1JY8A

2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2C-methyl-d-erythritol-2,4-cyclodiphosphate synthase involved in mevalonate-independent biosynthesis of isoprenoids.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jy8A00
3K14A 1IV3A 3F6MA 1U43A 3B6NA 3F0GA 3QHDA 3GHZA 4C81A 1H48A 3F0FA 3FBAA 1H47A 1GX1A 3ERNA 4C8GA 3MBMA 5B8FA 1KNKA 3ELCA 3IEQA 1IV1A 1IV2A 3P10A 2UZHA 3F0DA 3Q8HA 1VHAA 3FPIA 1U40A 3EORA 1T0AA 1W55A 3P0ZA 1IV4A 1KNJA 2AMTA 2GZLA 3JVHA 1W57A 3ESJA 3IEWA 3K2XA 3KE1A 1U3LA 1YQNA 4C8IA 2PMPA 3F0EA 3RE3A 1JY8A 4C8EA 1JN1A 1VH8A 3IKFA 1U3PA 3IKEA 3T80A 4C82A
chains in the Genus database with same CATH superfamily
2ZVYA 1ZWZA 2R751 3B6NA 5EWRA 5LOVA 5HP8A 4BVTA 5J2UB 1DT9A 3FBAA 4TUYA 3I7TA 4B62A 1GO0A 3GYQA 3HTNA 5LP6A 5EB0A 1W3EX 4ZK7A 2ZODA 3OBWA 4DRXA 3CCLF 2K1SA 3Q8HA 1XHOA 3LWQC 4WBNB 1JJ2F 1W55A 3NVIB 2AMTA 3K2XA 4LCKA 2BTUA 2IQQA 3JALA 2ZVZA 3CYPB 3V4DA 5JCOC 2VAWA 3JATA 2PHNA 4X3LA 3HKCA 3N2KB 3CC4F 3E22B 5IJ9B 1XV2A 3WGLA 3RYIA 5CA1A 3V7EA 1JD1A 1ODEA 4O2BA 4ZHWA 3WGKA 3ERNA 3ZP7A 3U0OA 3WXMB 2HX0A 2UZHA 2LBWA 5J2TA 1NMUB 4F6RA 3M84A 4IHJA 2H8CA 2HP0B 1FNJA 3GTZA 1CK2A 3WPXA 3LWRC 4C8IA 1IPAA 1SA0A 4X1YA 3CG6A 5G4VC 4TV9A 1COMA 2CVLA 2BTQB 1RQ7A 3C8LA 3D01A 2VGNA 1GX1A 3NK7A 4ZOLA 4EI8A 3FD6A 2Z1TA 1UFYA 3M4SA 3MDOA 5LXTB 3HWUA 1T0AA 1QD9A 1IV4A 3RYCB 3JVHA 1VQNF 2RHOA 1E7KA 3OW2F 4BT6A 2V9YA 3RYHA 1M1KH 4XCQA 3J7AR 1JY8A 4I55B 3G71F 5MN5A 1PF5A 1QAHA 4EB6A 1N8RH 3HAXD 4YJ3B 2UYJA 2RHHA 5JQGA 4RQOA 3RA6A 3UT5B 4I55A 4LNUB 3QUWA 4ZHVA 2QEXF 1Q8RA 5MN4A 4HNAB 4X20B 3VO8A 4O4HB 3L7QA 3JASA 3P10A 5IT9M 5EIBD 5HY1A 3HJWC 3RYCA 1X7OA 3HKEB 4RHAA 3MCQA 3SIUA 3P0ZA 4BT7A 1YJNF 3KE1A 3P4EA 1VQ4F 4O2AB 4KWEA 2KG4A 3S0YA 1K9MH 3JAWA 1TUBB 3F0GA 3J81M 3VOBA 1SZQA 1W41A 4M8IA 5LXTA 1VQPF 1OAPA 3JATB 2WALA 2R6R1 4O4HA 2CZWA 4ZI7B 3MBMA 1W5FA 4LNUA 1W5EA 3C9RA 3DC2A 4I4TA 4B46A 3ZO8A 4G88A 5CA0B 5HWEA 3HKBB 3VYTC 1YIJF 2I6DA 3F0EA 3PAFA 3R0PA 3V7QA 2YXZA 5IJ0B 3LWPC 3ZP4A 1VH8A 2HP0A 4R40B 3VOAA 3IR9A 3E22A 5IJ9A 3S06A 2HS3A 5JQGB 4PWTA 5IJ0A 2ALEA 4HNAA 2HRYA 4X20A 4O2AA 3I56F 5BMVB 5KX5B 5JH7B 1X25A 4BT5A 2Q1XA 5IYZA 2LBTA 1W57A 1U3LA 3KJKA 3KHNA 2UYKA 2AIZP 4E6EA 1VQ7F 4X3MA 5FJ4C 3WGNA 5LYJA 2DYYA 3VMFB 5HY2A 1TUBA 2OZBA 5EYPB 3GHZA 4I4TB 1YHQF 2HRUA 4NWOB 3CCUF 1OFUA 4ZOLB 5GAPK 4C8GA 2OHWA 5EB1B 4U39A 1YITF 5ITZB 2N48A 1YJ9F 3C9UA 4I50A 5EZYA 3LDTA 1Q7YH 5EAZA 5IYZB 2OTLF 2Z01A 3HKBA 3JALB 4O4JB 5GONA 3RA5A 1QVFF 2OTJF 4C8EA 1K73H 1GZ0A 3CCJF 3BYQA 3O85A 1PXWA 3JAKA 3QHDA 4BT2A 3D54A 5FNVB 3VTIC 5CB4A 3HKCB 2I6RA 3N2KA 3JAMM 3JASB 3CCEF 5HXUA 2GLZA 1R1MA 1Z5VA 2VAPA 5AVMA 1KD1H 2Z1EA 2QA4F 2HVYD 1QU9A 3C9TA 3WJPA 3RYFA 2VAMA 1W5AA 2B33A 3VI6A 1VQKF 2KGWA 3VYUC 2EWCA 3JAKB 5GINC 4TV8A 2AIFA 5KMGB 1VQ5F 2BO1A 3ELCA 1X52A 5GONB 2ZOVA 1GO1A 4BT4A 3KJJA 3CYQA 4O4LA 4ZHQA 2G9IA 5EZYB 1VQ9F 3LYBA 4G4VA 3VCZA 1SA0B 3JAWB 3RYHB 2HQSC 3CCQF 3CC2F 3WGMA 3IKFA 1CLIA 5LOVB 1Q81H 4BY9D 4C81A 3KIZA 1H48A 1VQ8F 3F0FA 4TZZA 3S02A 5J2TB 1W42A 3WJQA 3CC7F 3ZOPA 2IAFA 3TD3A 1VQVA 4FFBA 5C8YB 1X7PA 1U40A 3EORA 3HKEA 4O2BB 3HKDA 3I55F 2Z1UA 1Q82H 5HY0A 1K8AH 4B5CA 3ON1A 3IEWA 1YQNA 1H7MA 3E1YA 2Q1YA 2PMPA 4FFBB 1YI2F 3LWOC 5HY4A 3RYFB 5FLXM 3QTYA 4YJ3A 2ZAUA 2H8EA 1RLGA 2GVIA 3RYIB 5LA6B 5CA1B 1KC8H 1H47A 2FC3A 1M90H 5B8FA 4DRXB 1KNKA 1IV1A 1W40A 2CHTA 3LFOA 1VQMF 4ZHYB 3VIUA 1NQ3A 3S0HA 4F6RB 4EB6B 5KX5A 3CMEF 2CWJA 3RE3A 4YJ2B 3NMUC 3N2GB 4IIJA 4BVQA 1SDSA 2KTUA 1FFXA 3G4SF 3OBYA 1IV3A 2RB9A 3F6MA 1RA4A 1VQLF 5C8YA 5GANK 3DDNA 1TVKA 4YJ2A 2QTPA 3G6EF 3CCVF 1Z5WA 3IMPA 2HS4A 3FPIA 3HKDB 5G4UC 3WJRA 5EO3A 4U3JA 2L26A 1VQOF 4G4YA 4WBNA 5GIPC 5A2QM 5LA6A 3I3FA 2RHLA 3D00A 3S03A 1CN7A 1T0KB 4U3JB 2DT4A 3UT5A 3JARA 3MQWA 5JVDA 5J2UA 1NJIH 2F9ZC 4X1KA 5KMGA 4EI9A 1YJWF 3F0DA 3JARB 5JVDB 2CSLA 4ZHQB 4O4LB 5JH7A 1KNJA 2GZLA 2LBXA 2FGYA 3MCAB 4B45A 4O4JA 2VXYA 5MN6A 2LCAA 3CCMF 1U3PA 4X1IB 3T80A 3CMAF 2H6LA 3SIVA 3K14A 3CD6F 1DBFA 3NVKE 2P6YA 4EI7A 1TVKB 5EYPA 2HP3A 3TD5A 3V3TA 1FNKA 4TV9B 5CB4B 4O4IA 2RHJA 3WPWA 1QVGF 4NQ3A 3TD4A 5GIOC 1IV2A 5EIBC 4ZI7A 5DCVA 5CA0A 5LP6B 3CPQA 2UYNB 3E20B 3OONA 3C9SA 4ERHA 4IHJB 3N4ZA 1Q86H 4X1IA 2HS0A 1JN1A 2IG8A 4C4WC 3CB2A 1JFFB 2YYEA 2KTVA 4DXDA 3M1XA 1FSZA 2MQEA 1RQ2A 1VK3A 1W5BA 3CXCF 3AGKA 1RLUA 2QI2A 3CPWF 1XBIA 3LMEA 1W59A 4G4ZA 1XRGA 1J7HA 2NMUA 4BVSA 5LP6C 1W581 2OTMA 3NK6A 3N4YA 2JNBA 4NUTA 4BVRA 3CCSF 5LYJB 1KQSF 1JFFA 1YGYA 4IIJB 3N2GA 3IKEA 4O4IB 3LWVC 4X1KB 2W8BC 1FFXB 1UI9A 5JCOA 1U43A 4TUYB 2ZF8A 1ONIA 2VGMA 4BW0B 5BMVA 5HP7A 3K12A 3JCMM 3CCRF 2UYNA 2CW4A 2Z1FA 4TV8B 3IEQA 3S0WA 2CHSA 1VHAA 5FNVA 4I50B 1W2BF 2BTOA 1S72F 4BT3A 3PLAC 5ITZA 3FD5A 3J80M 4G4XA 3ESJA 3FFMA 1VQ6F 3K0TA 3VYSC 2UYPA 4X1YB 4G4WA 3WGJA 5HXZA 4C82A
chains in the Genus database with same CATH topology
3K14A 1IV3A 3F6MA 1U43A 3B6NA 3F0GA 3QHDA 3GHZA 4C81A 1H48A 3F0FA 3FBAA 1H47A 1GX1A 3ERNA 4C8GA 3MBMA 5B8FA 1KNKA 3ELCA 3IEQA 1IV1A 1IV2A 3P10A 2UZHA 3F0DA 3Q8HA 1VHAA 3FPIA 1U40A 3EORA 1T0AA 1W55A 3P0ZA 1IV4A 1KNJA 2AMTA 2GZLA 3JVHA 1W57A 3ESJA 3IEWA 3K2XA 3KE1A 1U3LA 1YQNA 4C8IA 2PMPA 3F0EA 3RE3A 1JY8A 4C8EA 1JN1A 1VH8A 3IKFA 1U3PA 3IKEA 3T80A 4C82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  1IV3 A;  3F6M A;  1U43 A;  3B6N A;  3F0G A;  3QHD A;  3GHZ A;  4C81 A;  1H48 A;  3F0F A;  3FBA A;  1H47 A;  1GX1 A;  3ERN A;  4C8G A;  3MBM A;  5B8F A;  1KNK A;  3ELC A;  3IEQ A;  1IV1 A;  1IV2 A;  3P10 A;  2UZH A;  3F0D A;  3Q8H A;  1VHA A;  3FPI A;  1U40 A;  3EOR A;  1T0A A;  1W55 A;  3P0Z A;  1IV4 A;  1KNJ A;  2AMT A;  2GZL A;  3JVH A;  1W57 A;  3ESJ A;  3IEW A;  3K2X A;  3KE1 A;  1U3L A;  1YQN A;  4C8I A;  2PMP A;  3F0E A;  3RE3 A;  1JY8 A;  4C8E A;  1JN1 A;  1VH8 A;  3IKF A;  1U3P A;  3IKE A;  3T80 A;  4C82 A; 
#chains in the Genus database with same CATH topology
 2ZVY A;  1ZWZ A;  2R75 1;  3B6N A;  5EWR A;  5LOV A;  5HP8 A;  4BVT A;  5J2U B;  1DT9 A;  3FBA A;  4TUY A;  3I7T A;  4B62 A;  1GO0 A;  3GYQ A;  3HTN A;  5LP6 A;  5EB0 A;  1W3E X;  4ZK7 A;  2ZOD A;  3OBW A;  4DRX A;  3CCL F;  2K1S A;  3Q8H A;  1XHO A;  3LWQ C;  4WBN B;  1JJ2 F;  1W55 A;  3NVI B;  2AMT A;  3K2X A;  4LCK A;  2BTU A;  2IQQ A;  3JAL A;  2ZVZ A;  3CYP B;  3V4D A;  5JCO C;  2VAW A;  3JAT A;  2PHN A;  4X3L A;  3HKC A;  3N2K B;  3CC4 F;  3E22 B;  5IJ9 B;  1XV2 A;  3WGL A;  3RYI A;  5CA1 A;  3V7E A;  1JD1 A;  1ODE A;  4O2B A;  4ZHW A;  3WGK A;  3ERN A;  3ZP7 A;  3U0O A;  3WXM B;  2HX0 A;  2UZH A;  2LBW A;  5J2T A;  1NMU B;  4F6R A;  3M84 A;  4IHJ A;  2H8C A;  2HP0 B;  1FNJ A;  3GTZ A;  1CK2 A;  3WPX A;  3LWR C;  4C8I A;  1IPA A;  1SA0 A;  4X1Y A;  3CG6 A;  5G4V C;  4TV9 A;  1COM A;  2CVL A;  2BTQ B;  1RQ7 A;  3C8L A;  3D01 A;  2VGN A;  1GX1 A;  3NK7 A;  4ZOL A;  4EI8 A;  3FD6 A;  2Z1T A;  1UFY A;  3M4S A;  3MDO A;  5LXT B;  3HWU A;  1T0A A;  1QD9 A;  1IV4 A;  3RYC B;  3JVH A;  1VQN F;  2RHO A;  1E7K A;  3OW2 F;  4BT6 A;  2V9Y A;  3RYH A;  1M1K H;  4XCQ A;  3J7A R;  1JY8 A;  4I55 B;  3G71 F;  5MN5 A;  1PF5 A;  1QAH A;  4EB6 A;  1N8R H;  3HAX D;  4YJ3 B;  2UYJ A;  2RHH A;  5JQG A;  4RQO A;  3RA6 A;  3UT5 B;  4I55 A;  4LNU B;  3QUW A;  4ZHV A;  2QEX F;  1Q8R A;  5MN4 A;  4HNA B;  4X20 B;  3VO8 A;  4O4H B;  3L7Q A;  3JAS A;  3P10 A;  5IT9 M;  5EIB D;  5HY1 A;  3HJW C;  3RYC A;  1X7O A;  3HKE B;  4RHA A;  3MCQ A;  3SIU A;  3P0Z A;  4BT7 A;  1YJN F;  3KE1 A;  3P4E A;  1VQ4 F;  4O2A B;  4KWE A;  2KG4 A;  3S0Y A;  1K9M H;  3JAW A;  1TUB B;  3F0G A;  3J81 M;  3VOB A;  1SZQ A;  1W41 A;  4M8I A;  5LXT A;  1VQP F;  1OAP A;  3JAT B;  2WAL A;  2R6R 1;  4O4H A;  2CZW A;  4ZI7 B;  3MBM A;  1W5F A;  4LNU A;  1W5E A;  3C9R A;  3DC2 A;  4I4T A;  4B46 A;  3ZO8 A;  4G88 A;  5CA0 B;  5HWE A;  3HKB B;  3VYT C;  1YIJ F;  2I6D A;  3F0E A;  3PAF A;  3R0P A;  3V7Q A;  2YXZ A;  5IJ0 B;  3LWP C;  3ZP4 A;  1VH8 A;  2HP0 A;  4R40 B;  3VOA A;  3IR9 A;  3E22 A;  5IJ9 A;  3S06 A;  2HS3 A;  5JQG B;  4PWT A;  5IJ0 A;  2ALE A;  4HNA A;  2HRY A;  4X20 A;  4O2A A;  3I56 F;  5BMV B;  5KX5 B;  5JH7 B;  1X25 A;  4BT5 A;  2Q1X A;  5IYZ A;  2LBT A;  1W57 A;  1U3L A;  3KJK A;  3KHN A;  2UYK A;  2AIZ P;  4E6E A;  1VQ7 F;  4X3M A;  5FJ4 C;  3WGN A;  5LYJ A;  2DYY A;  3VMF B;  5HY2 A;  1TUB A;  2OZB A;  5EYP B;  3GHZ A;  4I4T B;  1YHQ F;  2HRU A;  4NWO B;  3CCU F;  1OFU A;  4ZOL B;  5GAP K;  4C8G A;  2OHW A;  5EB1 B;  4U39 A;  1YIT F;  5ITZ B;  2N48 A;  1YJ9 F;  3C9U A;  4I50 A;  5EZY A;  3LDT A;  1Q7Y H;  5EAZ A;  5IYZ B;  2OTL F;  2Z01 A;  3HKB A;  3JAL B;  4O4J B;  5GON A;  3RA5 A;  1QVF F;  2OTJ F;  4C8E A;  1K73 H;  1GZ0 A;  3CCJ F;  3BYQ A;  3O85 A;  1PXW A;  3JAK A;  3QHD A;  4BT2 A;  3D54 A;  5FNV B;  3VTI C;  5CB4 A;  3HKC B;  2I6R A;  3N2K A;  3JAM M;  3JAS B;  3CCE F;  5HXU A;  2GLZ A;  1R1M A;  1Z5V A;  2VAP A;  5AVM A;  1KD1 H;  2Z1E A;  2QA4 F;  2HVY D;  1QU9 A;  3C9T A;  3WJP A;  3RYF A;  2VAM A;  1W5A A;  2B33 A;  3VI6 A;  1VQK F;  2KGW A;  3VYU C;  2EWC A;  3JAK B;  5GIN C;  4TV8 A;  2AIF A;  5KMG B;  1VQ5 F;  2BO1 A;  3ELC A;  1X52 A;  5GON B;  2ZOV A;  1GO1 A;  4BT4 A;  3KJJ A;  3CYQ A;  4O4L A;  4ZHQ A;  2G9I A;  5EZY B;  1VQ9 F;  3LYB A;  4G4V A;  3VCZ A;  1SA0 B;  3JAW B;  3RYH B;  2HQS C;  3CCQ F;  3CC2 F;  3WGM A;  3IKF A;  1CLI A;  5LOV B;  1Q81 H;  4BY9 D;  4C81 A;  3KIZ A;  1H48 A;  1VQ8 F;  3F0F A;  4TZZ A;  3S02 A;  5J2T B;  1W42 A;  3WJQ A;  3CC7 F;  3ZOP A;  2IAF A;  3TD3 A;  1VQV A;  4FFB A;  5C8Y B;  1X7P A;  1U40 A;  3EOR A;  3HKE A;  4O2B B;  3HKD A;  3I55 F;  2Z1U A;  1Q82 H;  5HY0 A;  1K8A H;  4B5C A;  3ON1 A;  3IEW A;  1YQN A;  1H7M A;  3E1Y A;  2Q1Y A;  2PMP A;  4FFB B;  1YI2 F;  3LWO C;  5HY4 A;  3RYF B;  5FLX M;  3QTY A;  4YJ3 A;  2ZAU A;  2H8E A;  1RLG A;  2GVI A;  3RYI B;  5LA6 B;  5CA1 B;  1KC8 H;  1H47 A;  2FC3 A;  1M90 H;  5B8F A;  4DRX B;  1KNK A;  1IV1 A;  1W40 A;  2CHT A;  3LFO A;  1VQM F;  4ZHY B;  3VIU A;  1NQ3 A;  3S0H A;  4F6R B;  4EB6 B;  5KX5 A;  3CME F;  2CWJ A;  3RE3 A;  4YJ2 B;  3NMU C;  3N2G B;  4IIJ A;  4BVQ A;  1SDS A;  2KTU A;  1FFX A;  3G4S F;  3OBY A;  1IV3 A;  2RB9 A;  3F6M A;  1RA4 A;  1VQL F;  5C8Y A;  5GAN K;  3DDN A;  1TVK A;  4YJ2 A;  2QTP A;  3G6E F;  3CCV F;  1Z5W A;  3IMP A;  2HS4 A;  3FPI A;  3HKD B;  5G4U C;  3WJR A;  5EO3 A;  4U3J A;  2L26 A;  1VQO F;  4G4Y A;  4WBN A;  5GIP C;  5A2Q M;  5LA6 A;  3I3F A;  2RHL A;  3D00 A;  3S03 A;  1CN7 A;  1T0K B;  4U3J B;  2DT4 A;  3UT5 A;  3JAR A;  3MQW A;  5JVD A;  5J2U A;  1NJI H;  2F9Z C;  4X1K A;  5KMG A;  4EI9 A;  1YJW F;  3F0D A;  3JAR B;  5JVD B;  2CSL A;  4ZHQ B;  4O4L B;  5JH7 A;  1KNJ A;  2GZL A;  2LBX A;  2FGY A;  3MCA B;  4B45 A;  4O4J A;  2VXY A;  5MN6 A;  2LCA A;  3CCM F;  1U3P A;  4X1I B;  3T80 A;  3CMA F;  2H6L A;  3SIV A;  3K14 A;  3CD6 F;  1DBF A;  3NVK E;  2P6Y A;  4EI7 A;  1TVK B;  5EYP A;  2HP3 A;  3TD5 A;  3V3T A;  1FNK A;  4TV9 B;  5CB4 B;  4O4I A;  2RHJ A;  3WPW A;  1QVG F;  4NQ3 A;  3TD4 A;  5GIO C;  1IV2 A;  5EIB C;  4ZI7 A;  5DCV A;  5CA0 A;  5LP6 B;  3CPQ A;  2UYN B;  3E20 B;  3OON A;  3C9S A;  4ERH A;  4IHJ B;  3N4Z A;  1Q86 H;  4X1I A;  2HS0 A;  1JN1 A;  2IG8 A;  4C4W C;  3CB2 A;  1JFF B;  2YYE A;  2KTV A;  4DXD A;  3M1X A;  1FSZ A;  2MQE A;  1RQ2 A;  1VK3 A;  1W5B A;  3CXC F;  3AGK A;  1RLU A;  2QI2 A;  3CPW F;  1XBI A;  3LME A;  1W59 A;  4G4Z A;  1XRG A;  1J7H A;  2NMU A;  4BVS A;  5LP6 C;  1W58 1;  2OTM A;  3NK6 A;  3N4Y A;  2JNB A;  4NUT A;  4BVR A;  3CCS F;  5LYJ B;  1KQS F;  1JFF A;  1YGY A;  4IIJ B;  3N2G A;  3IKE A;  4O4I B;  3LWV C;  4X1K B;  2W8B C;  1FFX B;  1UI9 A;  5JCO A;  1U43 A;  4TUY B;  2ZF8 A;  1ONI A;  2VGM A;  4BW0 B;  5BMV A;  5HP7 A;  3K12 A;  3JCM M;  3CCR F;  2UYN A;  2CW4 A;  2Z1F A;  4TV8 B;  3IEQ A;  3S0W A;  2CHS A;  1VHA A;  5FNV A;  4I50 B;  1W2B F;  2BTO A;  1S72 F;  4BT3 A;  3PLA C;  5ITZ A;  3FD5 A;  3J80 M;  4G4X A;  3ESJ A;  3FFM A;  1VQ6 F;  3K0T A;  3VYS C;  2UYP A;  4X1Y B;  4G4W A;  3WGJ A;  5HXZ A;  4C82 A; 
#chains in the Genus database with same CATH homology
 3K14 A;  1IV3 A;  3F6M A;  1U43 A;  3B6N A;  3F0G A;  3QHD A;  3GHZ A;  4C81 A;  1H48 A;  3F0F A;  3FBA A;  1H47 A;  1GX1 A;  3ERN A;  4C8G A;  3MBM A;  5B8F A;  1KNK A;  3ELC A;  3IEQ A;  1IV1 A;  1IV2 A;  3P10 A;  2UZH A;  3F0D A;  3Q8H A;  1VHA A;  3FPI A;  1U40 A;  3EOR A;  1T0A A;  1W55 A;  3P0Z A;  1IV4 A;  1KNJ A;  2AMT A;  2GZL A;  3JVH A;  1W57 A;  3ESJ A;  3IEW A;  3K2X A;  3KE1 A;  1U3L A;  1YQN A;  4C8I A;  2PMP A;  3F0E A;  3RE3 A;  1JY8 A;  4C8E A;  1JN1 A;  1VH8 A;  3IKF A;  1U3P A;  3IKE A;  3T80 A;  4C82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...