1JY8A

2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2C-methyl-d-erythritol-2,4-cyclodiphosphate synthase involved in mevalonate-independent biosynthesis of isoprenoids.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jy8A00
1IV2A 1GX1A 3IEWA 1VH8A 1KNJA 1IV3A 3KE1A 1IV4A 3ERNA 3F6MA 1T0AA 3K2XA 3ESJA 3JVHA 3MBMA 3RE3A 3B6NA 3QHDA 3IKEA 1JN1A 1H48A 2UZHA 3F0FA 3P0ZA 3FBAA 3F0DA 3IEQA 1VHAA 3GHZA 1H47A 5B8FA 4C8IA 4C8EA 1U3LA 3F0EA 3ELCA 4C8GA 4C82A 3K14A 3P10A 4C81A 1W57A 1YQNA 2PMPA 3Q8HA 1JY8A 1U43A 3T80A 2AMTA 3F0GA 1U40A 3EORA 1KNKA 1IV1A 3IKFA 3FPIA 2GZLA 1U3PA 1W55A
chains in the Genus database with same CATH superfamily
3RYFB 5MN4A 5JQGA 4ZOLA 1YHQF 1W5BA 1XV2A 5LXTA 4G4YA 2W8BC 3K0TA 1IPAA 3KHNA 1YGYA 3FBAA 1KC8H 3E22B 3S0WA 3CCJF 2HX0A 5HY0A 1T0KB 3MCAB 4O4HA 3WPWA 5C8YA 3RYCB 1VQ6F 3NVKE 2LBTA 2H6LA 2HRUA 3JATA 4O4JA 2LBWA 3LYBA 5KMGA 2OHWA 4ZI7A 3QTYA 1GZ0A 2I6DA 2UYNB 5HP8A 1JFFB 4O2AA 4EB6B 3VYUC 3ON1A 4TV9B 3OW2F 4TZZA 2V9YA 5IYZA 3K12A 1XRGA 1M90H 3LWOC 2RHHA 3ESJA 1QVGF 4B46A 3I56F 5IJ9B 1NMUB 3HKEB 1XHOA 2GLZA 3CC2F 4HNAB 5MN6A 5GIOC 5GINC 4LNUA 4BT4A 4X1IB 2QTPA 2OTLF 1U40A 3CXCF 4YJ2B 1U3PA 4O4LA 1RA4A 5EWRA 2P6YA 2WALA 3WGNA 4KWEA 1S72F 5EB1B 4PWTA 2HQSC 3HAXD 3VMFB 3CD6F 3MCQA 4ZHQA 2BTQB 2VGNA 2HP0A 3D54A 1KD1H 2RHLA 3K14A 1VQ5F 1J7HA 4ZHVA 1FNKA 1SZQA 1R1MA 4ZHQB 1ODEA 3RA6A 2UYNA 4BT7A 3N4ZA 5HXUA 3TD4A 1TUBA 5FLXM 4BVTA 1KQSF 1VQLF 3M84A 3WGMA 1IV3A 1OFUA 4X3LA 1TVKB 1QAHA 5GANK 5JH7B 5KX5B 2QEXF 3VCZA 1Z5VA 4FFBB 3F0FA 1Q82H 2N48A 5ITZA 2EWCA 4BT3A 3CC4F 3G71F 3JASB 3NMUC 5EZYA 1U3LA 1W40A 5KMGB 1NJIH 2Z1EA 3CCVF 2OTMA 1JFFA 1SDSA 4I55B 3ZO8A 5ITZB 3EORA 2L26A 3VOAA 4R40B 4B62A 3PLAC 4IIJB 2ZAUA 2CSLA 4NQ3A 1JD1A 3ZOPA 3S03A 3KIZA 1Q86H 4EI9A 1UI9A 3S02A 3QUWA 5HWEA 1VQKF 5IJ9A 3VI6A 4U3JA 2H8EA 1JN1A 2YXZA 1VHAA 3GHZA 4ZK7A 3ZP4A 3C9TA 4X20A 3RYIA 3RYHB 3S06A 2NMUA 3IR9A 4BVSA 3HKBA 2Z1FA 1TUBB 3E20B 5BMVA 2QA4F 1YITF 3JATB 4O4JB 3ERNA 3JALA 3LWVC 3LMEA 3D01A 3CCEF 1X52A 3CMEF 5DCVA 3QHDA 1RQ2A 2Q1YA 3IKEA 2UZHA 4DRXA 2Z1UA 3I55F 3HWUA 1VQMF 5EZYB 1VQ9F 1DT9A 5FJ4C 3JALB 4B5CA 1W2BF 2HP3A 3CCLF 1X7PA 3FFMA 3TD5A 3J80M 3V3TA 1YJ9F 5J2UA 5EIBC 5C8YB 3R0PA 3CCQF 4ZHWA 3FD5A 4BY9D 5GONB 5EYPB 3DC2A 1W55A 3U0OA 3JARA 3OONA 2ZODA 3WXMB 2RHJA 4E6EA 3VYSC 5JCOC 3DDNA 1H48A 3M1XA 4YJ3B 2KG4A 2ZF8A 3TD3A 3HJWC 3OBWA 5AVMA 3S0HA 4C8EA 4C82A 1RQ7A 2R6R1 2B33A 4NWOB 3JCMM 2UYJA 4LCKA 3FPIA 5IJ0A 1X7OA 5LP6C 1FNJA 3JAWA 3J81M 4EI8A 4X1IA 3WGKA 1T0AA 1ZWZA 2DT4A 3M4SA 3MQWA 4YJ2A 3E22A 5GAPK 4ERHA 4DRXB 3PAFA 3LWPC 3AGKA 3JAWB 3C9SA 5LYJA 2IG8A 5A2QM 3J7AR 2AIZP 3ELCA 2AIFA 5JVDA 3CPQA 3P10A 1W5AA 3WJRA 1Z5WA 2FGYA 3LDTA 4O2BA 3CCRF 5EIBD 1Q8RA 4G4WA 3ZP7A 5HY1A 5HP7A 5CB4B 2KTVA 3KJKA 4TV9A 2GZLA 5JVDB 2YYEA 3FD6A 3CCUF 4NUTA 1SA0B 1VQPF 4I50B 2LCAA 1RLUA 1Q7YH 3VOBA 2CVLA 2VAWA 3P0ZA 5LOVB 3I3FA 4F6RB 5IT9M 1Q81H 3V4DA 2PHNA 3SIUA 2K1SA 3T80A 3N2KA 4BT6A 1GX1A 1KNJA 4X20B 1IV4A 3RYIB 2HS3A 2UYKA 3LWQC 3F6MA 4X3MA 5EB0A 4U39A 1VQNF 3JVHA 3HKBB 3NK6A 1OAPA 4G4ZA 3RYFA 1FSZA 5BMVB 3CMAF 1FFXB 2Z1TA 3LWRC 2ALEA 5EO3A 2MQEA 3VIUA 3C8LA 2VXYA 2DYYA 4C8GA 1QD9A 3KJJA 2ZVZA 1VQ7F 3CB2A 2Q1XA 5J2TB 3F0GA 5HXZA 3WPXA 3L7QA 5LP6B 1E7KA 3NVIB 4FFBA 3E1YA 1CLIA 3IEWA 5GIPC 3WGLA 5KX5A 3P4EA 2VAMA 2I6RA 4RQOA 3HKDB 1CK2A 4IHJA 4O4IA 4EB6A 2HS4A 4I50A 1XBIA 3JASA 3G6EF 5CA0A 1VK3A 4WBNA 3S0YA 1ONIA 2BO1A 1YJWF 3D00A 4XCQA 1W57A 2BTOA 1JJ2F 4B45A 1K73H 4G4VA 3N2KB 4HNAA 1YJNF 1IV2A 4U3JB 3WGJA 2FC3A 2IQQA 3GTZA 5HY4A 2Z01A 4I4TA 1W42A 3C9UA 3JARB 3UT5A 2VGMA 5JCOA 3F0DA 1W581 2UYPA 2VAPA 1H47A 4C4WC 3F0EA 4O2AB 4RHAA 4BT5A 2OTJF 5LA6A 3VO8A 5FNVA 3NK7A 5LXTB 1VQOF 1N8RH 1QU9A 3HTNA 4EI7A 3V7QA 4ZHYB 1NQ3A 1YIJF 2IAFA 3WJPA 2KTUA 4X1YA 1YI2F 5CB4A 5IJ0B 1TVKA 3RE3A 3CCMF 1FFXA 4M8IA 4TV8A 1M1KH 4LNUB 3HKCB 3I7TA 4TUYA 5CA1A 5B8FA 5JH7A 3VYTC 2CWJA 3LFOA 5J2TA 3MDOA 1X25A 1YQNA 4TV8B 1W59A 1K8AH 2HS0A 5GONA 3JAMM 5EYPA 2HVYD 3VTIC 3MBMA 1H7MA 1VH8A 4IHJB 3N2GB 4I55A 3RA5A 1W41A 4G88A 4IIJA 2QI2A 1VQ4F 2HP0B 1DBFA 1W3EX 3JAKA 2CW4A 4WBNB 3UT5B 4BVQA 3GYQA 4C8IA 2G9IA 2CHSA 4O4LB 1CN7A 2GVIA 4O4HB 3Q8HA 2PMPA 5LA6B 4F6RA 1K9MH 2AMTA 3CC7F 1W5FA 1IV1A 2KGWA 3IKFA 4BW0B 2F9ZC 5EAZA 5JQGB 3RYHA 4I4TB 2R751 4ZOLB 3K2XA 3SIVA 5LYJB 2RHOA 3HKCA 3C9RA 3OBYA 3CCSF 1QVFF 4O2BB 3IMPA 4BT2A 3RYCA 4DXDA 2ZVYA 1COMA 5FNVB 4X1KA 1VQ8F 4O4IB 4C81A 4ZI7B 5CA0B 1KNKA 3CG6A 3CYPB 5J2UB 1PXWA 1JY8A 4X1KB 5HY2A 3N2GA 4X1YB 1SA0A 5IYZB 3KE1A 2CHTA 2OZBA 2HRYA 5LP6A 3BYQA 5LOVA 3B6NA 2JNBA 4TUYB 2BTUA 1W5EA 5CA1B 3CPWF 3JAKB 2H8CA 1RLGA 1GO1A 2LBXA 3HKEA 3G4SF 3IEQA 2ZOVA 3HKDA 4YJ3A 3V7EA 4BVRA 5MN5A 3CYQA 1VQVA 1PF5A 5G4VC 1UFYA 2RB9A 4G4XA 3N4YA 3WJQA 3O85A 1U43A 1GO0A 5G4UC 2CZWA
chains in the Genus database with same CATH topology
1IV2A 1GX1A 3IEWA 1VH8A 1KNJA 1IV3A 3KE1A 1IV4A 3ERNA 3F6MA 1T0AA 3K2XA 3ESJA 3JVHA 3MBMA 3RE3A 3B6NA 3QHDA 3IKEA 1JN1A 1H48A 2UZHA 3F0FA 3P0ZA 3FBAA 3F0DA 3IEQA 1VHAA 3GHZA 1H47A 5B8FA 4C8IA 4C8EA 1U3LA 3F0EA 3ELCA 4C8GA 4C82A 3K14A 3P10A 4C81A 1W57A 1YQNA 2PMPA 3Q8HA 1JY8A 1U43A 3T80A 2AMTA 3F0GA 1U40A 3EORA 1KNKA 1IV1A 3IKFA 3FPIA 2GZLA 1U3PA 1W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV2 A;  1GX1 A;  3IEW A;  1VH8 A;  1KNJ A;  1IV3 A;  3KE1 A;  1IV4 A;  3ERN A;  3F6M A;  1T0A A;  3K2X A;  3ESJ A;  3JVH A;  3MBM A;  3RE3 A;  3B6N A;  3QHD A;  3IKE A;  1JN1 A;  1H48 A;  2UZH A;  3F0F A;  3P0Z A;  3FBA A;  3F0D A;  3IEQ A;  1VHA A;  3GHZ A;  1H47 A;  5B8F A;  4C8I A;  4C8E A;  1U3L A;  3F0E A;  3ELC A;  4C8G A;  4C82 A;  3K14 A;  3P10 A;  4C81 A;  1W57 A;  1YQN A;  2PMP A;  3Q8H A;  1JY8 A;  1U43 A;  3T80 A;  2AMT A;  3F0G A;  1U40 A;  3EOR A;  1KNK A;  1IV1 A;  3IKF A;  3FPI A;  2GZL A;  1U3P A;  1W55 A; 
#chains in the Genus database with same CATH topology
 3RYF B;  5MN4 A;  5JQG A;  4ZOL A;  1YHQ F;  1W5B A;  1XV2 A;  5LXT A;  4G4Y A;  2W8B C;  3K0T A;  1IPA A;  3KHN A;  1YGY A;  3FBA A;  1KC8 H;  3E22 B;  3S0W A;  3CCJ F;  2HX0 A;  5HY0 A;  1T0K B;  3MCA B;  4O4H A;  3WPW A;  5C8Y A;  3RYC B;  1VQ6 F;  3NVK E;  2LBT A;  2H6L A;  2HRU A;  3JAT A;  4O4J A;  2LBW A;  3LYB A;  5KMG A;  2OHW A;  4ZI7 A;  3QTY A;  1GZ0 A;  2I6D A;  2UYN B;  5HP8 A;  1JFF B;  4O2A A;  4EB6 B;  3VYU C;  3ON1 A;  4TV9 B;  3OW2 F;  4TZZ A;  2V9Y A;  5IYZ A;  3K12 A;  1XRG A;  1M90 H;  3LWO C;  2RHH A;  3ESJ A;  1QVG F;  4B46 A;  3I56 F;  5IJ9 B;  1NMU B;  3HKE B;  1XHO A;  2GLZ A;  3CC2 F;  4HNA B;  5MN6 A;  5GIO C;  5GIN C;  4LNU A;  4BT4 A;  4X1I B;  2QTP A;  2OTL F;  1U40 A;  3CXC F;  4YJ2 B;  1U3P A;  4O4L A;  1RA4 A;  5EWR A;  2P6Y A;  2WAL A;  3WGN A;  4KWE A;  1S72 F;  5EB1 B;  4PWT A;  2HQS C;  3HAX D;  3VMF B;  3CD6 F;  3MCQ A;  4ZHQ A;  2BTQ B;  2VGN A;  2HP0 A;  3D54 A;  1KD1 H;  2RHL A;  3K14 A;  1VQ5 F;  1J7H A;  4ZHV A;  1FNK A;  1SZQ A;  1R1M A;  4ZHQ B;  1ODE A;  3RA6 A;  2UYN A;  4BT7 A;  3N4Z A;  5HXU A;  3TD4 A;  1TUB A;  5FLX M;  4BVT A;  1KQS F;  1VQL F;  3M84 A;  3WGM A;  1IV3 A;  1OFU A;  4X3L A;  1TVK B;  1QAH A;  5GAN K;  5JH7 B;  5KX5 B;  2QEX F;  3VCZ A;  1Z5V A;  4FFB B;  3F0F A;  1Q82 H;  2N48 A;  5ITZ A;  2EWC A;  4BT3 A;  3CC4 F;  3G71 F;  3JAS B;  3NMU C;  5EZY A;  1U3L A;  1W40 A;  5KMG B;  1NJI H;  2Z1E A;  3CCV F;  2OTM A;  1JFF A;  1SDS A;  4I55 B;  3ZO8 A;  5ITZ B;  3EOR A;  2L26 A;  3VOA A;  4R40 B;  4B62 A;  3PLA C;  4IIJ B;  2ZAU A;  2CSL A;  4NQ3 A;  1JD1 A;  3ZOP A;  3S03 A;  3KIZ A;  1Q86 H;  4EI9 A;  1UI9 A;  3S02 A;  3QUW A;  5HWE A;  1VQK F;  5IJ9 A;  3VI6 A;  4U3J A;  2H8E A;  1JN1 A;  2YXZ A;  1VHA A;  3GHZ A;  4ZK7 A;  3ZP4 A;  3C9T A;  4X20 A;  3RYI A;  3RYH B;  3S06 A;  2NMU A;  3IR9 A;  4BVS A;  3HKB A;  2Z1F A;  1TUB B;  3E20 B;  5BMV A;  2QA4 F;  1YIT F;  3JAT B;  4O4J B;  3ERN A;  3JAL A;  3LWV C;  3LME A;  3D01 A;  3CCE F;  1X52 A;  3CME F;  5DCV A;  3QHD A;  1RQ2 A;  2Q1Y A;  3IKE A;  2UZH A;  4DRX A;  2Z1U A;  3I55 F;  3HWU A;  1VQM F;  5EZY B;  1VQ9 F;  1DT9 A;  5FJ4 C;  3JAL B;  4B5C A;  1W2B F;  2HP3 A;  3CCL F;  1X7P A;  3FFM A;  3TD5 A;  3J80 M;  3V3T A;  1YJ9 F;  5J2U A;  5EIB C;  5C8Y B;  3R0P A;  3CCQ F;  4ZHW A;  3FD5 A;  4BY9 D;  5GON B;  5EYP B;  3DC2 A;  1W55 A;  3U0O A;  3JAR A;  3OON A;  2ZOD A;  3WXM B;  2RHJ A;  4E6E A;  3VYS C;  5JCO C;  3DDN A;  1H48 A;  3M1X A;  4YJ3 B;  2KG4 A;  2ZF8 A;  3TD3 A;  3HJW C;  3OBW A;  5AVM A;  3S0H A;  4C8E A;  4C82 A;  1RQ7 A;  2R6R 1;  2B33 A;  4NWO B;  3JCM M;  2UYJ A;  4LCK A;  3FPI A;  5IJ0 A;  1X7O A;  5LP6 C;  1FNJ A;  3JAW A;  3J81 M;  4EI8 A;  4X1I A;  3WGK A;  1T0A A;  1ZWZ A;  2DT4 A;  3M4S A;  3MQW A;  4YJ2 A;  3E22 A;  5GAP K;  4ERH A;  4DRX B;  3PAF A;  3LWP C;  3AGK A;  3JAW B;  3C9S A;  5LYJ A;  2IG8 A;  5A2Q M;  3J7A R;  2AIZ P;  3ELC A;  2AIF A;  5JVD A;  3CPQ A;  3P10 A;  1W5A A;  3WJR A;  1Z5W A;  2FGY A;  3LDT A;  4O2B A;  3CCR F;  5EIB D;  1Q8R A;  4G4W A;  3ZP7 A;  5HY1 A;  5HP7 A;  5CB4 B;  2KTV A;  3KJK A;  4TV9 A;  2GZL A;  5JVD B;  2YYE A;  3FD6 A;  3CCU F;  4NUT A;  1SA0 B;  1VQP F;  4I50 B;  2LCA A;  1RLU A;  1Q7Y H;  3VOB A;  2CVL A;  2VAW A;  3P0Z A;  5LOV B;  3I3F A;  4F6R B;  5IT9 M;  1Q81 H;  3V4D A;  2PHN A;  3SIU A;  2K1S A;  3T80 A;  3N2K A;  4BT6 A;  1GX1 A;  1KNJ A;  4X20 B;  1IV4 A;  3RYI B;  2HS3 A;  2UYK A;  3LWQ C;  3F6M A;  4X3M A;  5EB0 A;  4U39 A;  1VQN F;  3JVH A;  3HKB B;  3NK6 A;  1OAP A;  4G4Z A;  3RYF A;  1FSZ A;  5BMV B;  3CMA F;  1FFX B;  2Z1T A;  3LWR C;  2ALE A;  5EO3 A;  2MQE A;  3VIU A;  3C8L A;  2VXY A;  2DYY A;  4C8G A;  1QD9 A;  3KJJ A;  2ZVZ A;  1VQ7 F;  3CB2 A;  2Q1X A;  5J2T B;  3F0G A;  5HXZ A;  3WPX A;  3L7Q A;  5LP6 B;  1E7K A;  3NVI B;  4FFB A;  3E1Y A;  1CLI A;  3IEW A;  5GIP C;  3WGL A;  5KX5 A;  3P4E A;  2VAM A;  2I6R A;  4RQO A;  3HKD B;  1CK2 A;  4IHJ A;  4O4I A;  4EB6 A;  2HS4 A;  4I50 A;  1XBI A;  3JAS A;  3G6E F;  5CA0 A;  1VK3 A;  4WBN A;  3S0Y A;  1ONI A;  2BO1 A;  1YJW F;  3D00 A;  4XCQ A;  1W57 A;  2BTO A;  1JJ2 F;  4B45 A;  1K73 H;  4G4V A;  3N2K B;  4HNA A;  1YJN F;  1IV2 A;  4U3J B;  3WGJ A;  2FC3 A;  2IQQ A;  3GTZ A;  5HY4 A;  2Z01 A;  4I4T A;  1W42 A;  3C9U A;  3JAR B;  3UT5 A;  2VGM A;  5JCO A;  3F0D A;  1W58 1;  2UYP A;  2VAP A;  1H47 A;  4C4W C;  3F0E A;  4O2A B;  4RHA A;  4BT5 A;  2OTJ F;  5LA6 A;  3VO8 A;  5FNV A;  3NK7 A;  5LXT B;  1VQO F;  1N8R H;  1QU9 A;  3HTN A;  4EI7 A;  3V7Q A;  4ZHY B;  1NQ3 A;  1YIJ F;  2IAF A;  3WJP A;  2KTU A;  4X1Y A;  1YI2 F;  5CB4 A;  5IJ0 B;  1TVK A;  3RE3 A;  3CCM F;  1FFX A;  4M8I A;  4TV8 A;  1M1K H;  4LNU B;  3HKC B;  3I7T A;  4TUY A;  5CA1 A;  5B8F A;  5JH7 A;  3VYT C;  2CWJ A;  3LFO A;  5J2T A;  3MDO A;  1X25 A;  1YQN A;  4TV8 B;  1W59 A;  1K8A H;  2HS0 A;  5GON A;  3JAM M;  5EYP A;  2HVY D;  3VTI C;  3MBM A;  1H7M A;  1VH8 A;  4IHJ B;  3N2G B;  4I55 A;  3RA5 A;  1W41 A;  4G88 A;  4IIJ A;  2QI2 A;  1VQ4 F;  2HP0 B;  1DBF A;  1W3E X;  3JAK A;  2CW4 A;  4WBN B;  3UT5 B;  4BVQ A;  3GYQ A;  4C8I A;  2G9I A;  2CHS A;  4O4L B;  1CN7 A;  2GVI A;  4O4H B;  3Q8H A;  2PMP A;  5LA6 B;  4F6R A;  1K9M H;  2AMT A;  3CC7 F;  1W5F A;  1IV1 A;  2KGW A;  3IKF A;  4BW0 B;  2F9Z C;  5EAZ A;  5JQG B;  3RYH A;  4I4T B;  2R75 1;  4ZOL B;  3K2X A;  3SIV A;  5LYJ B;  2RHO A;  3HKC A;  3C9R A;  3OBY A;  3CCS F;  1QVF F;  4O2B B;  3IMP A;  4BT2 A;  3RYC A;  4DXD A;  2ZVY A;  1COM A;  5FNV B;  4X1K A;  1VQ8 F;  4O4I B;  4C81 A;  4ZI7 B;  5CA0 B;  1KNK A;  3CG6 A;  3CYP B;  5J2U B;  1PXW A;  1JY8 A;  4X1K B;  5HY2 A;  3N2G A;  4X1Y B;  1SA0 A;  5IYZ B;  3KE1 A;  2CHT A;  2OZB A;  2HRY A;  5LP6 A;  3BYQ A;  5LOV A;  3B6N A;  2JNB A;  4TUY B;  2BTU A;  1W5E A;  5CA1 B;  3CPW F;  3JAK B;  2H8C A;  1RLG A;  1GO1 A;  2LBX A;  3HKE A;  3G4S F;  3IEQ A;  2ZOV A;  3HKD A;  4YJ3 A;  3V7E A;  4BVR A;  5MN5 A;  3CYQ A;  1VQV A;  1PF5 A;  5G4V C;  1UFY A;  2RB9 A;  4G4X A;  3N4Y A;  3WJQ A;  3O85 A;  1U43 A;  1GO0 A;  5G4U C;  2CZW A; 
#chains in the Genus database with same CATH homology
 1IV2 A;  1GX1 A;  3IEW A;  1VH8 A;  1KNJ A;  1IV3 A;  3KE1 A;  1IV4 A;  3ERN A;  3F6M A;  1T0A A;  3K2X A;  3ESJ A;  3JVH A;  3MBM A;  3RE3 A;  3B6N A;  3QHD A;  3IKE A;  1JN1 A;  1H48 A;  2UZH A;  3F0F A;  3P0Z A;  3FBA A;  3F0D A;  3IEQ A;  1VHA A;  3GHZ A;  1H47 A;  5B8F A;  4C8I A;  4C8E A;  1U3L A;  3F0E A;  3ELC A;  4C8G A;  4C82 A;  3K14 A;  3P10 A;  4C81 A;  1W57 A;  1YQN A;  2PMP A;  3Q8H A;  1JY8 A;  1U43 A;  3T80 A;  2AMT A;  3F0G A;  1U40 A;  3EOR A;  1KNK A;  1IV1 A;  3IKF A;  3FPI A;  2GZL A;  1U3P A;  1W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...