  5JH7 A;  3WXM B;  1XRG A;  2R6R 1;  2CW4 A;  3TD3 A;  4ERH A;  2CZW A;  3ZP4 A;  3FD5 A;  4ZOL B;  4TUY A;  1QVG F;  1Z5W A;  3ZOP A;  1U3P A;  4BT6 A;  3N2K B;  3LWP C;  1J7H A;  5DCV A;  2ZF8 A;  4ZHQ B;  2QTP A; 
#chains in the Genus database with same CATH homology
 1KNJ A;  2PMP A;  1KNK A;  3GHZ A;  3F0F A;  1T0A A;  3B6N A;  2GZL A;  3F0G A;  3FBA A;  3K2X A;  3Q8H A;  3IEW A;  3ELC A;  1YQN A;  2AMT A;  3JVH A;  3FPI A;  3P10 A;  4C8G A;  4C81 A;  1H47 A;  3P0Z A;  3QHD A;  3IEQ A;  3ESJ A;  3RE3 A;  1IV4 A;  4C8E A;  1H48 A;  3ERN A;  1GX1 A;  3KE1 A;  1VHA A;  3K14 A;  1JN1 A;  1W55 A;  1W57 A;  1U40 A;  3F0E A;  3IKF A;  1IV3 A;  1U3P A;  3F6M A;  4C82 A;  3T80 A;  4C8I A;  3IKE A;  1IV2 A;  5B8F A;  1VH8 A;  1U43 A;  3F0D A;  1U3L A;  1JY8 A;  3MBM A;  3EOR A;  2UZH A;  1IV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...