1JY8A

2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-methyl-d-erythritol-2,4-cyclodiphosphate synthase involved in mevalonate-independent biosynthesis of isoprenoids.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jy8A00
3F0GA 3IEWA 3K14A 4C8EA 1W55A 3P0ZA 3ERNA 1YQNA 3F0DA 4C81A 1U3LA 4C8IA 3EORA 1U40A 1VHAA 1H48A 2UZHA 1KNJA 3T80A 1U3PA 1IV3A 5B8FA 3FBAA 1KNKA 3FPIA 3IKFA 3F6MA 1H47A 3B6NA 4C82A 3GHZA 3ESJA 3RE3A 3ELCA 1VH8A 3MBMA 4C8GA 3K2XA 3JVHA 1JY8A 3P10A 3QHDA 3F0EA 3KE1A 3IKEA 3F0FA 1JN1A 3IEQA 1IV2A 1IV1A 2GZLA 2AMTA 1GX1A 1W57A 2PMPA 1IV4A 1T0AA 3Q8HA 1U43A
chains in the Genus database with same CATH superfamily
4BVSA 3I55F 1SA0A 2N48A 3HKBA 3VI6A 1VQ9F 3WPXA 3CCMF 3SIUA 1NMUB 2IAFA 4FFBA 2VXYA 2VAWA 1KNKA 3N2KA 4I50B 2HP3A 2ZVYA 1TUBB 2CHSA 2RB9A 5LP6B 2DYYA 4O4JB 1VQKF 4B5CA 2GVIA 3QUWA 5G4VC 4EI9A 4C8EA 1IPAA 2NMUA 4EB6A 1IV3A 4X1IA 4WBNB 1JFFB 1GO1A 1TVKA 3JATA 3I3FA 3CMAF 3WJQA 1J7HA 4ZI7A 1S72F 1FNKA 2FGYA 1RQ7A 4G4YA 3M1XA 4YJ2B 4I4TB 3TD5A 3RYHB 2VAMA 3V3TA 3LWVC 1VQ4F 3NVKE 4BVQA 4HNAB 3KJKA 3G6EF 1GX1A 4TV8B 5A2QM 5EO3A 5FNVB 1Q82H 3CXCF 3JALB 2KG4A 1R1MA 2QTPA 2UYNB 3ERNA 1VHAA 4IIJB 1W2BF 2ZODA 1OAPA 3FPIA 1VQ7F 5GONB 3S0YA 2Z01A 2Q1XA 3P4EA 3HKCA 5JCOA 4ZHWA 3CC4F 5HP8A 2G9IA 4B46A 3CMEF 2QI2A 2LBXA 4O2BA 3UT5B 4BT3A 3NK6A 1YIJF 4LNUA 4TUYB 2H6LA 5CA0B 5JH7B 2CW4A 4EI7A 3K14A 5G4UC 2RHHA 2HP0B 4O2AA 2AIZP 5IJ0B 3CCJF 4O4HA 2EWCA 1Q81H 1Z5WA 3HTNA 3D01A 2K1SA 3CCVF 3RYCA 3R0PA 5CB4B 2UYPA 4X1KA 3MBMA 3NK7A 3CPWF 3WGMA 5CB4A 3N2GA 1X7PA 1W5FA 2OTJF 2GZLA 4O4IB 3CCLF 3WJRA 5EZYA 5LXTA 5IYZB 3WXMB 1FFXB 4BY9D 1SZQA 4IHJB 4C4WC 1KC8H 1XV2A 4BT6A 4YJ3A 1W581 3WGNA 1QD9A 5KMGA 3ELCA 5J2TA 2HQSC 5EYPB 5ITZB 1GO0A 5HY4A 3OBYA 1X52A 3L7QA 1SA0B 3HKBB 3IEQA 1W41A 3VYUC 5C8YA 1T0AA 2R6R1 1W5EA 4FFBB 1ONIA 2H8EA 3VTIC 1W55A 2B33A 4XCQA 1YJNF 5LOVA 3N2KB 3EORA 3C8LA 3DDNA 5MN5A 4DXDA 2ZVZA 5LA6A 2HS0A 1KQSF 4C82A 3S06A 3WJPA 5CA1A 3D00A 2Q1YA 3FD5A 1CLIA 4PWTA 1NQ3A 5GIPC 3S03A 3I7TA 3WPWA 3RYFA 4U39A 1YHQF 3KJJA 3LFOA 1K73H 5MN6A 5JCOC 1Z5VA 1W57A 2KTVA 1RLUA 3VYSC 2P6YA 3IR9A 3F0GA 4EB6B 3KIZA 1YQNA 4X1IB 2F9ZC 1TVKB 1H48A 3JATB 3N4ZA 2IQQA 1U3PA 3ZP7A 3J81M 4ZI7B 2VGNA 1VQNF 2HRYA 5IJ9A 3MDOA 2RHLA 2DT4A 3RA5A 3LWRC 4ZK7A 4B45A 1JY8A 2KTUA 3SIVA 3HKEA 1CN7A 3F0EA 1OFUA 3KE1A 3ZP4A 3CCSF 4RQOA 4ZHVA 3HWUA 1JJ2F 2MQEA 3ON1A 4G4WA 4ZHQA 1NJIH 1VQPF 1ZWZA 4R40B 5AVMA 2I6RA 2HVYD 1QU9A 5EIBC 3JARA 3PAFA 1VQLF 1T0KB 3MQWA 1YI2F 5B8FA 3HKCB 1YITF 4O2BB 3CCEF 1QVGF 4G4VA 3RE3A 4LNUB 2Z1UA 3VMFB 1PXWA 2CVLA 2Z1EA 3P10A 2LBTA 4E6EA 3GYQA 2HS3A 3G71F 4F6RA 2BTOA 4TZZA 3CCRF 4O2AB 3TD3A 1IV4A 3S02A 1VQOF 4O4HB 3IEWA 4BT7A 3J7AR 3FFMA 2HRUA 2CSLA 4RHAA 3QTYA 3RYCB 3IKFA 4I55A 1JD1A 4X1KB 1DT9A 2L26A 3F6MA 3RYIA 4G88A 1SDSA 3VO8A 2V9YA 3N2GB 4BT2A 4NQ3A 3C9TA 2CWJA 4ZOLA 1YJ9F 4X20A 5EZYB 1E7KA 1JN1A 5J2UA 5LXTB 2AMTA 5JQGA 2OHWA 1VQ5F 3Q8HA 3LWOC 3I56F 2H8CA 3E1YA 2RHOA 3JAMM 3NVIB 3JAKA 3O85A 4YJ3B 5LYJA 5HXUA 2JNBA 1FSZA 2GLZA 4O4LA 4DRXA 5KMGB 1VQMF 5J2TB 3HKDA 2ZAUA 2ZOVA 3JVHA 1VK3A 5DCVA 2OTMA 5C8YB 2YYEA 1RQ2A 1XBIA 3E22B 1Q86H 1YGYA 3TD4A 3HJWC 1W5BA 5LOVB 5HY1A 3E22A 2RHJA 4X3LA 2I6DA 5JVDA 3P0ZA 5LA6B 5HY0A 3WGJA 1Q8RA 5CA1B 4TV9A 4BW0B 3JAWA 3ZO8A 3RYFB 5KX5A 3BYQA 1K9MH 3OONA 5FLXM 5EIBD 3QHDA 1X25A 3KHNA 1IV1A 1W42A 1PF5A 2YXZA 1U43A 1H7MA 3LMEA 3VOAA 3CYQA 3GTZA 4X1YA 3CPQA 3JASA 3N4YA 4BVRA 1U3LA 3LWQC 5IJ9B 5EAZA 1KNJA 1M1KH 3VOBA 1DBFA 3FBAA 5HXZA 3M84A 1XHOA 5GINC 3GHZA 3WGLA 3CCUF 5MN4A 3HKEB 3J80M 2HS4A 4I50A 1W59A 1RLGA 3V7EA 1W3EX 3VCZA 1TUBA 3ZOPA 4U3JB 4KWEA 4ZHYB 2R751 3E20B 4ZHQB 1IV2A 2PMPA 2WALA 4BT5A 5LP6A 2LCAA 1UI9A 4U3JA 1X7OA 4G4XA 5GIOC 3JARB 4O4JA 5ITZA 5EWRA 2UZHA 5IT9M 2ALEA 2VGMA 3WGKA 1H47A 3ESJA 4B62A 1QAHA 5HWEA 5HY2A 4WBNA 1JFFA 2VAPA 3RA6A 1ODEA 4F6RB 2PHNA 2CHTA 3K2XA 5EB1B 2IG8A 3JCMM 4YJ2A 2W8BC 3K0TA 3MCAB 4I4TA 3RYHA 4ERHA 1RA4A 5EB0A 4HNAA 3LYBA 3VIUA 3CD6F 4TV8A 2OZBA 4EI8A 2UYJA 3F0DA 4I55B 5FNVA 4LCKA 2AIFA 3RYIB 3JALA 2HX0A 2BTUA 2UYNA 4NUTA 3U0OA 3PLAC 1GZ0A 4IIJA 5GAPK 1K8AH 3CG6A 3G4SF 5GONA 4C8GA 4ZOLB 3K12A 4X20B 3DC2A 1N8RH 5J2UB 5JQGB 2LBWA 4BT4A 2BO1A 3F0FA 3UT5A 5HP7A 1VQ6F 3C9SA 1VQ8F 3CCQF 4TUYA 1VQVA 3JAKB 5CA0A 2CZWA 5JH7A 3FD6A 4BVTA 5LYJB 3HAXD 2FC3A 4O4LB 4DRXB 3NMUC 2HP0A 4C81A 3OW2F 4C8IA 3HKDB 1UFYA 5IJ0A 1W5AA 1FNJA 4M8IA 1KD1H 5BMVB 1YJWF 1CK2A 3CB2A 1QVFF 2OTLF 2QA4F 3MCQA 5BMVA 3C9RA 5FJ4C 2QEXF 4X3MA 5JVDB 3V4DA 3CC2F 3S0HA 5GANK 3S0WA 4O4IA 1Q7YH 4TV9B 4G4ZA 2Z1TA 1U40A 3VYTC 5IYZA 3IMPA 3JAWB 4NWOB 3D54A 3LDTA 3T80A 3V7QA 5LP6C 1FFXA 5KX5B 3OBWA 1W40A 2Z1FA 3B6NA 3CYPB 4IHJA 2BTQB 3LWPC 3CC7F 1VH8A 3AGKA 1COMA 3C9UA 2ZF8A 3IKEA 1M90H 5EYPA 2UYKA 3M4SA 1XRGA 4X1YB 3JASB 2KGWA
chains in the Genus database with same CATH topology
3F0GA 3IEWA 3K14A 4C8EA 1W55A 3P0ZA 3ERNA 1YQNA 3F0DA 4C81A 1U3LA 4C8IA 3EORA 1U40A 1VHAA 1H48A 2UZHA 1KNJA 3T80A 1U3PA 1IV3A 5B8FA 3FBAA 1KNKA 3FPIA 3IKFA 3F6MA 1H47A 3B6NA 4C82A 3GHZA 3ESJA 3RE3A 3ELCA 1VH8A 3MBMA 4C8GA 3K2XA 3JVHA 1JY8A 3P10A 3QHDA 3F0EA 3KE1A 3IKEA 3F0FA 1JN1A 3IEQA 1IV2A 1IV1A 2GZLA 2AMTA 1GX1A 1W57A 2PMPA 1IV4A 1T0AA 3Q8HA 1U43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0G A;  3IEW A;  3K14 A;  4C8E A;  1W55 A;  3P0Z A;  3ERN A;  1YQN A;  3F0D A;  4C81 A;  1U3L A;  4C8I A;  3EOR A;  1U40 A;  1VHA A;  1H48 A;  2UZH A;  1KNJ A;  3T80 A;  1U3P A;  1IV3 A;  5B8F A;  3FBA A;  1KNK A;  3FPI A;  3IKF A;  3F6M A;  1H47 A;  3B6N A;  4C82 A;  3GHZ A;  3ESJ A;  3RE3 A;  3ELC A;  1VH8 A;  3MBM A;  4C8G A;  3K2X A;  3JVH A;  1JY8 A;  3P10 A;  3QHD A;  3F0E A;  3KE1 A;  3IKE A;  3F0F A;  1JN1 A;  3IEQ A;  1IV2 A;  1IV1 A;  2GZL A;  2AMT A;  1GX1 A;  1W57 A;  2PMP A;  1IV4 A;  1T0A A;  3Q8H A;  1U43 A; 
#chains in the Genus database with same CATH topology
 4BVS A;  3I55 F;  1SA0 A;  2N48 A;  3HKB A;  3VI6 A;  1VQ9 F;  3WPX A;  3CCM F;  3SIU A;  1NMU B;  2IAF A;  4FFB A;  2VXY A;  2VAW A;  1KNK A;  3N2K A;  4I50 B;  2HP3 A;  2ZVY A;  1TUB B;  2CHS A;  2RB9 A;  5LP6 B;  2DYY A;  4O4J B;  1VQK F;  4B5C A;  2GVI A;  3QUW A;  5G4V C;  4EI9 A;  4C8E A;  1IPA A;  2NMU A;  4EB6 A;  1IV3 A;  4X1I A;  4WBN B;  1JFF B;  1GO1 A;  1TVK A;  3JAT A;  3I3F A;  3CMA F;  3WJQ A;  1J7H A;  4ZI7 A;  1S72 F;  1FNK A;  2FGY A;  1RQ7 A;  4G4Y A;  3M1X A;  4YJ2 B;  4I4T B;  3TD5 A;  3RYH B;  2VAM A;  3V3T A;  3LWV C;  1VQ4 F;  3NVK E;  4BVQ A;  4HNA B;  3KJK A;  3G6E F;  1GX1 A;  4TV8 B;  5A2Q M;  5EO3 A;  5FNV B;  1Q82 H;  3CXC F;  3JAL B;  2KG4 A;  1R1M A;  2QTP A;  2UYN B;  3ERN A;  1VHA A;  4IIJ B;  1W2B F;  2ZOD A;  1OAP A;  3FPI A;  1VQ7 F;  5GON B;  3S0Y A;  2Z01 A;  2Q1X A;  3P4E A;  3HKC A;  5JCO A;  4ZHW A;  3CC4 F;  5HP8 A;  2G9I A;  4B46 A;  3CME F;  2QI2 A;  2LBX A;  4O2B A;  3UT5 B;  4BT3 A;  3NK6 A;  1YIJ F;  4LNU A;  4TUY B;  2H6L A;  5CA0 B;  5JH7 B;  2CW4 A;  4EI7 A;  3K14 A;  5G4U C;  2RHH A;  2HP0 B;  4O2A A;  2AIZ P;  5IJ0 B;  3CCJ F;  4O4H A;  2EWC A;  1Q81 H;  1Z5W A;  3HTN A;  3D01 A;  2K1S A;  3CCV F;  3RYC A;  3R0P A;  5CB4 B;  2UYP A;  4X1K A;  3MBM A;  3NK7 A;  3CPW F;  3WGM A;  5CB4 A;  3N2G A;  1X7P A;  1W5F A;  2OTJ F;  2GZL A;  4O4I B;  3CCL F;  3WJR A;  5EZY A;  5LXT A;  5IYZ B;  3WXM B;  1FFX B;  4BY9 D;  1SZQ A;  4IHJ B;  4C4W C;  1KC8 H;  1XV2 A;  4BT6 A;  4YJ3 A;  1W58 1;  3WGN A;  1QD9 A;  5KMG A;  3ELC A;  5J2T A;  2HQS C;  5EYP B;  5ITZ B;  1GO0 A;  5HY4 A;  3OBY A;  1X52 A;  3L7Q A;  1SA0 B;  3HKB B;  3IEQ A;  1W41 A;  3VYU C;  5C8Y A;  1T0A A;  2R6R 1;  1W5E A;  4FFB B;  1ONI A;  2H8E A;  3VTI C;  1W55 A;  2B33 A;  4XCQ A;  1YJN F;  5LOV A;  3N2K B;  3EOR A;  3C8L A;  3DDN A;  5MN5 A;  4DXD A;  2ZVZ A;  5LA6 A;  2HS0 A;  1KQS F;  4C82 A;  3S06 A;  3WJP A;  5CA1 A;  3D00 A;  2Q1Y A;  3FD5 A;  1CLI A;  4PWT A;  1NQ3 A;  5GIP C;  3S03 A;  3I7T A;  3WPW A;  3RYF A;  4U39 A;  1YHQ F;  3KJJ A;  3LFO A;  1K73 H;  5MN6 A;  5JCO C;  1Z5V A;  1W57 A;  2KTV A;  1RLU A;  3VYS C;  2P6Y A;  3IR9 A;  3F0G A;  4EB6 B;  3KIZ A;  1YQN A;  4X1I B;  2F9Z C;  1TVK B;  1H48 A;  3JAT B;  3N4Z A;  2IQQ A;  1U3P A;  3ZP7 A;  3J81 M;  4ZI7 B;  2VGN A;  1VQN F;  2HRY A;  5IJ9 A;  3MDO A;  2RHL A;  2DT4 A;  3RA5 A;  3LWR C;  4ZK7 A;  4B45 A;  1JY8 A;  2KTU A;  3SIV A;  3HKE A;  1CN7 A;  3F0E A;  1OFU A;  3KE1 A;  3ZP4 A;  3CCS F;  4RQO A;  4ZHV A;  3HWU A;  1JJ2 F;  2MQE A;  3ON1 A;  4G4W A;  4ZHQ A;  1NJI H;  1VQP F;  1ZWZ A;  4R40 B;  5AVM A;  2I6R A;  2HVY D;  1QU9 A;  5EIB C;  3JAR A;  3PAF A;  1VQL F;  1T0K B;  3MQW A;  1YI2 F;  5B8F A;  3HKC B;  1YIT F;  4O2B B;  3CCE F;  1QVG F;  4G4V A;  3RE3 A;  4LNU B;  2Z1U A;  3VMF B;  1PXW A;  2CVL A;  2Z1E A;  3P10 A;  2LBT A;  4E6E A;  3GYQ A;  2HS3 A;  3G71 F;  4F6R A;  2BTO A;  4TZZ A;  3CCR F;  4O2A B;  3TD3 A;  1IV4 A;  3S02 A;  1VQO F;  4O4H B;  3IEW A;  4BT7 A;  3J7A R;  3FFM A;  2HRU A;  2CSL A;  4RHA A;  3QTY A;  3RYC B;  3IKF A;  4I55 A;  1JD1 A;  4X1K B;  1DT9 A;  2L26 A;  3F6M A;  3RYI A;  4G88 A;  1SDS A;  3VO8 A;  2V9Y A;  3N2G B;  4BT2 A;  4NQ3 A;  3C9T A;  2CWJ A;  4ZOL A;  1YJ9 F;  4X20 A;  5EZY B;  1E7K A;  1JN1 A;  5J2U A;  5LXT B;  2AMT A;  5JQG A;  2OHW A;  1VQ5 F;  3Q8H A;  3LWO C;  3I56 F;  2H8C A;  3E1Y A;  2RHO A;  3JAM M;  3NVI B;  3JAK A;  3O85 A;  4YJ3 B;  5LYJ A;  5HXU A;  2JNB A;  1FSZ A;  2GLZ A;  4O4L A;  4DRX A;  5KMG B;  1VQM F;  5J2T B;  3HKD A;  2ZAU A;  2ZOV A;  3JVH A;  1VK3 A;  5DCV A;  2OTM A;  5C8Y B;  2YYE A;  1RQ2 A;  1XBI A;  3E22 B;  1Q86 H;  1YGY A;  3TD4 A;  3HJW C;  1W5B A;  5LOV B;  5HY1 A;  3E22 A;  2RHJ A;  4X3L A;  2I6D A;  5JVD A;  3P0Z A;  5LA6 B;  5HY0 A;  3WGJ A;  1Q8R A;  5CA1 B;  4TV9 A;  4BW0 B;  3JAW A;  3ZO8 A;  3RYF B;  5KX5 A;  3BYQ A;  1K9M H;  3OON A;  5FLX M;  5EIB D;  3QHD A;  1X25 A;  3KHN A;  1IV1 A;  1W42 A;  1PF5 A;  2YXZ A;  1U43 A;  1H7M A;  3LME A;  3VOA A;  3CYQ A;  3GTZ A;  4X1Y A;  3CPQ A;  3JAS A;  3N4Y A;  4BVR A;  1U3L A;  3LWQ C;  5IJ9 B;  5EAZ A;  1KNJ A;  1M1K H;  3VOB A;  1DBF A;  3FBA A;  5HXZ A;  3M84 A;  1XHO A;  5GIN C;  3GHZ A;  3WGL A;  3CCU F;  5MN4 A;  3HKE B;  3J80 M;  2HS4 A;  4I50 A;  1W59 A;  1RLG A;  3V7E A;  1W3E X;  3VCZ A;  1TUB A;  3ZOP A;  4U3J B;  4KWE A;  4ZHY B;  2R75 1;  3E20 B;  4ZHQ B;  1IV2 A;  2PMP A;  2WAL A;  4BT5 A;  5LP6 A;  2LCA A;  1UI9 A;  4U3J A;  1X7O A;  4G4X A;  5GIO C;  3JAR B;  4O4J A;  5ITZ A;  5EWR A;  2UZH A;  5IT9 M;  2ALE A;  2VGM A;  3WGK A;  1H47 A;  3ESJ A;  4B62 A;  1QAH A;  5HWE A;  5HY2 A;  4WBN A;  1JFF A;  2VAP A;  3RA6 A;  1ODE A;  4F6R B;  2PHN A;  2CHT A;  3K2X A;  5EB1 B;  2IG8 A;  3JCM M;  4YJ2 A;  2W8B C;  3K0T A;  3MCA B;  4I4T A;  3RYH A;  4ERH A;  1RA4 A;  5EB0 A;  4HNA A;  3LYB A;  3VIU A;  3CD6 F;  4TV8 A;  2OZB A;  4EI8 A;  2UYJ A;  3F0D A;  4I55 B;  5FNV A;  4LCK A;  2AIF A;  3RYI B;  3JAL A;  2HX0 A;  2BTU A;  2UYN A;  4NUT A;  3U0O A;  3PLA C;  1GZ0 A;  4IIJ A;  5GAP K;  1K8A H;  3CG6 A;  3G4S F;  5GON A;  4C8G A;  4ZOL B;  3K12 A;  4X20 B;  3DC2 A;  1N8R H;  5J2U B;  5JQG B;  2LBW A;  4BT4 A;  2BO1 A;  3F0F A;  3UT5 A;  5HP7 A;  1VQ6 F;  3C9S A;  1VQ8 F;  3CCQ F;  4TUY A;  1VQV A;  3JAK B;  5CA0 A;  2CZW A;  5JH7 A;  3FD6 A;  4BVT A;  5LYJ B;  3HAX D;  2FC3 A;  4O4L B;  4DRX B;  3NMU C;  2HP0 A;  4C81 A;  3OW2 F;  4C8I A;  3HKD B;  1UFY A;  5IJ0 A;  1W5A A;  1FNJ A;  4M8I A;  1KD1 H;  5BMV B;  1YJW F;  1CK2 A;  3CB2 A;  1QVF F;  2OTL F;  2QA4 F;  3MCQ A;  5BMV A;  3C9R A;  5FJ4 C;  2QEX F;  4X3M A;  5JVD B;  3V4D A;  3CC2 F;  3S0H A;  5GAN K;  3S0W A;  4O4I A;  1Q7Y H;  4TV9 B;  4G4Z A;  2Z1T A;  1U40 A;  3VYT C;  5IYZ A;  3IMP A;  3JAW B;  4NWO B;  3D54 A;  3LDT A;  3T80 A;  3V7Q A;  5LP6 C;  1FFX A;  5KX5 B;  3OBW A;  1W40 A;  2Z1F A;  3B6N A;  3CYP B;  4IHJ A;  2BTQ B;  3LWP C;  3CC7 F;  1VH8 A;  3AGK A;  1COM A;  3C9U A;  2ZF8 A;  3IKE A;  1M90 H;  5EYP A;  2UYK A;  3M4S A;  1XRG A;  4X1Y B;  3JAS B;  2KGW A; 
#chains in the Genus database with same CATH homology
 3F0G A;  3IEW A;  3K14 A;  4C8E A;  1W55 A;  3P0Z A;  3ERN A;  1YQN A;  3F0D A;  4C81 A;  1U3L A;  4C8I A;  3EOR A;  1U40 A;  1VHA A;  1H48 A;  2UZH A;  1KNJ A;  3T80 A;  1U3P A;  1IV3 A;  5B8F A;  3FBA A;  1KNK A;  3FPI A;  3IKF A;  3F6M A;  1H47 A;  3B6N A;  4C82 A;  3GHZ A;  3ESJ A;  3RE3 A;  3ELC A;  1VH8 A;  3MBM A;  4C8G A;  3K2X A;  3JVH A;  1JY8 A;  3P10 A;  3QHD A;  3F0E A;  3KE1 A;  3IKE A;  3F0F A;  1JN1 A;  3IEQ A;  1IV2 A;  1IV1 A;  2GZL A;  2AMT A;  1GX1 A;  1W57 A;  2PMP A;  1IV4 A;  1T0A A;  3Q8H A;  1U43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...