1JY8A

2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase (ispf)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-methyl-d-erythritol-2,4-cyclodiphosphate synthase involved in mevalonate-independent biosynthesis of isoprenoids.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2001-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1jy8A00
1VH8A 3P0ZA 4C8EA 1KNJA 3ERNA 3K2XA 3B6NA 1U3PA 3EORA 1GX1A 3ELCA 3K14A 3IEQA 1KNKA 1W55A 4C82A 3P10A 3FBAA 1VHAA 1IV2A 2AMTA 3GHZA 3IKFA 1W57A 3RE3A 3JVHA 1JY8A 3FPIA 2GZLA 3F0FA 1T0AA 2PMPA 4C81A 3F0EA 3IKEA 1H47A 1IV1A 3F6MA 1JN1A 1U43A 1U40A 3MBMA 4C8IA 3KE1A 3IEWA 3Q8HA 3QHDA 2UZHA 4C8GA 1YQNA 1U3LA 1H48A 3ESJA 3F0GA 3F0DA 3T80A 1IV3A 1IV4A 5B8FA
chains in the Genus database with same CATH superfamily
1VH8A 1XBIA 2Z1UA 3CC4F 3EORA 1KQSF 2HQSC 5GONB 3C9TA 5A2QM 2FGYA 2UYNA 3P10A 5MN5A 1W57A 3JALB 5MN6A 3J80M 4EB6B 3QUWA 3CPWF 5JQGB 4X20A 1ZWZA 3KJKA 4O4JA 1ONIA 3MCQA 1Q86H 4O4IB 3JCMM 3E20B 5BMVB 1VQLF 1IV4A 3JASA 3HTNA 2Z01A 1W5BA 1W55A 1W3EX 4DRXA 4O2BB 2AMTA 3LWQC 1GO0A 5EYPA 3CCSF 1YJWF 3CCVF 2HX0A 3F0EA 2WALA 4TUYB 3CG6A 2VAPA 3E22B 4IHJA 1QVGF 4C8IA 5G4VC 1JJ2F 3QHDA 3NK6A 1U3LA 1Z5VA 2Z1EA 3PLAC 1TUBB 5IJ9A 2DYYA 5J2TA 3IEQA 4O4JB 4ZOLB 3RA6A 1M90H 1UI9A 2VGNA 4ZK7A 4BT3A 3OBYA 1W5AA 4R40B 3JASB 3CXCF 2ZAUA 5EO3A 4TV8A 4X1KA 3M1XA 3VO8A 4XCQA 3IEWA 1YGYA 4C8GA 3F0GA 1FFXB 1SA0B 4G4YA 4IIJA 5EZYB 5EYPB 2ZF8A 3JAKA 1X7PA 5JVDB 2UYJA 3C9RA 3O85A 1GX1A 2AIFA 3WGJA 1K9MH 4ZI7A 1W40A 3G4SF 4IHJB 4BT7A 5J2UB 3M4SA 2OHWA 3L7QA 2LBXA 4RQOA 3RYCB 3JARA 2QI2A 4B46A 2F9ZC 1YHQF 3HWUA 5CA1A 5IJ9B 5J2TB 1KC8H 2QEXF 5LXTA 1U40A 1T0KB 3G71F 1COMA 1VQ7F 1FSZA 2UZHA 1VQ6F 4BVTA 1ODEA 5EWRA 3VYSC 4TV9A 2VXYA 5LOVA 2ZOVA 5HXUA 2Q1YA 4I50B 2RHOA 5HY0A 1NQ3A 2DT4A 3KIZA 3HKBA 2KTVA 2CWJA 2CHSA 3HKCA 5HP7A 3FPIA 4IIJB 1DT9A 3JAKB 1T0AA 3J81M 3CCEF 1UFYA 1OFUA 5IYZB 1TVKA 4EI8A 3F6MA 5EB1B 3KE1A 3WPXA 3VIUA 3R0PA 1W59A 3JAMM 2HP3A 3JARB 4B5CA 4G88A 2OTLF 5IJ0B 3ERNA 5LA6A 5HP8A 2Z1TA 1RQ2A 5EIBD 4NQ3A 4YJ2A 3HKDA 1K8AH 5JCOA 1VQPF 3CMEF 2YYEA 5JCOC 2BTOA 3GTZA 1VQNF 5LOVB 3HKEB 1W41A 5LP6A 3CCUF 5LP6C 4BVQA 4X1IA 3LWPC 1NJIH 1RQ7A 5KMGA 1IV1A 1JN1A 3HKBB 5KX5B 1E7KA 4FFBB 3WJPA 5CA0A 4WBNB 3CCLF 3HKCB 3ESJA 4ZHQA 1H48A 3IR9A 2KG4A 3DDNA 3RYFA 4BT4A 3VYTC 2JNBA 2P6YA 4BT2A 5EAZA 3C8LA 2IAFA 2UYKA 4BVRA 2H8CA 1SDSA 3MDOA 5LYJA 3JAWA 2RHLA 5FJ4C 4ZHVA 3IKFA 1DBFA 1Q7YH 1JY8A 4DXDA 2CVLA 1JFFB 3WGMA 3SIUA 2UYPA 2ZODA 3RYHA 5LA6B 2RHJA 2HRUA 3IKEA 4LNUA 5FNVA 4ZHWA 3CCQF 1YIJF 4YJ2B 3HKDB 1H7MA 2BTQB 2UYNB 1CN7A 2R751 1YI2F 3F0DA 4HNAA 3P0ZA 3TD3A 5G4UC 3OONA 1Z5WA 5AVMA 3WPWA 1GO1A 3S0YA 4X20B 3TD5A 4G4XA 2QA4F 5EIBC 1FNJA 3FBAA 3MCAB 3QTYA 5HY4A 4ZHQB 3RE3A 3RYFB 2K1SA 3BYQA 2Q1XA 3S03A 2HS0A 3CCMF 2L26A 1VQ8F 3ZO8A 1W2BF 3U0OA 2Z1FA 4LCKA 4O2AA 1CK2A 4X1YA 3GYQA 3UT5A 1PXWA 3D01A 5LYJB 3JAWB 5GANK 1VQVA 2HP0A 4DRXB 3E1YA 3K0TA 2LCAA 3LYBA 4G4VA 3AGKA 4G4WA 2VAMA 3LFOA 3CPQA 1VQ5F 3RYHB 1RLUA 4YJ3A 2H6LA 4LNUB 4ERHA 1YJ9F 3VCZA 3GHZA 3CCRF 2PHNA 3N2KA 2PMPA 3CD6F 1VQKF 3NK7A 4F6RA 4RHAA 4I55A 1OAPA 3T80A 5GINC 4U3JA 2G9IA 3LDTA 3HAXD 3VI6A 1U3PA 1FNKA 4TV8B 1VQOF 4X1KB 3PAFA 4BT6A 2HVYD 4O2AB 4X1YB 5C8YA 3NVIB 2LBWA 1N8RH 3N4YA 3CMAF 2HP0B 4ZOLA 5GONA 1VK3A 2HRYA 5JH7A 3S02A 1H47A 1IPAA 3NVKE 4U39A 1VQ9F 4ZI7B 1YITF 3JALA 3FD5A 2KGWA 2N48A 3N2KB 1KD1H 5GIPC 5JQGA 3VMFB 4C8EA 3K2XA 1W5EA 2OTJF 2ZVYA 2I6DA 5CA1B 2R6R1 3K14A 3ZOPA 1QU9A 4BY9D 3WJQA 4F6RB 5LXTB 1Q81H 5BMVA 1SZQA 2EWCA 5DCVA 1QAHA 1VQ4F 3WGNA 4TV9B 3VTIC 2GLZA 4NUTA 3ZP4A 3JATA 3LWRC 1W5FA 2ZVZA 2RB9A 2I6RA 4KWEA 1K73H 5B8FA 1KNJA 5JH7B 3ELCA 4TUYA 3E22A 2HS4A 1TVKB 5MN4A 3CC2F 4EI9A 4BW0B 2OZBA 3LWVC 2LBTA 4G4ZA 3CC7F 3JVHA 2KTUA 3N4ZA 1TUBA 4B45A 2MQEA 4X3MA 3C9SA 4ZHYB 3C9UA 1W581 3CYQA 4O4HA 1U43A 5ITZA 3OBWA 3MBMA 3ON1A 3KHNA 3CYPB 1W42A 4O4LA 3V7QA 3OW2F 3CCJF 5LP6B 4M8IA 4X1IB 1Q82H 2VGMA 3D54A 1GZ0A 5KMGB 4EI7A 3JATB 1FFXA 1RA4A 1SA0A 2BO1A 2W8BC 5EZYA 5CA0B 3NMUC 5JVDA 2ALEA 3G6EF 5GIOC 4C81A 3S06A 3S0WA 2RHHA 3FD6A 5J2UA 3RYCA 3WJRA 3ZP7A 5CB4A 4B62A 1M1KH 4BVSA 3N2GA 2IG8A 3B6NA 3FFMA 5EB0A 4BT5A 4O4HB 1NMUB 5FNVB 5ITZB 1X7OA 4E6EA 4I4TA 2FC3A 4NWOB 4C4WC 4O4LB 2GVIA 4I50A 3MQWA 2GZLA 4HNAB 3F0FA 2NMUA 2CZWA 2CHTA 5HY2A 3V7EA 1JD1A 3Q8HA 1X25A 2IQQA 2CW4A 5HY1A 1YQNA 1J7HA 4X3LA 3WGKA 1IV3A 1X52A 2HS3A 4PWTA 5IYZA 3V4DA 1PF5A 1R1MA 3DC2A 2CSLA 1KNKA 3VOBA 2AIZP 2B33A 1VQMF 3UT5B 1VHAA 1IV2A 3RYIA 5CB4B 1Q8RA 2OTMA 3TD4A 5IJ0A 4TZZA 3J7AR 3N2GB 3LMEA 5IT9M 4YJ3B 2V9YA 3I7TA 1YJNF 3HJWC 1XV2A 4I4TB 5FLXM 3HKEA 3V3TA 5HWEA 3VOAA 3P4EA 3M84A 3I3FA 1XHOA 4EB6A 5GAPK 3IMPA 5KX5A 3I55F 2VAWA 5HXZA 1QVFF 4C82A 4FFBA 4O4IA 4WBNA 1S72F 4I55B 3K12A 1CLIA 3I56F 3VYUC 3LWOC 1QD9A 2QTPA 4U3JB 2H8EA 3D00A 3RA5A 3SIVA 2YXZA 3KJJA 3WXMB 3S0HA 3WGLA 5C8YB 3CB2A 1XRGA 4O2BA 3RYIB 1JFFA 2BTUA 1RLGA
chains in the Genus database with same CATH topology
1VH8A 3P0ZA 4C8EA 1KNJA 3ERNA 3K2XA 3B6NA 1U3PA 3EORA 1GX1A 3ELCA 3K14A 3IEQA 1KNKA 1W55A 4C82A 3P10A 3FBAA 1VHAA 1IV2A 2AMTA 3GHZA 3IKFA 1W57A 3RE3A 3JVHA 1JY8A 3FPIA 2GZLA 3F0FA 1T0AA 2PMPA 4C81A 3F0EA 3IKEA 1H47A 1IV1A 3F6MA 1JN1A 1U43A 1U40A 3MBMA 4C8IA 3KE1A 3IEWA 3Q8HA 3QHDA 2UZHA 4C8GA 1YQNA 1U3LA 1H48A 3ESJA 3F0GA 3F0DA 3T80A 1IV3A 1IV4A 5B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH8 A;  3P0Z A;  4C8E A;  1KNJ A;  3ERN A;  3K2X A;  3B6N A;  1U3P A;  3EOR A;  1GX1 A;  3ELC A;  3K14 A;  3IEQ A;  1KNK A;  1W55 A;  4C82 A;  3P10 A;  3FBA A;  1VHA A;  1IV2 A;  2AMT A;  3GHZ A;  3IKF A;  1W57 A;  3RE3 A;  3JVH A;  1JY8 A;  3FPI A;  2GZL A;  3F0F A;  1T0A A;  2PMP A;  4C81 A;  3F0E A;  3IKE A;  1H47 A;  1IV1 A;  3F6M A;  1JN1 A;  1U43 A;  1U40 A;  3MBM A;  4C8I A;  3KE1 A;  3IEW A;  3Q8H A;  3QHD A;  2UZH A;  4C8G A;  1YQN A;  1U3L A;  1H48 A;  3ESJ A;  3F0G A;  3F0D A;  3T80 A;  1IV3 A;  1IV4 A;  5B8F A; 
#chains in the Genus database with same CATH topology
 1VH8 A;  1XBI A;  2Z1U A;  3CC4 F;  3EOR A;  1KQS F;  2HQS C;  5GON B;  3C9T A;  5A2Q M;  2FGY A;  2UYN A;  3P10 A;  5MN5 A;  1W57 A;  3JAL B;  5MN6 A;  3J80 M;  4EB6 B;  3QUW A;  3CPW F;  5JQG B;  4X20 A;  1ZWZ A;  3KJK A;  4O4J A;  1ONI A;  3MCQ A;  1Q86 H;  4O4I B;  3JCM M;  3E20 B;  5BMV B;  1VQL F;  1IV4 A;  3JAS A;  3HTN A;  2Z01 A;  1W5B A;  1W55 A;  1W3E X;  4DRX A;  4O2B B;  2AMT A;  3LWQ C;  1GO0 A;  5EYP A;  3CCS F;  1YJW F;  3CCV F;  2HX0 A;  3F0E A;  2WAL A;  4TUY B;  3CG6 A;  2VAP A;  3E22 B;  4IHJ A;  1QVG F;  4C8I A;  5G4V C;  1JJ2 F;  3QHD A;  3NK6 A;  1U3L A;  1Z5V A;  2Z1E A;  3PLA C;  1TUB B;  5IJ9 A;  2DYY A;  5J2T A;  3IEQ A;  4O4J B;  4ZOL B;  3RA6 A;  1M90 H;  1UI9 A;  2VGN A;  4ZK7 A;  4BT3 A;  3OBY A;  1W5A A;  4R40 B;  3JAS B;  3CXC F;  2ZAU A;  5EO3 A;  4TV8 A;  4X1K A;  3M1X A;  3VO8 A;  4XCQ A;  3IEW A;  1YGY A;  4C8G A;  3F0G A;  1FFX B;  1SA0 B;  4G4Y A;  4IIJ A;  5EZY B;  5EYP B;  2ZF8 A;  3JAK A;  1X7P A;  5JVD B;  2UYJ A;  3C9R A;  3O85 A;  1GX1 A;  2AIF A;  3WGJ A;  1K9M H;  4ZI7 A;  1W40 A;  3G4S F;  4IHJ B;  4BT7 A;  5J2U B;  3M4S A;  2OHW A;  3L7Q A;  2LBX A;  4RQO A;  3RYC B;  3JAR A;  2QI2 A;  4B46 A;  2F9Z C;  1YHQ F;  3HWU A;  5CA1 A;  5IJ9 B;  5J2T B;  1KC8 H;  2QEX F;  5LXT A;  1U40 A;  1T0K B;  3G71 F;  1COM A;  1VQ7 F;  1FSZ A;  2UZH A;  1VQ6 F;  4BVT A;  1ODE A;  5EWR A;  3VYS C;  4TV9 A;  2VXY A;  5LOV A;  2ZOV A;  5HXU A;  2Q1Y A;  4I50 B;  2RHO A;  5HY0 A;  1NQ3 A;  2DT4 A;  3KIZ A;  3HKB A;  2KTV A;  2CWJ A;  2CHS A;  3HKC A;  5HP7 A;  3FPI A;  4IIJ B;  1DT9 A;  3JAK B;  1T0A A;  3J81 M;  3CCE F;  1UFY A;  1OFU A;  5IYZ B;  1TVK A;  4EI8 A;  3F6M A;  5EB1 B;  3KE1 A;  3WPX A;  3VIU A;  3R0P A;  1W59 A;  3JAM M;  2HP3 A;  3JAR B;  4B5C A;  4G88 A;  2OTL F;  5IJ0 B;  3ERN A;  5LA6 A;  5HP8 A;  2Z1T A;  1RQ2 A;  5EIB D;  4NQ3 A;  4YJ2 A;  3HKD A;  1K8A H;  5JCO A;  1VQP F;  3CME F;  2YYE A;  5JCO C;  2BTO A;  3GTZ A;  1VQN F;  5LOV B;  3HKE B;  1W41 A;  5LP6 A;  3CCU F;  5LP6 C;  4BVQ A;  4X1I A;  3LWP C;  1NJI H;  1RQ7 A;  5KMG A;  1IV1 A;  1JN1 A;  3HKB B;  5KX5 B;  1E7K A;  4FFB B;  3WJP A;  5CA0 A;  4WBN B;  3CCL F;  3HKC B;  3ESJ A;  4ZHQ A;  1H48 A;  3IR9 A;  2KG4 A;  3DDN A;  3RYF A;  4BT4 A;  3VYT C;  2JNB A;  2P6Y A;  4BT2 A;  5EAZ A;  3C8L A;  2IAF A;  2UYK A;  4BVR A;  2H8C A;  1SDS A;  3MDO A;  5LYJ A;  3JAW A;  2RHL A;  5FJ4 C;  4ZHV A;  3IKF A;  1DBF A;  1Q7Y H;  1JY8 A;  4DXD A;  2CVL A;  1JFF B;  3WGM A;  3SIU A;  2UYP A;  2ZOD A;  3RYH A;  5LA6 B;  2RHJ A;  2HRU A;  3IKE A;  4LNU A;  5FNV A;  4ZHW A;  3CCQ F;  1YIJ F;  4YJ2 B;  3HKD B;  1H7M A;  2BTQ B;  2UYN B;  1CN7 A;  2R75 1;  1YI2 F;  3F0D A;  4HNA A;  3P0Z A;  3TD3 A;  5G4U C;  3OON A;  1Z5W A;  5AVM A;  3WPW A;  1GO1 A;  3S0Y A;  4X20 B;  3TD5 A;  4G4X A;  2QA4 F;  5EIB C;  1FNJ A;  3FBA A;  3MCA B;  3QTY A;  5HY4 A;  4ZHQ B;  3RE3 A;  3RYF B;  2K1S A;  3BYQ A;  2Q1X A;  3S03 A;  2HS0 A;  3CCM F;  2L26 A;  1VQ8 F;  3ZO8 A;  1W2B F;  3U0O A;  2Z1F A;  4LCK A;  4O2A A;  1CK2 A;  4X1Y A;  3GYQ A;  3UT5 A;  1PXW A;  3D01 A;  5LYJ B;  3JAW B;  5GAN K;  1VQV A;  2HP0 A;  4DRX B;  3E1Y A;  3K0T A;  2LCA A;  3LYB A;  4G4V A;  3AGK A;  4G4W A;  2VAM A;  3LFO A;  3CPQ A;  1VQ5 F;  3RYH B;  1RLU A;  4YJ3 A;  2H6L A;  4LNU B;  4ERH A;  1YJ9 F;  3VCZ A;  3GHZ A;  3CCR F;  2PHN A;  3N2K A;  2PMP A;  3CD6 F;  1VQK F;  3NK7 A;  4F6R A;  4RHA A;  4I55 A;  1OAP A;  3T80 A;  5GIN C;  4U3J A;  2G9I A;  3LDT A;  3HAX D;  3VI6 A;  1U3P A;  1FNK A;  4TV8 B;  1VQO F;  4X1K B;  3PAF A;  4BT6 A;  2HVY D;  4O2A B;  4X1Y B;  5C8Y A;  3NVI B;  2LBW A;  1N8R H;  3N4Y A;  3CMA F;  2HP0 B;  4ZOL A;  5GON A;  1VK3 A;  2HRY A;  5JH7 A;  3S02 A;  1H47 A;  1IPA A;  3NVK E;  4U39 A;  1VQ9 F;  4ZI7 B;  1YIT F;  3JAL A;  3FD5 A;  2KGW A;  2N48 A;  3N2K B;  1KD1 H;  5GIP C;  5JQG A;  3VMF B;  4C8E A;  3K2X A;  1W5E A;  2OTJ F;  2ZVY A;  2I6D A;  5CA1 B;  2R6R 1;  3K14 A;  3ZOP A;  1QU9 A;  4BY9 D;  3WJQ A;  4F6R B;  5LXT B;  1Q81 H;  5BMV A;  1SZQ A;  2EWC A;  5DCV A;  1QAH A;  1VQ4 F;  3WGN A;  4TV9 B;  3VTI C;  2GLZ A;  4NUT A;  3ZP4 A;  3JAT A;  3LWR C;  1W5F A;  2ZVZ A;  2RB9 A;  2I6R A;  4KWE A;  1K73 H;  5B8F A;  1KNJ A;  5JH7 B;  3ELC A;  4TUY A;  3E22 A;  2HS4 A;  1TVK B;  5MN4 A;  3CC2 F;  4EI9 A;  4BW0 B;  2OZB A;  3LWV C;  2LBT A;  4G4Z A;  3CC7 F;  3JVH A;  2KTU A;  3N4Z A;  1TUB A;  4B45 A;  2MQE A;  4X3M A;  3C9S A;  4ZHY B;  3C9U A;  1W58 1;  3CYQ A;  4O4H A;  1U43 A;  5ITZ A;  3OBW A;  3MBM A;  3ON1 A;  3KHN A;  3CYP B;  1W42 A;  4O4L A;  3V7Q A;  3OW2 F;  3CCJ F;  5LP6 B;  4M8I A;  4X1I B;  1Q82 H;  2VGM A;  3D54 A;  1GZ0 A;  5KMG B;  4EI7 A;  3JAT B;  1FFX A;  1RA4 A;  1SA0 A;  2BO1 A;  2W8B C;  5EZY A;  5CA0 B;  3NMU C;  5JVD A;  2ALE A;  3G6E F;  5GIO C;  4C81 A;  3S06 A;  3S0W A;  2RHH A;  3FD6 A;  5J2U A;  3RYC A;  3WJR A;  3ZP7 A;  5CB4 A;  4B62 A;  1M1K H;  4BVS A;  3N2G A;  2IG8 A;  3B6N A;  3FFM A;  5EB0 A;  4BT5 A;  4O4H B;  1NMU B;  5FNV B;  5ITZ B;  1X7O A;  4E6E A;  4I4T A;  2FC3 A;  4NWO B;  4C4W C;  4O4L B;  2GVI A;  4I50 A;  3MQW A;  2GZL A;  4HNA B;  3F0F A;  2NMU A;  2CZW A;  2CHT A;  5HY2 A;  3V7E A;  1JD1 A;  3Q8H A;  1X25 A;  2IQQ A;  2CW4 A;  5HY1 A;  1YQN A;  1J7H A;  4X3L A;  3WGK A;  1IV3 A;  1X52 A;  2HS3 A;  4PWT A;  5IYZ A;  3V4D A;  1PF5 A;  1R1M A;  3DC2 A;  2CSL A;  1KNK A;  3VOB A;  2AIZ P;  2B33 A;  1VQM F;  3UT5 B;  1VHA A;  1IV2 A;  3RYI A;  5CB4 B;  1Q8R A;  2OTM A;  3TD4 A;  5IJ0 A;  4TZZ A;  3J7A R;  3N2G B;  3LME A;  5IT9 M;  4YJ3 B;  2V9Y A;  3I7T A;  1YJN F;  3HJW C;  1XV2 A;  4I4T B;  5FLX M;  3HKE A;  3V3T A;  5HWE A;  3VOA A;  3P4E A;  3M84 A;  3I3F A;  1XHO A;  4EB6 A;  5GAP K;  3IMP A;  5KX5 A;  3I55 F;  2VAW A;  5HXZ A;  1QVF F;  4C82 A;  4FFB A;  4O4I A;  4WBN A;  1S72 F;  4I55 B;  3K12 A;  1CLI A;  3I56 F;  3VYU C;  3LWO C;  1QD9 A;  2QTP A;  4U3J B;  2H8E A;  3D00 A;  3RA5 A;  3SIV A;  2YXZ A;  3KJJ A;  3WXM B;  3S0H A;  3WGL A;  5C8Y B;  3CB2 A;  1XRG A;  4O2B A;  3RYI B;  1JFF A;  2BTU A;  1RLG A; 
#chains in the Genus database with same CATH homology
 1VH8 A;  3P0Z A;  4C8E A;  1KNJ A;  3ERN A;  3K2X A;  3B6N A;  1U3P A;  3EOR A;  1GX1 A;  3ELC A;  3K14 A;  3IEQ A;  1KNK A;  1W55 A;  4C82 A;  3P10 A;  3FBA A;  1VHA A;  1IV2 A;  2AMT A;  3GHZ A;  3IKF A;  1W57 A;  3RE3 A;  3JVH A;  1JY8 A;  3FPI A;  2GZL A;  3F0F A;  1T0A A;  2PMP A;  4C81 A;  3F0E A;  3IKE A;  1H47 A;  1IV1 A;  3F6M A;  1JN1 A;  1U43 A;  1U40 A;  3MBM A;  4C8I A;  3KE1 A;  3IEW A;  3Q8H A;  3QHD A;  2UZH A;  4C8G A;  1YQN A;  1U3L A;  1H48 A;  3ESJ A;  3F0G A;  3F0D A;  3T80 A;  1IV3 A;  1IV4 A;  5B8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...