3KE1A

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment-nucleoside fusion d000161829
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
150
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 51
structure length 150
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ke1A00
3EORA 4C81A 3KE1A 1JN1A 3F0DA 3IKFA 1JY8A 1U3LA 1KNJA 3F6MA 3ELCA 3P0ZA 4C82A 3B6NA 3GHZA 2AMTA 3F0EA 1GX1A 1U43A 1YQNA 1H47A 1IV4A 1W57A 3FBAA 5B8FA 3F0FA 3RE3A 1W55A 2PMPA 2UZHA 3QHDA 3T80A 1VHAA 1VH8A 3ERNA 1IV2A 3FPIA 3P10A 3ESJA 3K14A 1T0AA 3K2XA 3MBMA 4C8EA 4C8GA 1U40A 2GZLA 3F0GA 3IEWA 1U3PA 1KNKA 3IEQA 3JVHA 4C8IA 3Q8HA 1IV3A 1H48A 1IV1A 3IKEA
chains in the Genus database with same CATH superfamily
2QI2A 3JALB 5AVMA 3OW2F 3C9SA 4B62A 4I55B 3F6MA 4O4IA 3V7QA 5J2UA 2ZOVA 4LNUA 2OTLF 3LDTA 3VO8A 4X1KA 4X3MA 3VYUC 5HP7A 3CCLF 4YJ3B 5HY1A 3NK7A 3HKDB 3NK6A 3TD4A 3MBMA 1SDSA 4G4VA 3Q8HA 2KG4A 3VMFB 5LP6B 4X20A 1JFFA 2WALA 1K9MH 2IQQA 4O2AA 3CB2A 1CLIA 1GX1A 2VXYA 4B46A 1KC8H 5EB1B 4BT7A 2DT4A 3L7QA 1Q8RA 2ZF8A 2I6DA 3CCJF 5EIBD 3OBYA 5C8YB 4IHJB 3JATB 2UYJA 3LWVC 3VOBA 3LFOA 3CCSF 5J2TB 3VYTC 1T0KB 2CWJA 3LWPC 3IKEA 3VCZA 4M8IA 2B33A 1VQKF 1GO0A 1W5BA 2RHJA 3KIZA 1YQNA 2NMUA 4O4IB 5J2UB 1TUBA 4LNUB 4F6RA 3CG6A 3OONA 4G4XA 4X1KB 3KJJA 2PMPA 3VI6A 4BT4A 3M4SA 1Z5WA 1VH8A 5JH7A 3LYBA 5EAZA 5EO3A 1H7MA 4O4LA 1OFUA 5MN5A 2W8BC 1N8RH 5LP6C 3RYIA 4BT5A 2H8EA 2OTMA 4C4WC 2JNBA 2HRYA 4C8IA 3HJWC 1XBIA 5FNVA 4C81A 3ZOPA 4X20B 3RA5A 1JFFB 3N2KA 2LBWA 1Q82H 4XCQA 4O2AB 4U3JA 5B8FA 1RQ7A 3AGKA 1RLUA 2CVLA 4I4TA 3C9RA 2OHWA 3HKBA 3LWRC 1YJWF 3WPWA 1K8AH 4NUTA 4O2BA 2BTOA 3ZP4A 2P6YA 2Z1EA 2RB9A 4RQOA 2HS0A 4O4JA 1TUBB 2G9IA 4F6RB 3JAWA 4B45A 4BW0B 4I50A 3QHDA 1YI2F 3V4DA 1IPAA 1VK3A 5JH7B 3DDNA 2UYKA 4O4LB 2V9YA 3TD3A 5EWRA 1S72F 3MQWA 3RYIB 3WPXA 2H6LA 2QA4F 5CA1A 1YGYA 5FNVB 3HKCA 3WGNA 5JVDA 4RHAA 1U3LA 2HVYD 2HP0A 3N2KB 1Q7YH 3E1YA 2OZBA 1QVFF 3IMPA 4G88A 4U3JB 3LMEA 4ZI7A 2MQEA 1RLGA 5HY4A 4ZHQA 1VQPF 1XHOA 1X7OA 2LBTA 4BVQA 2Q1YA 4I4TB 5ITZA 3CC7F 3HKBB 3VTIC 4C8GA 3JVHA 4TV8A 4FFBA 3PAFA 3CCVF 2FC3A 4ZK7A 1VQ9F 4O2BB 5HXUA 3P0ZA 3O85A 1NJIH 3LWOC 4O4JB 3VYSC 3G4SF 1NMUB 3J81M 3JAWB 1PF5A 4I50B 4EI7A 3U0OA 1FFXB 3V3TA 4HNAA 3K2XA 4DXDA 2Q1XA 3CC4F 3SIUA 5KX5A 3F0GA 3IEQA 3P4EA 4B5CA 2QTPA 3SIVA 3CMAF 1COMA 4ZOLA 1W5FA 5CA1B 3CCUF 4E6EA 5JVDB 3HKCB 1W5EA 1VQ8F 2GVIA 2N48A 5EB0A 3WJRA 2HP0B 5EIBC 3CYQA 1U43A 3WJQA 2KTUA 3BYQA 5IJ0A 3RE3A 4ZI7B 2ZVYA 3E22A 1UI9A 3HKEA 4ZHQB 1VHAA 3UT5A 5LOVA 3NMUC 5GINC 3ZP7A 3ESJA 3WGJA 5IJ9A 5ITZB 5GIPC 5JQGA 1QU9A 3CC2F 5MN4A 4TV8B 1M90H 4FFBB 1RA4A 3E20B 1VQNF 3HAXD 1YIJF 3QUWA 3HWUA 3N2GA 1W42A 4ZHVA 2FGYA 1W57A 3FBAA 2Z1UA 3JAKA 4X3LA 2VGMA 5FLXM 4YJ2A 3NVKE 4O4HA 1Z5VA 2KTVA 2IAFA 1ZWZA 5EYPA 1TVKA 1KQSF 3K12A 1KNKA 5KX5B 5GIOC 4NWOB 4X1IA 3G71F 1IV3A 2VGNA 5BMVA 3ON1A 4ZOLB 3FD5A 4BVTA 1CK2A 3F0EA 4TUYA 2CHTA 4G4WA 3MCAB 5MN6A 3G6EF 3CMEF 5IJ0B 4ZHYB 3WGMA 3E22B 5GONA 2CW4A 1VQLF 3HKEB 5LOVB 3UT5B 2RHHA 2BTUA 3K14A 3KJKA 2Z1FA 1ODEA 2ZVZA 3WXMB 4WBNA 2CZWA 5IJ9B 5FJ4C 5JQGB 1YITF 3IR9A 1KD1H 2LCAA 2UZHA 1SA0A 3FFMA 1YHQF 1VQ7F 3EORA 3J7AR 3B6NA 3N2GB 2HS4A 2HQSC 3I56F 3S02A 1NQ3A 3JAKB 3T80A 4DRXA 4YJ2B 3RYFA 4EB6A 4O4HB 3FPIA 3D01A 1T0AA 5IYZA 1TVKB 3WJPA 1XRGA 2BO1A 2HP3A 5HXZA 2YYEA 2I6RA 4X1IB 5HP8A 4TV9A 1VQ5F 1DT9A 2LBXA 3GYQA 3N4YA 5BMVB 1JN1A 5KMGA 2Z01A 4BT6A 3WGKA 3PLAC 5GAPK 2ALEA 3S06A 3VIUA 3M84A 4U39A 5HY2A 4TUYB 1DBFA 1R1MA 3MDOA 2VAWA 3S03A 5JCOA 1VQMF 3CYPB 5GONB 3RYHA 1IV2A 3C9UA 1QD9A 4BVSA 1J7HA 4KWEA 1GO1A 1JJ2F 2GLZA 1GZ0A 5G4VC 4NQ3A 3S0YA 1PXWA 2YXZA 2CSLA 3LWQC 1U3PA 4WBNB 3JARA 1IV1A 4ERHA 5LXTA 1SA0B 5EZYA 3KE1A 2QEXF 3OBWA 3IKFA 1FNKA 5LA6A 2AMTA 3QTYA 1X52A 5CA0A 3CXCF 1M1KH 5DCVA 1H47A 1IV4A 3RYCA 2HRUA 1UFYA 3D00A 5LYJA 4IIJA 4BVRA 3MCQA 4DRXB 5HY0A 3RYFB 4EB6B 3TD5A 1CN7A 4BY9D 3D54A 1W2BF 5CB4A 5HWEA 4C8EA 3CPQA 5IYZB 3IEWA 3I7TA 4TZZA 3J80M 3CCEF 1OAPA 4TV9B 3VOAA 2VAMA 3JASA 3R0PA 2H8CA 3ELCA 5KMGB 2OTJF 4G4ZA 3GTZA 3F0FA 2UYNA 1QAHA 4G4YA 1RQ2A 2ZODA 1ONIA 3KHNA 1VQOF 3S0WA 2UYPA 3FD6A 3RYHB 3WGLA 1Q86H 4X1YA 2IG8A 3JCMM 4HNAB 3V7EA 3CD6F 1FSZA 4ZHWA 1JD1A 3JALA 2Z1TA 3JARB 1FNJA 5LXTB 2BTQB 3F0DA 5EZYB 4I55A 1W41A 3C8LA 1X25A 3GHZA 2RHOA 1YJNF 1W40A 5LA6B 2R6R1 1E7KA 1X7PA 2EWCA 5CA0B 3RYCB 5LYJB 3RA6A 4YJ3A 4IIJB 1W3EX 3N4ZA 2R751 3ERNA 2ZAUA 3P10A 3HKDA 3I55F 4BT3A 3M1XA 2PHNA 1VQ4F 4BT2A 2HS3A 2L26A 1YJ9F 5CB4B 1VQ6F 5IT9M 2KGWA 5LP6A 2AIFA 1W581 1H48A 3C9TA 1W59A 2F9ZC 5GANK 2AIZP 4LCKA 2CHSA 3JAMM 3HTNA 3CCMF 1JY8A 3JASB 1KNJA 1Q81H 4C82A 1VQVA 3K0TA 3NVIB 1K73H 4PWTA 3CPWF 3DC2A 4EI8A 2DYYA 2K1SA 5JCOC 3CCRF 2UYNB 3I3FA 1QVGF 1W55A 2RHLA 2HX0A 4R40B 1FFXA 5C8YA 3CCQF 4IHJA 2VAPA 3JATA 3ZO8A 3S0HA 5J2TA 5EYPB 1U40A 2GZLA 4X1YB 4EI9A 5G4UC 1W5AA 5A2QM 1XV2A 1SZQA
chains in the Genus database with same CATH topology
3EORA 4C81A 3KE1A 1JN1A 3F0DA 3IKFA 1JY8A 1U3LA 1KNJA 3F6MA 3ELCA 3P0ZA 4C82A 3B6NA 3GHZA 2AMTA 3F0EA 1GX1A 1U43A 1YQNA 1H47A 1IV4A 1W57A 3FBAA 5B8FA 3F0FA 3RE3A 1W55A 2PMPA 2UZHA 3QHDA 3T80A 1VHAA 1VH8A 3ERNA 1IV2A 3FPIA 3P10A 3ESJA 3K14A 1T0AA 3K2XA 3MBMA 4C8EA 4C8GA 1U40A 2GZLA 3F0GA 3IEWA 1U3PA 1KNKA 3IEQA 3JVHA 4C8IA 3Q8HA 1IV3A 1H48A 1IV1A 3IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  4C81 A;  3KE1 A;  1JN1 A;  3F0D A;  3IKF A;  1JY8 A;  1U3L A;  1KNJ A;  3F6M A;  3ELC A;  3P0Z A;  4C82 A;  3B6N A;  3GHZ A;  2AMT A;  3F0E A;  1GX1 A;  1U43 A;  1YQN A;  1H47 A;  1IV4 A;  1W57 A;  3FBA A;  5B8F A;  3F0F A;  3RE3 A;  1W55 A;  2PMP A;  2UZH A;  3QHD A;  3T80 A;  1VHA A;  1VH8 A;  3ERN A;  1IV2 A;  3FPI A;  3P10 A;  3ESJ A;  3K14 A;  1T0A A;  3K2X A;  3MBM A;  4C8E A;  4C8G A;  1U40 A;  2GZL A;  3F0G A;  3IEW A;  1U3P A;  1KNK A;  3IEQ A;  3JVH A;  4C8I A;  3Q8H A;  1IV3 A;  1H48 A;  1IV1 A;  3IKE A; 
#chains in the Genus database with same CATH topology
 2QI2 A;  3JAL B;  5AVM A;  3OW2 F;  3C9S A;  4B62 A;  4I55 B;  3F6M A;  4O4I A;  3V7Q A;  5J2U A;  2ZOV A;  4LNU A;  2OTL F;  3LDT A;  3VO8 A;  4X1K A;  4X3M A;  3VYU C;  5HP7 A;  3CCL F;  4YJ3 B;  5HY1 A;  3NK7 A;  3HKD B;  3NK6 A;  3TD4 A;  3MBM A;  1SDS A;  4G4V A;  3Q8H A;  2KG4 A;  3VMF B;  5LP6 B;  4X20 A;  1JFF A;  2WAL A;  1K9M H;  2IQQ A;  4O2A A;  3CB2 A;  1CLI A;  1GX1 A;  2VXY A;  4B46 A;  1KC8 H;  5EB1 B;  4BT7 A;  2DT4 A;  3L7Q A;  1Q8R A;  2ZF8 A;  2I6D A;  3CCJ F;  5EIB D;  3OBY A;  5C8Y B;  4IHJ B;  3JAT B;  2UYJ A;  3LWV C;  3VOB A;  3LFO A;  3CCS F;  5J2T B;  3VYT C;  1T0K B;  2CWJ A;  3LWP C;  3IKE A;  3VCZ A;  4M8I A;  2B33 A;  1VQK F;  1GO0 A;  1W5B A;  2RHJ A;  3KIZ A;  1YQN A;  2NMU A;  4O4I B;  5J2U B;  1TUB A;  4LNU B;  4F6R A;  3CG6 A;  3OON A;  4G4X A;  4X1K B;  3KJJ A;  2PMP A;  3VI6 A;  4BT4 A;  3M4S A;  1Z5W A;  1VH8 A;  5JH7 A;  3LYB A;  5EAZ A;  5EO3 A;  1H7M A;  4O4L A;  1OFU A;  5MN5 A;  2W8B C;  1N8R H;  5LP6 C;  3RYI A;  4BT5 A;  2H8E A;  2OTM A;  4C4W C;  2JNB A;  2HRY A;  4C8I A;  3HJW C;  1XBI A;  5FNV A;  4C81 A;  3ZOP A;  4X20 B;  3RA5 A;  1JFF B;  3N2K A;  2LBW A;  1Q82 H;  4XCQ A;  4O2A B;  4U3J A;  5B8F A;  1RQ7 A;  3AGK A;  1RLU A;  2CVL A;  4I4T A;  3C9R A;  2OHW A;  3HKB A;  3LWR C;  1YJW F;  3WPW A;  1K8A H;  4NUT A;  4O2B A;  2BTO A;  3ZP4 A;  2P6Y A;  2Z1E A;  2RB9 A;  4RQO A;  2HS0 A;  4O4J A;  1TUB B;  2G9I A;  4F6R B;  3JAW A;  4B45 A;  4BW0 B;  4I50 A;  3QHD A;  1YI2 F;  3V4D A;  1IPA A;  1VK3 A;  5JH7 B;  3DDN A;  2UYK A;  4O4L B;  2V9Y A;  3TD3 A;  5EWR A;  1S72 F;  3MQW A;  3RYI B;  3WPX A;  2H6L A;  2QA4 F;  5CA1 A;  1YGY A;  5FNV B;  3HKC A;  3WGN A;  5JVD A;  4RHA A;  1U3L A;  2HVY D;  2HP0 A;  3N2K B;  1Q7Y H;  3E1Y A;  2OZB A;  1QVF F;  3IMP A;  4G88 A;  4U3J B;  3LME A;  4ZI7 A;  2MQE A;  1RLG A;  5HY4 A;  4ZHQ A;  1VQP F;  1XHO A;  1X7O A;  2LBT A;  4BVQ A;  2Q1Y A;  4I4T B;  5ITZ A;  3CC7 F;  3HKB B;  3VTI C;  4C8G A;  3JVH A;  4TV8 A;  4FFB A;  3PAF A;  3CCV F;  2FC3 A;  4ZK7 A;  1VQ9 F;  4O2B B;  5HXU A;  3P0Z A;  3O85 A;  1NJI H;  3LWO C;  4O4J B;  3VYS C;  3G4S F;  1NMU B;  3J81 M;  3JAW B;  1PF5 A;  4I50 B;  4EI7 A;  3U0O A;  1FFX B;  3V3T A;  4HNA A;  3K2X A;  4DXD A;  2Q1X A;  3CC4 F;  3SIU A;  5KX5 A;  3F0G A;  3IEQ A;  3P4E A;  4B5C A;  2QTP A;  3SIV A;  3CMA F;  1COM A;  4ZOL A;  1W5F A;  5CA1 B;  3CCU F;  4E6E A;  5JVD B;  3HKC B;  1W5E A;  1VQ8 F;  2GVI A;  2N48 A;  5EB0 A;  3WJR A;  2HP0 B;  5EIB C;  3CYQ A;  1U43 A;  3WJQ A;  2KTU A;  3BYQ A;  5IJ0 A;  3RE3 A;  4ZI7 B;  2ZVY A;  3E22 A;  1UI9 A;  3HKE A;  4ZHQ B;  1VHA A;  3UT5 A;  5LOV A;  3NMU C;  5GIN C;  3ZP7 A;  3ESJ A;  3WGJ A;  5IJ9 A;  5ITZ B;  5GIP C;  5JQG A;  1QU9 A;  3CC2 F;  5MN4 A;  4TV8 B;  1M90 H;  4FFB B;  1RA4 A;  3E20 B;  1VQN F;  3HAX D;  1YIJ F;  3QUW A;  3HWU A;  3N2G A;  1W42 A;  4ZHV A;  2FGY A;  1W57 A;  3FBA A;  2Z1U A;  3JAK A;  4X3L A;  2VGM A;  5FLX M;  4YJ2 A;  3NVK E;  4O4H A;  1Z5V A;  2KTV A;  2IAF A;  1ZWZ A;  5EYP A;  1TVK A;  1KQS F;  3K12 A;  1KNK A;  5KX5 B;  5GIO C;  4NWO B;  4X1I A;  3G71 F;  1IV3 A;  2VGN A;  5BMV A;  3ON1 A;  4ZOL B;  3FD5 A;  4BVT A;  1CK2 A;  3F0E A;  4TUY A;  2CHT A;  4G4W A;  3MCA B;  5MN6 A;  3G6E F;  3CME F;  5IJ0 B;  4ZHY B;  3WGM A;  3E22 B;  5GON A;  2CW4 A;  1VQL F;  3HKE B;  5LOV B;  3UT5 B;  2RHH A;  2BTU A;  3K14 A;  3KJK A;  2Z1F A;  1ODE A;  2ZVZ A;  3WXM B;  4WBN A;  2CZW A;  5IJ9 B;  5FJ4 C;  5JQG B;  1YIT F;  3IR9 A;  1KD1 H;  2LCA A;  2UZH A;  1SA0 A;  3FFM A;  1YHQ F;  1VQ7 F;  3EOR A;  3J7A R;  3B6N A;  3N2G B;  2HS4 A;  2HQS C;  3I56 F;  3S02 A;  1NQ3 A;  3JAK B;  3T80 A;  4DRX A;  4YJ2 B;  3RYF A;  4EB6 A;  4O4H B;  3FPI A;  3D01 A;  1T0A A;  5IYZ A;  1TVK B;  3WJP A;  1XRG A;  2BO1 A;  2HP3 A;  5HXZ A;  2YYE A;  2I6R A;  4X1I B;  5HP8 A;  4TV9 A;  1VQ5 F;  1DT9 A;  2LBX A;  3GYQ A;  3N4Y A;  5BMV B;  1JN1 A;  5KMG A;  2Z01 A;  4BT6 A;  3WGK A;  3PLA C;  5GAP K;  2ALE A;  3S06 A;  3VIU A;  3M84 A;  4U39 A;  5HY2 A;  4TUY B;  1DBF A;  1R1M A;  3MDO A;  2VAW A;  3S03 A;  5JCO A;  1VQM F;  3CYP B;  5GON B;  3RYH A;  1IV2 A;  3C9U A;  1QD9 A;  4BVS A;  1J7H A;  4KWE A;  1GO1 A;  1JJ2 F;  2GLZ A;  1GZ0 A;  5G4V C;  4NQ3 A;  3S0Y A;  1PXW A;  2YXZ A;  2CSL A;  3LWQ C;  1U3P A;  4WBN B;  3JAR A;  1IV1 A;  4ERH A;  5LXT A;  1SA0 B;  5EZY A;  3KE1 A;  2QEX F;  3OBW A;  3IKF A;  1FNK A;  5LA6 A;  2AMT A;  3QTY A;  1X52 A;  5CA0 A;  3CXC F;  1M1K H;  5DCV A;  1H47 A;  1IV4 A;  3RYC A;  2HRU A;  1UFY A;  3D00 A;  5LYJ A;  4IIJ A;  4BVR A;  3MCQ A;  4DRX B;  5HY0 A;  3RYF B;  4EB6 B;  3TD5 A;  1CN7 A;  4BY9 D;  3D54 A;  1W2B F;  5CB4 A;  5HWE A;  4C8E A;  3CPQ A;  5IYZ B;  3IEW A;  3I7T A;  4TZZ A;  3J80 M;  3CCE F;  1OAP A;  4TV9 B;  3VOA A;  2VAM A;  3JAS A;  3R0P A;  2H8C A;  3ELC A;  5KMG B;  2OTJ F;  4G4Z A;  3GTZ A;  3F0F A;  2UYN A;  1QAH A;  4G4Y A;  1RQ2 A;  2ZOD A;  1ONI A;  3KHN A;  1VQO F;  3S0W A;  2UYP A;  3FD6 A;  3RYH B;  3WGL A;  1Q86 H;  4X1Y A;  2IG8 A;  3JCM M;  4HNA B;  3V7E A;  3CD6 F;  1FSZ A;  4ZHW A;  1JD1 A;  3JAL A;  2Z1T A;  3JAR B;  1FNJ A;  5LXT B;  2BTQ B;  3F0D A;  5EZY B;  4I55 A;  1W41 A;  3C8L A;  1X25 A;  3GHZ A;  2RHO A;  1YJN F;  1W40 A;  5LA6 B;  2R6R 1;  1E7K A;  1X7P A;  2EWC A;  5CA0 B;  3RYC B;  5LYJ B;  3RA6 A;  4YJ3 A;  4IIJ B;  1W3E X;  3N4Z A;  2R75 1;  3ERN A;  2ZAU A;  3P10 A;  3HKD A;  3I55 F;  4BT3 A;  3M1X A;  2PHN A;  1VQ4 F;  4BT2 A;  2HS3 A;  2L26 A;  1YJ9 F;  5CB4 B;  1VQ6 F;  5IT9 M;  2KGW A;  5LP6 A;  2AIF A;  1W58 1;  1H48 A;  3C9T A;  1W59 A;  2F9Z C;  5GAN K;  2AIZ P;  4LCK A;  2CHS A;  3JAM M;  3HTN A;  3CCM F;  1JY8 A;  3JAS B;  1KNJ A;  1Q81 H;  4C82 A;  1VQV A;  3K0T A;  3NVI B;  1K73 H;  4PWT A;  3CPW F;  3DC2 A;  4EI8 A;  2DYY A;  2K1S A;  5JCO C;  3CCR F;  2UYN B;  3I3F A;  1QVG F;  1W55 A;  2RHL A;  2HX0 A;  4R40 B;  1FFX A;  5C8Y A;  3CCQ F;  4IHJ A;  2VAP A;  3JAT A;  3ZO8 A;  3S0H A;  5J2T A;  5EYP B;  1U40 A;  2GZL A;  4X1Y B;  4EI9 A;  5G4U C;  1W5A A;  5A2Q M;  1XV2 A;  1SZQ A; 
#chains in the Genus database with same CATH homology
 3EOR A;  4C81 A;  3KE1 A;  1JN1 A;  3F0D A;  3IKF A;  1JY8 A;  1U3L A;  1KNJ A;  3F6M A;  3ELC A;  3P0Z A;  4C82 A;  3B6N A;  3GHZ A;  2AMT A;  3F0E A;  1GX1 A;  1U43 A;  1YQN A;  1H47 A;  1IV4 A;  1W57 A;  3FBA A;  5B8F A;  3F0F A;  3RE3 A;  1W55 A;  2PMP A;  2UZH A;  3QHD A;  3T80 A;  1VHA A;  1VH8 A;  3ERN A;  1IV2 A;  3FPI A;  3P10 A;  3ESJ A;  3K14 A;  1T0A A;  3K2X A;  3MBM A;  4C8E A;  4C8G A;  1U40 A;  2GZL A;  3F0G A;  3IEW A;  1U3P A;  1KNK A;  3IEQ A;  3JVH A;  4C8I A;  3Q8H A;  1IV3 A;  1H48 A;  1IV1 A;  3IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...