1JY8A

2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-methyl-d-erythritol-2,4-cyclodiphosphate synthase involved in mevalonate-independent biosynthesis of isoprenoids.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jy8A00
3ERNA 1U40A 2PMPA 3K14A 3MBMA 3F0DA 4C8EA 3Q8HA 5B8FA 3IKEA 3F0GA 2GZLA 4C82A 1H48A 3P0ZA 3F0EA 3JVHA 1W57A 3B6NA 1T0AA 3EORA 3ELCA 3IKFA 2AMTA 4C8GA 3FPIA 1H47A 1YQNA 3RE3A 4C8IA 1U3LA 3F0FA 1U3PA 1IV2A 3T80A 2UZHA 3KE1A 3ESJA 3P10A 1IV1A 3GHZA 1KNKA 3FBAA 4C81A 1IV3A 3IEQA 3IEWA 3K2XA 1VH8A 1U43A 3QHDA 1W55A 1JY8A 1KNJA 1JN1A 1VHAA 3F6MA 1IV4A 1GX1A
chains in the Genus database with same CATH superfamily
2KG4A 3K14A 3J7AR 4ERHA 1X7PA 5LP6C 4BT5A 4C82A 1CLIA 5IT9M 1K73H 1VQOF 3FD5A 3UT5B 1U3PA 4G4YA 3KE1A 3UT5A 1IV1A 3CCEF 2CVLA 3WPXA 1KNKA 4EB6B 4KWEA 3C9UA 2R751 1YJ9F 2ZODA 4EB6A 1XRGA 4TZZA 3G6EF 5HY0A 1DT9A 3F6MA 3VOBA 1IPAA 3TD3A 2UYPA 2CSLA 3VYTC 1QD9A 1VQVA 1X52A 2HS3A 3E1YA 1Q8RA 3O85A 4C4WC 1XBIA 3FPIA 3IMPA 3BYQA 4I50B 5GIOC 2ZAUA 2VGNA 3ZO8A 4I50A 3PAFA 1ODEA 5GAPK 2V9YA 4C81A 3K2XA 1VH8A 4EI9A 2B33A 5G4VC 1KC8H 5HWEA 4FFBB 3CCVF 4FFBA 1VQLF 5A2QM 3CMAF 3S06A 2BTQB 2QI2A 5FLXM 3HKCB 3JATB 3OW2F 3V3TA 3N2GB 3HKCA 3NK7A 2WALA 3JATA 4X3MA 5KX5B 3N2GA 5EYPB 3CYPB 2FGYA 5EYPA 2NMUA 1VQKF 3LYBA 3P10A 3D00A 3L7QA 1Z5VA 3AGKA 3CG6A 1SA0B 1TVKB 3KIZA 4BT7A 1SA0A 1JN1A 1TVKA 2UYJA 2MQEA 3J81M 1M1KH 1W5EA 1COMA 5JVDB 2IQQA 2LBTA 3F0DA 5JVDA 4O4JB 1W40A 3HTNA 4BVQA 3P0ZA 2Z1UA 2VAMA 4O4JA 1FNJA 4X3LA 1XV2A 4YJ3A 1R1MA 3D54A 4U3JB 3LWVC 1W5FA 4U3JA 1SZQA 2HVYD 5AVMA 4ZHQB 2N48A 4G4WA 4ZHQA 3MCQA 5GIPC 4U39A 3M84A 3LWPC 2RHJA 2OTLF 1JD1A 2H6LA 4B62A 3S0YA 3S0WA 2PHNA 3CCRF 3S03A 3FD6A 3CCJF 4RQOA 1NQ3A 5EIBD 2JNBA 3CC7F 3WJPA 4G4XA 1VQPF 1CK2A 4I55B 3I55F 3I56F 1VQ4F 4I55A 3KJKA 1YJWF 2AIZP 5IJ0B 3FFMA 1K9MH 1VQ6F 3MDOA 2I6DA 5IJ0A 1QVGF 1FNKA 4ZHWA 1H7MA 2KGWA 1VQMF 4C8EA 1GZ0A 3Q8HA 3WGJA 3SIVA 3IKEA 3CXCF 3WGKA 2ALEA 3SIUA 4YJ2B 1Z5WA 3V7QA 3WGMA 1KD1H 1JJ2F 3EORA 3ELCA 4YJ2A 3R0PA 4O2BB 1CN7A 4O2BA 3WJRA 2VXYA 5HY4A 3N4ZA 2YYEA 1XHOA 2RHHA 2YXZA 2RHLA 1ZWZA 1W5BA 3RYFB 3ERNA 1U40A 3RYFA 2I6RA 5B8FA 4IIJB 4TV8B 2KTUA 1VQ7F 3M4SA 4IIJA 5JCOC 3KHNA 4TV8A 1M90H 3RA6A 3IKFA 5LA6B 2Z01A 3CPQA 5JH7B 3ZP4A 5LA6A 4E6EA 5JH7A 3JASA 4O4HB 3JALB 2ZF8A 4O4HA 5J2TB 2IAFA 3JALA 3KJJA 5J2TA 5FNVB 3CB2A 3RYCB 3IEQA 2L26A 4BY9D 5FNVA 3RYCA 2H8EA 2QEXF 4O4LB 1QU9A 1Q7YH 2OTMA 1GX1A 1RA4A 5EZYB 4O4LA 3E22B 5EZYA 4DRXB 2HRUA 3E22A 4TV9B 4DRXA 4O2AB 2OTJF 2CZWA 4TV9A 2VGMA 4O2AA 5GANK 3LWRC 3HWUA 1KQSF 3VYSC 3N4YA 3K0TA 1OAPA 3T80A 5KMGB 2UZHA 3ESJA 1RLGA 4ZHVA 5KMGA 5CA0B 3I3FA 4IHJB 2F9ZC 3I7TA 1YJNF 1GO0A 5CA0A 4IHJA 4NWOB 3M1XA 3IEWA 3VCZA 1KNJA 2CW4A 4BVTA 5CB4B 4HNAB 5LP6B 2IG8A 2W8BC 5CB4A 1VQ8F 4HNAA 1VK3A 4X1KB 3ZOPA 1W41A 5LP6A 3CCMF 1Q86H 4X1KA 3B6NA 4DXDA 2Q1YA 1NJIH 1QAHA 3DDNA 3RE3A 4YJ3B 4C8IA 5C8YB 5C8YA 3CCLF 2ZVZA 2Q1XA 4O4IB 3N2KB 4X1IB 4O4IA 3N2KA 1E7KA 4X1IA 2CWJA 2GLZA 5BMVB 2HP3A 5EWRA 1JY8A 5BMVA 2HS0A 4I4TB 1RQ2A 2CHTA 4I4TA 3ZP7A 2DYYA 3MBMA 3CPWF 4EI8A 3JAWB 3JAWA 5EB0A 2ZVYA 2HQSC 5CA1A 3JAMM 2HP0A 4EI7A 1IV2A 3VO8A 4LCKA 3S0HA 4NQ3A 4M8IA 3GYQA 2HS4A 5DCVA 3CCSF 5HY1A 2BTOA 3HKBB 4BT2A 5HY2A 3OBYA 3QHDA 3HKBA 3JAKB 1VHAA 5JQGB 3CMEF 1VQNF 3CC4F 5HP7A 3VMFB 3JAKA 4XCQA 3OBWA 2G9IA 5JQGA 3C9RA 5MN4A 3NK6A 2CHSA 3E20B 4R40B 3CCQF 3NVIB 1YITF 4X20B 4X1YB 3RYIB 4X20A 1W581 1YQNA 4X1YA 5EAZA 1W42A 3RYIA 3G71F 1SDSA 2H8CA 2OHWA 1QVFF 3GHZA 1TUBB 5G4UC 5IJ9B 3C9TA 1RLUA 1TUBA 5IJ9A 1RQ7A 1UFYA 4B45A 2EWCA 4NUTA 4PWTA 3LFOA 2HRYA 3VIUA 1X7OA 1J7HA 2GZLA 2QA4F 3WGLA 3QUWA 3CCUF 4BT3A 4BVRA 1YGYA 3U0OA 3JASB 3VTIC 4B46A 3IR9A 3CYQA 5EO3A 5EB1B 3WJQA 2KTVA 3LDTA 1PF5A 4G4VA 1IV3A 1N8RH 5HP8A 3NVKE 3J80M 2UYNB 2OZBA 4BVSA 1W55A 2UYNA 1IV4A 2RB9A 3WPWA 4ZI7B 5EIBC 3RA5A 4ZI7A 3CC2F 3V4DA 2LBWA 1OFUA 3MCAB 1S72F 3S02A 5GINC 2AMTA 1X25A 5LOVB 2DT4A 2ZOVA 3HKEB 5LOVA 3V7EA 5J2UB 5HXUA 4B5CA 3HKEA 5GONB 3WGNA 5J2UA 3FBAA 2BO1A 5GONA 3DC2A 3NMUC 2LBXA 3C9SA 5LYJB 3RYHB 3LWQC 2PMPA 5LYJA 3RYHA 1NMUB 1Q82H 3F0GA 1FFXB 4ZOLB 3F0EA 3JVHA 1Q81H 5ITZB 1T0AA 1W3EX 3LWOC 1FFXA 4ZOLA 5LXTB 1W5AA 4C8GA 5ITZA 5KX5A 3JCMM 5LXTA 1T0KB 3F0FA 3K12A 3ON1A 2AIFA 2K1SA 3G4SF 4ZHYB 2R6R1 5FJ4C 3C8LA 1FSZA 4BT6A 2LCAA 1PXWA 2FC3A 3JARB 2QTPA 3MQWA 1ONIA 3JARA 1U43A 5HXZA 2GVIA 1DBFA 3VYUC 5MN6A 1VQ9F 1GO1A 1UI9A 4F6RB 5JCOA 4F6RA 2BTUA 3D01A 5CA1B 1YIJF 2Z1FA 3HJWC 2HP0B 1H47A 3VI6A 2Z1TA 1U3LA 4G88A 1YHQF 4TUYB 3CD6F 3GTZA 4TUYA 3OONA 3HKDB 4BW0B 2Z1EA 3HKDA 4ZK7A 4WBNB 4G4ZA 3P4EA 4WBNA 5IYZB 2P6YA 1W59A 5IYZA 1YI2F 3HAXD 2VAWA 2HX0A 5MN5A 2RHOA 1H48A 3WXMB 1W57A 2VAPA 3QTYA 4BT4A 4RHAA 1JFFB 4LNUB 3PLAC 1K8AH 1JFFA 1W2BF 4LNUA 3VOAA 3TD4A 2UYKA 1VQ5F 3LMEA 3TD5A
chains in the Genus database with same CATH topology
3ERNA 1U40A 2PMPA 3K14A 3MBMA 3F0DA 4C8EA 3Q8HA 5B8FA 3IKEA 3F0GA 2GZLA 4C82A 1H48A 3P0ZA 3F0EA 3JVHA 1W57A 3B6NA 1T0AA 3EORA 3ELCA 3IKFA 2AMTA 4C8GA 3FPIA 1H47A 1YQNA 3RE3A 4C8IA 1U3LA 3F0FA 1U3PA 1IV2A 3T80A 2UZHA 3KE1A 3ESJA 3P10A 1IV1A 3GHZA 1KNKA 3FBAA 4C81A 1IV3A 3IEQA 3IEWA 3K2XA 1VH8A 1U43A 3QHDA 1W55A 1JY8A 1KNJA 1JN1A 1VHAA 3F6MA 1IV4A 1GX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERN A;  1U40 A;  2PMP A;  3K14 A;  3MBM A;  3F0D A;  4C8E A;  3Q8H A;  5B8F A;  3IKE A;  3F0G A;  2GZL A;  4C82 A;  1H48 A;  3P0Z A;  3F0E A;  3JVH A;  1W57 A;  3B6N A;  1T0A A;  3EOR A;  3ELC A;  3IKF A;  2AMT A;  4C8G A;  3FPI A;  1H47 A;  1YQN A;  3RE3 A;  4C8I A;  1U3L A;  3F0F A;  1U3P A;  1IV2 A;  3T80 A;  2UZH A;  3KE1 A;  3ESJ A;  3P10 A;  1IV1 A;  3GHZ A;  1KNK A;  3FBA A;  4C81 A;  1IV3 A;  3IEQ A;  3IEW A;  3K2X A;  1VH8 A;  1U43 A;  3QHD A;  1W55 A;  1JY8 A;  1KNJ A;  1JN1 A;  1VHA A;  3F6M A;  1IV4 A;  1GX1 A; 
#chains in the Genus database with same CATH topology
 2KG4 A;  3K14 A;  3J7A R;  4ERH A;  1X7P A;  5LP6 C;  4BT5 A;  4C82 A;  1CLI A;  5IT9 M;  1K73 H;  1VQO F;  3FD5 A;  3UT5 B;  1U3P A;  4G4Y A;  3KE1 A;  3UT5 A;  1IV1 A;  3CCE F;  2CVL A;  3WPX A;  1KNK A;  4EB6 B;  4KWE A;  3C9U A;  2R75 1;  1YJ9 F;  2ZOD A;  4EB6 A;  1XRG A;  4TZZ A;  3G6E F;  5HY0 A;  1DT9 A;  3F6M A;  3VOB A;  1IPA A;  3TD3 A;  2UYP A;  2CSL A;  3VYT C;  1QD9 A;  1VQV A;  1X52 A;  2HS3 A;  3E1Y A;  1Q8R A;  3O85 A;  4C4W C;  1XBI A;  3FPI A;  3IMP A;  3BYQ A;  4I50 B;  5GIO C;  2ZAU A;  2VGN A;  3ZO8 A;  4I50 A;  3PAF A;  1ODE A;  5GAP K;  2V9Y A;  4C81 A;  3K2X A;  1VH8 A;  4EI9 A;  2B33 A;  5G4V C;  1KC8 H;  5HWE A;  4FFB B;  3CCV F;  4FFB A;  1VQL F;  5A2Q M;  3CMA F;  3S06 A;  2BTQ B;  2QI2 A;  5FLX M;  3HKC B;  3JAT B;  3OW2 F;  3V3T A;  3N2G B;  3HKC A;  3NK7 A;  2WAL A;  3JAT A;  4X3M A;  5KX5 B;  3N2G A;  5EYP B;  3CYP B;  2FGY A;  5EYP A;  2NMU A;  1VQK F;  3LYB A;  3P10 A;  3D00 A;  3L7Q A;  1Z5V A;  3AGK A;  3CG6 A;  1SA0 B;  1TVK B;  3KIZ A;  4BT7 A;  1SA0 A;  1JN1 A;  1TVK A;  2UYJ A;  2MQE A;  3J81 M;  1M1K H;  1W5E A;  1COM A;  5JVD B;  2IQQ A;  2LBT A;  3F0D A;  5JVD A;  4O4J B;  1W40 A;  3HTN A;  4BVQ A;  3P0Z A;  2Z1U A;  2VAM A;  4O4J A;  1FNJ A;  4X3L A;  1XV2 A;  4YJ3 A;  1R1M A;  3D54 A;  4U3J B;  3LWV C;  1W5F A;  4U3J A;  1SZQ A;  2HVY D;  5AVM A;  4ZHQ B;  2N48 A;  4G4W A;  4ZHQ A;  3MCQ A;  5GIP C;  4U39 A;  3M84 A;  3LWP C;  2RHJ A;  2OTL F;  1JD1 A;  2H6L A;  4B62 A;  3S0Y A;  3S0W A;  2PHN A;  3CCR F;  3S03 A;  3FD6 A;  3CCJ F;  4RQO A;  1NQ3 A;  5EIB D;  2JNB A;  3CC7 F;  3WJP A;  4G4X A;  1VQP F;  1CK2 A;  4I55 B;  3I55 F;  3I56 F;  1VQ4 F;  4I55 A;  3KJK A;  1YJW F;  2AIZ P;  5IJ0 B;  3FFM A;  1K9M H;  1VQ6 F;  3MDO A;  2I6D A;  5IJ0 A;  1QVG F;  1FNK A;  4ZHW A;  1H7M A;  2KGW A;  1VQM F;  4C8E A;  1GZ0 A;  3Q8H A;  3WGJ A;  3SIV A;  3IKE A;  3CXC F;  3WGK A;  2ALE A;  3SIU A;  4YJ2 B;  1Z5W A;  3V7Q A;  3WGM A;  1KD1 H;  1JJ2 F;  3EOR A;  3ELC A;  4YJ2 A;  3R0P A;  4O2B B;  1CN7 A;  4O2B A;  3WJR A;  2VXY A;  5HY4 A;  3N4Z A;  2YYE A;  1XHO A;  2RHH A;  2YXZ A;  2RHL A;  1ZWZ A;  1W5B A;  3RYF B;  3ERN A;  1U40 A;  3RYF A;  2I6R A;  5B8F A;  4IIJ B;  4TV8 B;  2KTU A;  1VQ7 F;  3M4S A;  4IIJ A;  5JCO C;  3KHN A;  4TV8 A;  1M90 H;  3RA6 A;  3IKF A;  5LA6 B;  2Z01 A;  3CPQ A;  5JH7 B;  3ZP4 A;  5LA6 A;  4E6E A;  5JH7 A;  3JAS A;  4O4H B;  3JAL B;  2ZF8 A;  4O4H A;  5J2T B;  2IAF A;  3JAL A;  3KJJ A;  5J2T A;  5FNV B;  3CB2 A;  3RYC B;  3IEQ A;  2L26 A;  4BY9 D;  5FNV A;  3RYC A;  2H8E A;  2QEX F;  4O4L B;  1QU9 A;  1Q7Y H;  2OTM A;  1GX1 A;  1RA4 A;  5EZY B;  4O4L A;  3E22 B;  5EZY A;  4DRX B;  2HRU A;  3E22 A;  4TV9 B;  4DRX A;  4O2A B;  2OTJ F;  2CZW A;  4TV9 A;  2VGM A;  4O2A A;  5GAN K;  3LWR C;  3HWU A;  1KQS F;  3VYS C;  3N4Y A;  3K0T A;  1OAP A;  3T80 A;  5KMG B;  2UZH A;  3ESJ A;  1RLG A;  4ZHV A;  5KMG A;  5CA0 B;  3I3F A;  4IHJ B;  2F9Z C;  3I7T A;  1YJN F;  1GO0 A;  5CA0 A;  4IHJ A;  4NWO B;  3M1X A;  3IEW A;  3VCZ A;  1KNJ A;  2CW4 A;  4BVT A;  5CB4 B;  4HNA B;  5LP6 B;  2IG8 A;  2W8B C;  5CB4 A;  1VQ8 F;  4HNA A;  1VK3 A;  4X1K B;  3ZOP A;  1W41 A;  5LP6 A;  3CCM F;  1Q86 H;  4X1K A;  3B6N A;  4DXD A;  2Q1Y A;  1NJI H;  1QAH A;  3DDN A;  3RE3 A;  4YJ3 B;  4C8I A;  5C8Y B;  5C8Y A;  3CCL F;  2ZVZ A;  2Q1X A;  4O4I B;  3N2K B;  4X1I B;  4O4I A;  3N2K A;  1E7K A;  4X1I A;  2CWJ A;  2GLZ A;  5BMV B;  2HP3 A;  5EWR A;  1JY8 A;  5BMV A;  2HS0 A;  4I4T B;  1RQ2 A;  2CHT A;  4I4T A;  3ZP7 A;  2DYY A;  3MBM A;  3CPW F;  4EI8 A;  3JAW B;  3JAW A;  5EB0 A;  2ZVY A;  2HQS C;  5CA1 A;  3JAM M;  2HP0 A;  4EI7 A;  1IV2 A;  3VO8 A;  4LCK A;  3S0H A;  4NQ3 A;  4M8I A;  3GYQ A;  2HS4 A;  5DCV A;  3CCS F;  5HY1 A;  2BTO A;  3HKB B;  4BT2 A;  5HY2 A;  3OBY A;  3QHD A;  3HKB A;  3JAK B;  1VHA A;  5JQG B;  3CME F;  1VQN F;  3CC4 F;  5HP7 A;  3VMF B;  3JAK A;  4XCQ A;  3OBW A;  2G9I A;  5JQG A;  3C9R A;  5MN4 A;  3NK6 A;  2CHS A;  3E20 B;  4R40 B;  3CCQ F;  3NVI B;  1YIT F;  4X20 B;  4X1Y B;  3RYI B;  4X20 A;  1W58 1;  1YQN A;  4X1Y A;  5EAZ A;  1W42 A;  3RYI A;  3G71 F;  1SDS A;  2H8C A;  2OHW A;  1QVF F;  3GHZ A;  1TUB B;  5G4U C;  5IJ9 B;  3C9T A;  1RLU A;  1TUB A;  5IJ9 A;  1RQ7 A;  1UFY A;  4B45 A;  2EWC A;  4NUT A;  4PWT A;  3LFO A;  2HRY A;  3VIU A;  1X7O A;  1J7H A;  2GZL A;  2QA4 F;  3WGL A;  3QUW A;  3CCU F;  4BT3 A;  4BVR A;  1YGY A;  3U0O A;  3JAS B;  3VTI C;  4B46 A;  3IR9 A;  3CYQ A;  5EO3 A;  5EB1 B;  3WJQ A;  2KTV A;  3LDT A;  1PF5 A;  4G4V A;  1IV3 A;  1N8R H;  5HP8 A;  3NVK E;  3J80 M;  2UYN B;  2OZB A;  4BVS A;  1W55 A;  2UYN A;  1IV4 A;  2RB9 A;  3WPW A;  4ZI7 B;  5EIB C;  3RA5 A;  4ZI7 A;  3CC2 F;  3V4D A;  2LBW A;  1OFU A;  3MCA B;  1S72 F;  3S02 A;  5GIN C;  2AMT A;  1X25 A;  5LOV B;  2DT4 A;  2ZOV A;  3HKE B;  5LOV A;  3V7E A;  5J2U B;  5HXU A;  4B5C A;  3HKE A;  5GON B;  3WGN A;  5J2U A;  3FBA A;  2BO1 A;  5GON A;  3DC2 A;  3NMU C;  2LBX A;  3C9S A;  5LYJ B;  3RYH B;  3LWQ C;  2PMP A;  5LYJ A;  3RYH A;  1NMU B;  1Q82 H;  3F0G A;  1FFX B;  4ZOL B;  3F0E A;  3JVH A;  1Q81 H;  5ITZ B;  1T0A A;  1W3E X;  3LWO C;  1FFX A;  4ZOL A;  5LXT B;  1W5A A;  4C8G A;  5ITZ A;  5KX5 A;  3JCM M;  5LXT A;  1T0K B;  3F0F A;  3K12 A;  3ON1 A;  2AIF A;  2K1S A;  3G4S F;  4ZHY B;  2R6R 1;  5FJ4 C;  3C8L A;  1FSZ A;  4BT6 A;  2LCA A;  1PXW A;  2FC3 A;  3JAR B;  2QTP A;  3MQW A;  1ONI A;  3JAR A;  1U43 A;  5HXZ A;  2GVI A;  1DBF A;  3VYU C;  5MN6 A;  1VQ9 F;  1GO1 A;  1UI9 A;  4F6R B;  5JCO A;  4F6R A;  2BTU A;  3D01 A;  5CA1 B;  1YIJ F;  2Z1F A;  3HJW C;  2HP0 B;  1H47 A;  3VI6 A;  2Z1T A;  1U3L A;  4G88 A;  1YHQ F;  4TUY B;  3CD6 F;  3GTZ A;  4TUY A;  3OON A;  3HKD B;  4BW0 B;  2Z1E A;  3HKD A;  4ZK7 A;  4WBN B;  4G4Z A;  3P4E A;  4WBN A;  5IYZ B;  2P6Y A;  1W59 A;  5IYZ A;  1YI2 F;  3HAX D;  2VAW A;  2HX0 A;  5MN5 A;  2RHO A;  1H48 A;  3WXM B;  1W57 A;  2VAP A;  3QTY A;  4BT4 A;  4RHA A;  1JFF B;  4LNU B;  3PLA C;  1K8A H;  1JFF A;  1W2B F;  4LNU A;  3VOA A;  3TD4 A;  2UYK A;  1VQ5 F;  3LME A;  3TD5 A; 
#chains in the Genus database with same CATH homology
 3ERN A;  1U40 A;  2PMP A;  3K14 A;  3MBM A;  3F0D A;  4C8E A;  3Q8H A;  5B8F A;  3IKE A;  3F0G A;  2GZL A;  4C82 A;  1H48 A;  3P0Z A;  3F0E A;  3JVH A;  1W57 A;  3B6N A;  1T0A A;  3EOR A;  3ELC A;  3IKF A;  2AMT A;  4C8G A;  3FPI A;  1H47 A;  1YQN A;  3RE3 A;  4C8I A;  1U3L A;  3F0F A;  1U3P A;  1IV2 A;  3T80 A;  2UZH A;  3KE1 A;  3ESJ A;  3P10 A;  1IV1 A;  3GHZ A;  1KNK A;  3FBA A;  4C81 A;  1IV3 A;  3IEQ A;  3IEW A;  3K2X A;  1VH8 A;  1U43 A;  3QHD A;  1W55 A;  1JY8 A;  1KNJ A;  1JN1 A;  1VHA A;  3F6M A;  1IV4 A;  1GX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...