3KE1A

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with a fragment-nucleoside fusion d000161829
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
150
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Cytidine derivatives as IspF inhibitors of Burkolderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 150
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ke1A00
2GZLA 3IKEA 1JY8A 1VH8A 1VHAA 4C8EA 1IV2A 1H47A 1KNJA 2PMPA 3IEWA 1U3LA 3K2XA 3FBAA 4C8GA 3P10A 2AMTA 4C82A 1IV3A 3EORA 1YQNA 3FPIA 3K14A 3IKFA 3F0GA 3ERNA 1H48A 3QHDA 3ESJA 1U43A 1T0AA 3B6NA 3F0DA 3P0ZA 4C81A 1U40A 1IV4A 3IEQA 1GX1A 3GHZA 3MBMA 3Q8HA 4C8IA 2UZHA 1W57A 3F0EA 3ELCA 3JVHA 3T80A 3RE3A 1U3PA 3KE1A 1IV1A 1JN1A 1W55A 3F0FA 1KNKA 5B8FA 3F6MA
chains in the Genus database with same CATH superfamily
4LNUB 1Z5VA 2ZF8A 3OONA 1VQ5F 4E6EA 2EWCA 1VQNF 2DYYA 1XBIA 2KTUA 2HRYA 4BVTA 5EYPB 2FGYA 3S03A 3CCVF 3EORA 1VQMF 5IJ0B 4X1KA 3HKEB 2OHWA 2LCAA 3B6NA 4BVQA 3GYQA 4KWEA 2YXZA 1RLUA 1RQ7A 4BVSA 3HKCA 4BT6A 3HKEA 5HY0A 1QVGF 3CPQA 2GZLA 3WXMB 4FFBA 3SIVA 1VHAA 4XCQA 4DRXB 3D00A 3OW2F 2QEXF 4TV8A 3K2XA 2OTJF 4U39A 5EAZA 3G4SF 1IV3A 2OTLF 1COMA 5LYJB 3JASB 3K12A 5CA1A 3VOAA 2Z1TA 3C9TA 4IHJA 4EI7A 1YI2F 4DRXA 3RYHB 4C81A 1YJWF 3MBMA 3DDNA 5EIBD 2KGWA 4YJ2B 1SA0B 3HTNA 1RQ2A 3LWQC 1SDSA 5JVDB 4O4JB 4YJ3B 2BO1A 5JQGB 4YJ2A 4O2BA 3GTZA 4I50A 3I56F 5JVDA 3K14A 1IPAA 1OFUA 4YJ3A 3P0ZA 3E1YA 2RB9A 3NMUC 1GZ0A 3D54A 1FFXA 4C8IA 3L7QA 3R0PA 2VAMA 5ITZB 3LWVC 1X7OA 2QI2A 3FD5A 3F0FA 4X1YA 2ALEA 1FNKA 4EI9A 5MN4A 1NMUB 2QTPA 5LP6B 4X20A 2AIZP 5AVMA 3NVIB 5ITZA 3RYIB 1N8RH 3FBAA 4B5CA 2IG8A 4C82A 3C9UA 1YQNA 3RYFB 2GLZA 1W59A 1H48A 3QHDA 1RLGA 3CMAF 4ZOLB 3RYIA 3K0TA 1W41A 2ZAUA 4X1IB 5BMVB 3RYFA 2RHHA 4I55B 5G4VC 3WPXA 2ZODA 1KNKA 3VOBA 4R40B 4ZHYB 4ZOLA 1JFFB 2AIFA 3HKDB 2NMUA 3LDTA 3UT5A 3I7TA 5GANK 4C8EA 1H47A 2VAWA 3KIZA 3V4DA 5BMVA 3JAKB 4I55A 3S06A 1TVKB 1FSZA 3CCLF 1W581 3LWPC 2I6DA 3FPIA 5GAPK 3HKDA 1Q8RA 2CWJA 4ERHA 1K9MH 1CK2A 1TVKA 4G4YA 3TD4A 4EI8A 3VI6A 3LMEA 3PAFA 3ELCA 2ZVZA 1W5BA 1M1KH 1IV1A 1JN1A 1KQSF 4O4HB 4ZK7A 3QTYA 5B8FA 3F6MA 5J2TB 2CHSA 3JALB 4I4TB 4ZHWA 4O4HA 2IQQA 4TUYB 2CW4A 1JJ2F 2GVIA 1UI9A 3HWUA 3WGKA 3ZOPA 1R1MA 4LNUA 3M1XA 5G4UC 3C9SA 3MCAB 1GX1A 3CB2A 5EYPA 4HNAB 3ZP7A 4X3MA 2HRUA 1U3PA 1M90H 5IJ0A 1K8AH 2CZWA 2F9ZC 5HXZA 1VH8A 4M8IA 2PMPA 4HNAA 4B45A 3TD3A 1W5FA 4TZZA 3P10A 2LBXA 1T0KB 4PWTA 3D01A 2H6LA 4EB6B 2IAFA 4U3JB 2QA4F 5IYZB 5EB0A 1IV4A 3VIUA 3NK7A 3CCEF 2YYEA 1VQ7F 1ZWZA 2LBWA 4BT4A 1W2BF 4WBNB 2OZBA 3ZO8A 4G4XA 1W5EA 5KMGB 5HWEA 5LYJA 3JASA 3S0YA 3G6EF 4G88A 4U3JA 3I3FA 5IYZA 3FD6A 4BT5A 3RYHA 5CA0B 4BY9D 2UYKA 1ONIA 1CN7A 3U0OA 2UYPA 3BYQA 2MQEA 1U3LA 1SA0A 4C8GA 2CSLA 1E7KA 3CCSF 1ODEA 1TUBB 5MN5A 3CG6A 3LWRC 2HS0A 3ERNA 3ESJA 4O4JA 2K1SA 4TV9B 3F0DA 2HP3A 5A2QM 5JQGA 3LFOA 1VQKF 5LOVB 4BT2A 3Q8HA 3CCJF 5LXTB 2RHLA 3V3TA 1VK3A 3AGKA 1YITF 3VO8A 5LOVA 1QD9A 3J81M 4F6RB 4LCKA 2HS3A 2Z1UA 5GIPC 1H7MA 2G9IA 1W42A 2HVYD 2LBTA 1VQ9F 3VCZA 2CVLA 1T0AA 3JAWB 3TD5A 4B46A 5LP6A 3VYUC 3HJWC 1PXWA 2ZVYA 2KTVA 3JARB 1VQOF 3T80A 1Q7YH 2ZOVA 3JCMM 2KG4A 3OBWA 3N2GB 3VMFB 5LA6B 3JAWA 4BVRA 2CHTA 1X25A 1IV2A 3JARA 1KNJA 3E20B 5JCOC 2RHJA 4X1IA 3CC4F 3LYBA 5C8YB 3NK6A 3I55F 1JFFA 4O4IB 3CCRF 3IMPA 2HS4A 1UFYA 2VGNA 3S02A 3GHZA 4B62A 2Z1EA 3JAKA 1VQVA 3CCMF 1X7PA 3F0EA 4NQ3A 5HP7A 2RHOA 3V7EA 4O4IA 4BT7A 4O4LB 4G4ZA 3LWOC 3IR9A 3N4ZA 5HXUA 5CB4B 5HP8A 3CCQF 3IEWA 3FFMA 2Q1XA 5EWRA 3CC2F 1YHQF 2BTQB 5EB1B 5J2TA 3QUWA 3WGNA 3CYPB 3MDOA 3IEQA 5HY2A 3JALA 4BT3A 4I4TA 4TUYA 2PHNA 3RE3A 2Z1FA 1XV2A 3KE1A 1GO0A 3SIUA 2P6YA 4NWOB 3WJQA 4X1KB 1KC8H 3KHNA 1NJIH 2WALA 3M84A 4G4VA 3WGJA 3RYCB 2FC3A 5FLXM 1VQPF 3KJKA 4ZHVA 3HKCB 1RA4A 2VGMA 2DT4A 5HY1A 1X52A 3E22B 3RA6A 5EZYB 5IT9M 3J80M 4FFBB 1J7HA 1Q81H 3RYCA 3ZP4A 5IJ9B 1PF5A 1Z5WA 1YJNF 4TV8B 2VXYA 1NQ3A 5GONB 4RQOA 3PLAC 3MCQA 3VTIC 2OTMA 3E22A 1VQ6F 5EZYA 4EB6A 5CA1B 5GINC 1XHOA 4ZHQB 4IHJB 5HY4A 5IJ9A 3V7QA 1S72F 3JAMM 1VQLF 5GONA 3HAXD 4WBNA 1CLIA 3HKBB 2Z01A 5KMGA 1GO1A 2AMTA 2VAPA 3RA5A 1JD1A 3N4YA 3IKFA 5MN6A 4ZHQA 5CA0A 5J2UB 1DBFA 3J7AR 4X3LA 3HKBA 3S0HA 3N2KB 4O2BB 4I50B 2UZHA 3NVKE 1W57A 1TUBA 1DT9A 5J2UA 2H8EA 1QVFF 5FJ4C 4TV9A 3VYSC 3CCUF 5EIBC 1YGYA 3N2KA 3DC2A 1QU9A 1FFXB 5LXTA 1OAPA 1W3EX 4X1YB 3KJJA 3MQWA 5JCOA 4ZI7B 3CC7F 3CXCF 2UYNB 4F6RA 5GIOC 5JH7B 4X20B 4DXDA 2BTOA 3CD6F 3O85A 3OBYA 3G71F 4NUTA 3JATB 4ZI7A 2UYNA 3P4EA 5JH7A 1JY8A 3WGMA 2R6R1 3WGLA 1YJ9F 4C4WC 2L26A 3JATA 2UYJA 5DCVA 3N2GA 4RHAA 3WJPA 1YIJF 5LA6A 4BW0B 2HP0B 3M4SA 2B33A 2HQSC 3UT5B 3C9RA 5KX5B 2R751 1K73H 3WPWA 3JVHA 5C8YA 1VQ8F 2HP0A 1Q86H 2Q1YA 4O2AB 1VQ4F 1KD1H 1XRGA 2JNBA 3IKEA 3ON1A 3VYTC 5KX5A 1Q82H 1SZQA 2W8BC 5LP6C 5FNVB 1W40A 3CMEF 3CYQA 1FNJA 1W5AA 4IIJB 4O2AA 3WJRA 4O4LA 3F0GA 1QAHA 2H8CA 3C8LA 5CB4A 1U43A 1U40A 2HX0A 2N48A 2V9YA 5FNVA 4G4WA 2I6RA 2BTUA 4IIJA 5EO3A 3S0WA 1W55A 3CPWF
chains in the Genus database with same CATH topology
2GZLA 3IKEA 1JY8A 1VH8A 1VHAA 4C8EA 1IV2A 1H47A 1KNJA 2PMPA 3IEWA 1U3LA 3K2XA 3FBAA 4C8GA 3P10A 2AMTA 4C82A 1IV3A 3EORA 1YQNA 3FPIA 3K14A 3IKFA 3F0GA 3ERNA 1H48A 3QHDA 3ESJA 1U43A 1T0AA 3B6NA 3F0DA 3P0ZA 4C81A 1U40A 1IV4A 3IEQA 1GX1A 3GHZA 3MBMA 3Q8HA 4C8IA 2UZHA 1W57A 3F0EA 3ELCA 3JVHA 3T80A 3RE3A 1U3PA 3KE1A 1IV1A 1JN1A 1W55A 3F0FA 1KNKA 5B8FA 3F6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZL A;  3IKE A;  1JY8 A;  1VH8 A;  1VHA A;  4C8E A;  1IV2 A;  1H47 A;  1KNJ A;  2PMP A;  3IEW A;  1U3L A;  3K2X A;  3FBA A;  4C8G A;  3P10 A;  2AMT A;  4C82 A;  1IV3 A;  3EOR A;  1YQN A;  3FPI A;  3K14 A;  3IKF A;  3F0G A;  3ERN A;  1H48 A;  3QHD A;  3ESJ A;  1U43 A;  1T0A A;  3B6N A;  3F0D A;  3P0Z A;  4C81 A;  1U40 A;  1IV4 A;  3IEQ A;  1GX1 A;  3GHZ A;  3MBM A;  3Q8H A;  4C8I A;  2UZH A;  1W57 A;  3F0E A;  3ELC A;  3JVH A;  3T80 A;  3RE3 A;  1U3P A;  3KE1 A;  1IV1 A;  1JN1 A;  1W55 A;  3F0F A;  1KNK A;  5B8F A;  3F6M A; 
#chains in the Genus database with same CATH topology
 4LNU B;  1Z5V A;  2ZF8 A;  3OON A;  1VQ5 F;  4E6E A;  2EWC A;  1VQN F;  2DYY A;  1XBI A;  2KTU A;  2HRY A;  4BVT A;  5EYP B;  2FGY A;  3S03 A;  3CCV F;  3EOR A;  1VQM F;  5IJ0 B;  4X1K A;  3HKE B;  2OHW A;  2LCA A;  3B6N A;  4BVQ A;  3GYQ A;  4KWE A;  2YXZ A;  1RLU A;  1RQ7 A;  4BVS A;  3HKC A;  4BT6 A;  3HKE A;  5HY0 A;  1QVG F;  3CPQ A;  2GZL A;  3WXM B;  4FFB A;  3SIV A;  1VHA A;  4XCQ A;  4DRX B;  3D00 A;  3OW2 F;  2QEX F;  4TV8 A;  3K2X A;  2OTJ F;  4U39 A;  5EAZ A;  3G4S F;  1IV3 A;  2OTL F;  1COM A;  5LYJ B;  3JAS B;  3K12 A;  5CA1 A;  3VOA A;  2Z1T A;  3C9T A;  4IHJ A;  4EI7 A;  1YI2 F;  4DRX A;  3RYH B;  4C81 A;  1YJW F;  3MBM A;  3DDN A;  5EIB D;  2KGW A;  4YJ2 B;  1SA0 B;  3HTN A;  1RQ2 A;  3LWQ C;  1SDS A;  5JVD B;  4O4J B;  4YJ3 B;  2BO1 A;  5JQG B;  4YJ2 A;  4O2B A;  3GTZ A;  4I50 A;  3I56 F;  5JVD A;  3K14 A;  1IPA A;  1OFU A;  4YJ3 A;  3P0Z A;  3E1Y A;  2RB9 A;  3NMU C;  1GZ0 A;  3D54 A;  1FFX A;  4C8I A;  3L7Q A;  3R0P A;  2VAM A;  5ITZ B;  3LWV C;  1X7O A;  2QI2 A;  3FD5 A;  3F0F A;  4X1Y A;  2ALE A;  1FNK A;  4EI9 A;  5MN4 A;  1NMU B;  2QTP A;  5LP6 B;  4X20 A;  2AIZ P;  5AVM A;  3NVI B;  5ITZ A;  3RYI B;  1N8R H;  3FBA A;  4B5C A;  2IG8 A;  4C82 A;  3C9U A;  1YQN A;  3RYF B;  2GLZ A;  1W59 A;  1H48 A;  3QHD A;  1RLG A;  3CMA F;  4ZOL B;  3RYI A;  3K0T A;  1W41 A;  2ZAU A;  4X1I B;  5BMV B;  3RYF A;  2RHH A;  4I55 B;  5G4V C;  3WPX A;  2ZOD A;  1KNK A;  3VOB A;  4R40 B;  4ZHY B;  4ZOL A;  1JFF B;  2AIF A;  3HKD B;  2NMU A;  3LDT A;  3UT5 A;  3I7T A;  5GAN K;  4C8E A;  1H47 A;  2VAW A;  3KIZ A;  3V4D A;  5BMV A;  3JAK B;  4I55 A;  3S06 A;  1TVK B;  1FSZ A;  3CCL F;  1W58 1;  3LWP C;  2I6D A;  3FPI A;  5GAP K;  3HKD A;  1Q8R A;  2CWJ A;  4ERH A;  1K9M H;  1CK2 A;  1TVK A;  4G4Y A;  3TD4 A;  4EI8 A;  3VI6 A;  3LME A;  3PAF A;  3ELC A;  2ZVZ A;  1W5B A;  1M1K H;  1IV1 A;  1JN1 A;  1KQS F;  4O4H B;  4ZK7 A;  3QTY A;  5B8F A;  3F6M A;  5J2T B;  2CHS A;  3JAL B;  4I4T B;  4ZHW A;  4O4H A;  2IQQ A;  4TUY B;  2CW4 A;  1JJ2 F;  2GVI A;  1UI9 A;  3HWU A;  3WGK A;  3ZOP A;  1R1M A;  4LNU A;  3M1X A;  5G4U C;  3C9S A;  3MCA B;  1GX1 A;  3CB2 A;  5EYP A;  4HNA B;  3ZP7 A;  4X3M A;  2HRU A;  1U3P A;  1M90 H;  5IJ0 A;  1K8A H;  2CZW A;  2F9Z C;  5HXZ A;  1VH8 A;  4M8I A;  2PMP A;  4HNA A;  4B45 A;  3TD3 A;  1W5F A;  4TZZ A;  3P10 A;  2LBX A;  1T0K B;  4PWT A;  3D01 A;  2H6L A;  4EB6 B;  2IAF A;  4U3J B;  2QA4 F;  5IYZ B;  5EB0 A;  1IV4 A;  3VIU A;  3NK7 A;  3CCE F;  2YYE A;  1VQ7 F;  1ZWZ A;  2LBW A;  4BT4 A;  1W2B F;  4WBN B;  2OZB A;  3ZO8 A;  4G4X A;  1W5E A;  5KMG B;  5HWE A;  5LYJ A;  3JAS A;  3S0Y A;  3G6E F;  4G88 A;  4U3J A;  3I3F A;  5IYZ A;  3FD6 A;  4BT5 A;  3RYH A;  5CA0 B;  4BY9 D;  2UYK A;  1ONI A;  1CN7 A;  3U0O A;  2UYP A;  3BYQ A;  2MQE A;  1U3L A;  1SA0 A;  4C8G A;  2CSL A;  1E7K A;  3CCS F;  1ODE A;  1TUB B;  5MN5 A;  3CG6 A;  3LWR C;  2HS0 A;  3ERN A;  3ESJ A;  4O4J A;  2K1S A;  4TV9 B;  3F0D A;  2HP3 A;  5A2Q M;  5JQG A;  3LFO A;  1VQK F;  5LOV B;  4BT2 A;  3Q8H A;  3CCJ F;  5LXT B;  2RHL A;  3V3T A;  1VK3 A;  3AGK A;  1YIT F;  3VO8 A;  5LOV A;  1QD9 A;  3J81 M;  4F6R B;  4LCK A;  2HS3 A;  2Z1U A;  5GIP C;  1H7M A;  2G9I A;  1W42 A;  2HVY D;  2LBT A;  1VQ9 F;  3VCZ A;  2CVL A;  1T0A A;  3JAW B;  3TD5 A;  4B46 A;  5LP6 A;  3VYU C;  3HJW C;  1PXW A;  2ZVY A;  2KTV A;  3JAR B;  1VQO F;  3T80 A;  1Q7Y H;  2ZOV A;  3JCM M;  2KG4 A;  3OBW A;  3N2G B;  3VMF B;  5LA6 B;  3JAW A;  4BVR A;  2CHT A;  1X25 A;  1IV2 A;  3JAR A;  1KNJ A;  3E20 B;  5JCO C;  2RHJ A;  4X1I A;  3CC4 F;  3LYB A;  5C8Y B;  3NK6 A;  3I55 F;  1JFF A;  4O4I B;  3CCR F;  3IMP A;  2HS4 A;  1UFY A;  2VGN A;  3S02 A;  3GHZ A;  4B62 A;  2Z1E A;  3JAK A;  1VQV A;  3CCM F;  1X7P A;  3F0E A;  4NQ3 A;  5HP7 A;  2RHO A;  3V7E A;  4O4I A;  4BT7 A;  4O4L B;  4G4Z A;  3LWO C;  3IR9 A;  3N4Z A;  5HXU A;  5CB4 B;  5HP8 A;  3CCQ F;  3IEW A;  3FFM A;  2Q1X A;  5EWR A;  3CC2 F;  1YHQ F;  2BTQ B;  5EB1 B;  5J2T A;  3QUW A;  3WGN A;  3CYP B;  3MDO A;  3IEQ A;  5HY2 A;  3JAL A;  4BT3 A;  4I4T A;  4TUY A;  2PHN A;  3RE3 A;  2Z1F A;  1XV2 A;  3KE1 A;  1GO0 A;  3SIU A;  2P6Y A;  4NWO B;  3WJQ A;  4X1K B;  1KC8 H;  3KHN A;  1NJI H;  2WAL A;  3M84 A;  4G4V A;  3WGJ A;  3RYC B;  2FC3 A;  5FLX M;  1VQP F;  3KJK A;  4ZHV A;  3HKC B;  1RA4 A;  2VGM A;  2DT4 A;  5HY1 A;  1X52 A;  3E22 B;  3RA6 A;  5EZY B;  5IT9 M;  3J80 M;  4FFB B;  1J7H A;  1Q81 H;  3RYC A;  3ZP4 A;  5IJ9 B;  1PF5 A;  1Z5W A;  1YJN F;  4TV8 B;  2VXY A;  1NQ3 A;  5GON B;  4RQO A;  3PLA C;  3MCQ A;  3VTI C;  2OTM A;  3E22 A;  1VQ6 F;  5EZY A;  4EB6 A;  5CA1 B;  5GIN C;  1XHO A;  4ZHQ B;  4IHJ B;  5HY4 A;  5IJ9 A;  3V7Q A;  1S72 F;  3JAM M;  1VQL F;  5GON A;  3HAX D;  4WBN A;  1CLI A;  3HKB B;  2Z01 A;  5KMG A;  1GO1 A;  2AMT A;  2VAP A;  3RA5 A;  1JD1 A;  3N4Y A;  3IKF A;  5MN6 A;  4ZHQ A;  5CA0 A;  5J2U B;  1DBF A;  3J7A R;  4X3L A;  3HKB A;  3S0H A;  3N2K B;  4O2B B;  4I50 B;  2UZH A;  3NVK E;  1W57 A;  1TUB A;  1DT9 A;  5J2U A;  2H8E A;  1QVF F;  5FJ4 C;  4TV9 A;  3VYS C;  3CCU F;  5EIB C;  1YGY A;  3N2K A;  3DC2 A;  1QU9 A;  1FFX B;  5LXT A;  1OAP A;  1W3E X;  4X1Y B;  3KJJ A;  3MQW A;  5JCO A;  4ZI7 B;  3CC7 F;  3CXC F;  2UYN B;  4F6R A;  5GIO C;  5JH7 B;  4X20 B;  4DXD A;  2BTO A;  3CD6 F;  3O85 A;  3OBY A;  3G71 F;  4NUT A;  3JAT B;  4ZI7 A;  2UYN A;  3P4E A;  5JH7 A;  1JY8 A;  3WGM A;  2R6R 1;  3WGL A;  1YJ9 F;  4C4W C;  2L26 A;  3JAT A;  2UYJ A;  5DCV A;  3N2G A;  4RHA A;  3WJP A;  1YIJ F;  5LA6 A;  4BW0 B;  2HP0 B;  3M4S A;  2B33 A;  2HQS C;  3UT5 B;  3C9R A;  5KX5 B;  2R75 1;  1K73 H;  3WPW A;  3JVH A;  5C8Y A;  1VQ8 F;  2HP0 A;  1Q86 H;  2Q1Y A;  4O2A B;  1VQ4 F;  1KD1 H;  1XRG A;  2JNB A;  3IKE A;  3ON1 A;  3VYT C;  5KX5 A;  1Q82 H;  1SZQ A;  2W8B C;  5LP6 C;  5FNV B;  1W40 A;  3CME F;  3CYQ A;  1FNJ A;  1W5A A;  4IIJ B;  4O2A A;  3WJR A;  4O4L A;  3F0G A;  1QAH A;  2H8C A;  3C8L A;  5CB4 A;  1U43 A;  1U40 A;  2HX0 A;  2N48 A;  2V9Y A;  5FNV A;  4G4W A;  2I6R A;  2BTU A;  4IIJ A;  5EO3 A;  3S0W A;  1W55 A;  3CPW F; 
#chains in the Genus database with same CATH homology
 2GZL A;  3IKE A;  1JY8 A;  1VH8 A;  1VHA A;  4C8E A;  1IV2 A;  1H47 A;  1KNJ A;  2PMP A;  3IEW A;  1U3L A;  3K2X A;  3FBA A;  4C8G A;  3P10 A;  2AMT A;  4C82 A;  1IV3 A;  3EOR A;  1YQN A;  3FPI A;  3K14 A;  3IKF A;  3F0G A;  3ERN A;  1H48 A;  3QHD A;  3ESJ A;  1U43 A;  1T0A A;  3B6N A;  3F0D A;  3P0Z A;  4C81 A;  1U40 A;  1IV4 A;  3IEQ A;  1GX1 A;  3GHZ A;  3MBM A;  3Q8H A;  4C8I A;  2UZH A;  1W57 A;  3F0E A;  3ELC A;  3JVH A;  3T80 A;  3RE3 A;  1U3P A;  3KE1 A;  1IV1 A;  1JN1 A;  1W55 A;  3F0F A;  1KNK A;  5B8F A;  3F6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...