4U39A

Crystal structure of ftsz:mciz complex from bacillus subtilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
294
Chain Sequence
SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIALDFADVKTIMKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 99
structure length 294
sequence length 302
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4u39A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4u39A01
3JARA 4O4LA 4I50A 4O2AA 4DXDA 4ZI7A 5CB4B 3RYIA 3E22A 4F6RA 2RHLA 2VAWA 3HKEB 1Z5WA 3HKDB 3JASA 4X1YB 4O4IB 4EI8A 4U3JA 4FFBB 5FNVA 5IJ9B 4M8IA 4DRXA 1RQ7A 4YJ2B 2BTQA 5EZYB 3RYHA 5C8YA 5MN4A 4TUYA 2RHJA 2XKAA 2R751 5CB4A 4X1KB 4I4TB 5BMVB 3HKEA 1TVKB 3HKDA 4X1YA 4O4IA 3N2GB 4FFBA 3UT5B 4HNAB 5IJ9A 4XCQA 1FFXB 4YJ2A 1Z5VA 5EZYA 5KX5B 3HKCB 4ZHQB 5KMGB 5LOVB 5LYJB 2RHOA 5JCOC 4X1KA 5ITZB 3JAWB 4I4TA 3VPAA 5BMVA 4EB6B 3ZBPA 1TVKA 4EI9A 4B45A 3N2GA 3UT5A 4HNAA 1FFXA 5KX5A 3HKCA 4ZHQA 5KMGA 5MN6A 2BTOA 5LXTB 5LOVA 1W5EA 5J2UB 5JCOA 2VAMA 3R4VA 5EIBC 5LYJA 5ITZA 4IHJB 3JAWA 3RYCB 4EB6A 4TV9B 5LA6B 3M89A 3CB2A 1W581 1W5FA 4X20B 3N2KB 4O4JB 5J2TB 4WBNB 5LXTA 5J2UA 2Q1YA 3HKBB 4LNUB 4IHJA 5C8YB 5CA1B 3WGNA 3RYCA 4TV9A 1W5BA 1RQ2A 3JAKB 5LA6A 1W5AA 3V3TA 4X20A 3JALB 5J2TA 3N2KA 4O4JA 5GONB 2R6R1 4WBNA 5JQGB 1W59A 3HKBA 4EI7A 4LNUA 5CA0B 4IIJB 3WGKA 2RHHA 4O2BB 5CA1A 5LP6B 3VO9A 3VOAA 5JVDB 5JH7B 3JAKA 5LP6C 5IJ0B 3VO8A 3M8KA 3JALA 5GONA 4I55B 1SA0B 1OFUA 1RLUA 5EIBD 2XKBA 4X1IB 4TV8B 5JQGA 4YJ3B 5CA0A 3RB8A 4IIJA 4ZOLB 4O2BA 3RYFB 5LP6A 5JH7A 1TUBB 5JVDA 3ZBQA 2VXYA 3JATB 5EYPB 5IJ0A 1JFFB 4I55A 1SA0A 5MN5A 3WGJA 4X1IA 4TV8A 4O4HB 5IYZB 4YJ3A 3WGLA 4E6EA 3ZIDA 4ZOLA 3VOBA 3RYFA 5M7EA 3JARB 4O4LB 1TUBA 2VAPA 4B46A 4I50B 4O2AB 3JATA 5EYPA 4ZI7B 3RYIB 1JFFA 3E22B 4F6RB 1FSZA 3JASB 2GVIA 4KWEA 4U3JB 4O4HA 5IYZA 5FNVB 4DRXB 2BTQB 3RYHB 4U39A 2Q1XA 3WGMA 3C8LA 4TUYB
chains in the Genus database with same CATH superfamily
3O4RA 4RM3A 3DMTA 2GJKA 4GMXA 5EJ7A 3MTBA 4DWOA 2FX5A 4ZGWA 4KSYA 2XUAA 4XLZA 1KTVA 4N0QA 3YASA 4OLBA 5FA5A 3CUYA 3I6QA 2FMKA 1EJBA 1U94A 1W2WB 1UK8A 4RANA 1XHOA 3MD0A 4QHYA 2DCMA 3U7QB 5FUWA 2QLLA 3NOOA 5GV8A 5DCYA 4Z99A 5ARDA 5KYYB 3T7KA 1A9RA 2W6ID 1QE3A 1QRRA 1X9IA 3HSKA 4J0IA 3ZCTA 3SXUB 3AM3A 4OHUA 4QJ3A 1X1QA 1OWPA 1ST2A 1YJWF 2CUNA 1TQ6A 4IVPA 3WLNA 3BAZA 1LS1A 1QLWA 1XTPA 1M2OB 1SUAA 2WJIA 2C2ZA 4BW0B 3IQHX 1X7ZB 4Z4EA 4XH9B 2AJ8A 5K6RA 2ECOA 2HC9A 5CM9C 4M9UA 1UINA 1Q12A 1UMBA 1UQTA 1VMKA 2MYPA 2QA4F 3I30X 3IAM6 3H5VA 4QGBA 3RJ9A 3SHWA 3TDMA 2ZB4A 1KAOA 3JQGB 2XQKA 3Q98A 5BN4B 3VI4B 2O54A 1V7QA 2IUFA 4JBHA 4MARA 2OTCA 3N87A 5DULA 4RORA 3JRNA 1M2KA 2WZDA 5AHXA 5BUCA 4ND8A 3H87A 3N75A 2WB4A 1PX2A 4JUIA 4MR8B 4QRDA 1BHO1 3I0NA 4KK4A 5HP8A 3T52A 1ODFA 3QUTA 2Q9AA 4LRXA 1JHYA 1K27A 2WINI 4OMDA 4DLNA 2ECKA 2WSMA 1H4QA 3HXLA 1P19A 3ZDYB 4O4HF 1K88A 4Y2GA 5E8RA 1EEXB 3JQBA 2WOJA 2MWMA 4HZIA 4YN3A 3KVRA 5C34B 1GTMA 3HXPA 4NCBA 2FP4B 4KBYA 3H0EA 3QIAA 1QFMA 4GPAA 4HUJA 4KQ6A 3ZCVA 1ADBA 3VC7A 5IW8A 3VDMA 4Z3KA 4F9FA 1GRVA 1M2JA 2R6ZA 1L7MA 2EJVA 5KJFA 2PSHA 1SUFA 3A1VA 1WD5A 1JX6A 4BX8A 4JUFA 4RVDA 1FU4A 5FWXA 4TRJA 4NULA 3TQCA 4ZC8A 3PWZA 5HMMA 1PD0A 5JAPA 4NIMA 1FY2A 4TUYF 5EUCA 3I6IA 1XPUA 3AOEA 1GGJA 5CA0B 3LFUA 5IJWA 1WQ4A 3EOZA 1S02A 2VATA 4L15A 4RF4A 4RYLA 5FFFA 1T2AA 4Y2HA 1PG0A 3ZGNA 4DAOA 5FUMA 5KKCA 1RC1A 5D7NA 1HBJA 1F1JA 3C5EA 5TPWA 4A6EA 2WB2A 1PZNA 4JDPA 3AVTA 1DKLA 1WUKS 1KWGA 3FDZA 4B6RA 4J0FA 5GIOE 2BN4A 4Q1VA 1RRVA 3BH6A 3FR7A 3UJDA 4TQAA 3LRPA 3DUWA 4B73A 1BE6A 1T8UA 3NVIB 5IZ4A 2W6JD 5DI3B 5PNTA 5BVGA 5IX8A 4Y98A 2P5UA 3IPLA 2VVTA 4E5VA 3OPVA 3V2UA 1CUYA 3H9QA 3QSGA 2PQ0A 2OV3A 2I6GA 4OFXA 3OMLA 3AP2A 2GCEA 3COSA 1DCMA 5MFZA 4B6GA 2UVQA 1EDEA 3UV3A 1KYVA 3IUQA 1S7CA 4WXPA 2DKOA 4KODA 4DLZA 2H11A 2J87A 1NY6A 1ODTC 2WJAA 1TT7A 1JEQA 2JI4A 2YWBA 3QKUA 3FFMA 4PR0A 3TRJA 3TIIA 4H1UA 4EYEA 1JZQA 2DBQA 2ZYUX 2CVHA 4K0RA 3VH4A 1CQJB 3TKLA 1Q7BA 5IYZA 1SKUA 1QH8A 3CWCA 3LX8A 3RUDA 2XLCA 5E3JA 2BTQB 2C9MA 3E35A 3DCIA 1OKKD 1QIKA 2MSCB 3SVTA 1PG5A 3L5KA 4MR9B 2IH5A 4W9RA 3L4BA 2Y2UA 1OZAA 2VJNA 1JFVA 2RFLA 2BKEA 1RI1A 1WSBA 2Q6LA 4KNYA 3IT2A 2YVLA 2YXBA 3VISA 1Q0RA 4KHPB 2GF0A 4Y9TA 5E4JA 5CEEA 1EYZA 3SBOA 3C8HA 1L4EA 4CL2A 3IKVA 3JCMM 3RADC 5K7SA 1QDLB 1M7HA 3OT5A 4UQOA 4CIDA 4KX5A 5ALLA 2QNIA 2CYCA 2FMXA 1WLSA 3L1KA 2JFFA 2QTGA 4QT4A 1JSZA 1E4YA 1LZLA 1KEWA 1ESCA 1XCLA 4ZTZB 5JYCA 2C9BA 2QDXA 3KETA 1O95C 2CL0X 3THWA 4IJWA 4QEDA 4KYIB 4X54A 4GEKA 4MRPA 4Q1DA 4EYOA 3ZY5A 3L7DA 2J0UB 3H1PA 3KHTA 1BXGB 4IPTA 3E5RA 2X0FA 3UZUA 3W5SA 2ZKIA 4IIEA 4OHWA 4ETNA 2GSWA 3F3YA 3L7LA 4C88A 1YT5A 2ZFUA 5L4NA 1SC9A 3OJFA 2PEYA 4O02B 2FWPA 2DFNA 3AL2A 3GJSA 4MYSA 1YVDA 3BD6A 1L4UA 1W36D 3LYUA 4TXHA 1H48A 5ILQA 5TDHA 4P5PA 4L8LA 1P2DA 1UBOS 2WHEA 3BERA 3CW8X 2FSGA 3KXKA 3LQQA 4IVQA 4RGYA 3WL6A 1G291 2VN8A 2VUHB 1NR1A 4EPWA 2XZTA 1BGWA 1D0VA 1XROA 4FMDF 5FV7A 3K2XA 2G04A 3GUCA 4AT1A 2XGSA 4EITA 3HFGA 1EE9A 2DSNA 3KPYA 3PC6A 4TXLA 1TU3A 3MMPA 4WZAE 3L0DA 3UJAA 1KVSA 1Z8DA 2FZEA 2Z6VA 1SBCA 1J2JA 2GZ3A 1Z18A 3OJWA 3M4YA 3FTPA 3NIFB 4L0CA 3L1IA 4LRWA 1EBFA 4RGVA 1FDVA 4Y6SA 3FWPA 1SG9A 4D44A 1E6LA 1XZIA 1RAEA 1DAPA 1IV2A 5E7MA 5C37A 3TL3A 4LDAA 2DFPA 2W93A 3WXMB 3ER8A 1F2DA 4BUJA 5HCIA 3O9MA 1Y8AA 5LZ5A 2GZMA 4A6PA 2DP4E 1G4AE 1U5BA 2X41A 3SNHA 3TOXA 4KR6A 3BXHA 1K4MA 3IBCA 4DMRA 3WP1B 1G8GA 1AXGA 3WGHA 3T95A 2FQXA 1Z4IA 5JI2E 1GKYA 4BAUA 3MHTA 3EWIA 4YBRA 1IU9A 2JCYA 1NI4B 3GAZA 4YP1A 5JBQA 2XE7A 2IUSA 3GLIA 2JK1A 2DX7A 4HX2A 3O8LA 2V7PA 4TLDA 4WT7A 4CDGA 5LDDC 5AIAA 3KRTA 5EXPA 5AVWA 1NASA 4YCCA 1J0XO 4RFSB 4QODA 5C35A 4DEVA 1ZM9A 4L3WA 4P84A 1QZ3A 2RKWA 4GAEA 4ZHVA 2FR0A 3VMFB 4QDTA 4X8LA 5DTMA 4ZDIA 4CF7A 3PAFA 2F64A 3QPWA 3WLTA 1RXYA 4CE6A 3ISVA 2JFPA 4DDUA 3HJFA 3VU0A 1O6BA 1NW7A 2DUUA 1DT3A 2E85A 4PCAA 3RRMA 5JS2A 5IKXA 3CGGA 3OCXA 4FKMA 4I5IA 3G4SF 1EK0A 2CHVA 3MTDA 1ZU4A 2FWMX 4YB8A 3SYKA 4LFBB 4JUCA 1MD9A 3P0HA 4DXDA 1X8JA 4UHBA 1OLOA 2FPGA 2Q5EA 5LD2C 2P40A 2RGNA 2REQA 5IJ9B 4NU0A 1RZUA 3C14C 3ZJ4A 5EKSA 3B89A 5C9ZA 5C8YA 3CIOA 5JQWA 3QBTA 1E3QA 1ISFA 2BFFB 2ZWOA 4HJRA 1ZGGA 2BF4A 5JAZA 3NMUF 2OV1A 4M1YA 5CB4A 1VECA 1Q0SA 4J7CA 3RTBA 2P35A 4DF3A 4Q5IA 2OAGA 3W9SA 3R0VA 4PZEA 1PDVA 4AJLA 2BV3A 5BQ5A 4FB5A 1FMCA 1U9IC 2I0FA 1P7VA 3HCEA 3WIDA 1ZH2A 3WPWA 2FPPB 1CF9A 4PLYA 3IDOA 4M54A 4YI3A 4CQJA 1DBPA 3LCMA 1Y1KE 3O8NA 1FSSA 2A57A 1OFTA 2CMGA 2GF9A 3MAAC 4JL8A 1PNTA 4ASUA 4J0CA 4FHGA 5AVYA 1K7XB 1B6GA 1HQDA 3ZBUA 4CCSA 4GP9A 2DBVO 4H6WA 4D6PA 4DMFA 1E2BA 2P2NA 3LWZA 1AC5A 1SKYB 2R25B 2YVUA 3IHKA 4RLQA 3WYNA 1C3XA 3UICA 5GINE 2BEVA 5LYJA 2OFPA 4Q4HB 4EG1A 3L0OA 3CC7F 1ISIA 3CH5A 2ZJOA 3FH0A 3MT9A 3PA8A 1YNSA 1PGOA 1YZFA 3KR1A 4L7QA 3V7WA 4HX5A 3ZY4A 1Q84A 3QFFA 4FJ1A 3NIBA 4DDHA 5A03A 2QNRA 2EDAA 2ZRMA 1PK7A 3G0CA 4ICIA 5KNCD 4B84A 1P2SA 1GVNB 2W2KB 2C2OA 3GEPA 4NONA 1E6EA 3T7JA 2XD9A 4LXUA 3VDRA 2WTEA 2PUBA 2FVXA 4NY1A 4DZTA 1UC5B 2NPOA 1E1CA 4V03A 3V4VB 1U7UA 3KTFA 4JENA 3RVRA 3D8BA 4E07A 5J4LA 1IAQA 2NV0A 1TJ3A 5HKKD 2GEDA 1DWUA 1R4ZA 1D7OA 1NMXA 2I4LA 1J9EA 3EUWA 4OQPA 2DPYA 1CZKA 3WXBA 1FQKA 2E3JA 3TQRA 1GNQA 3IODA 3FZNA 3IXMA 3AF2A 5CA1A 1E3MA 2VGMA 2WC1A 2BUAA 3D6FA 1Q3TA 3RG8A 1QH9A 3DWFA 1VB3A 1HZZA 1CF4A 3GMTA 1GY8A 5K5EA 2E4UA 4UD2A 3ZU5A 1FUKA 5CBKA 1JHAA 5CM8B 3M5CA 3FPFA 3TZ6A 2VNKA 3WAJA 1PNOA 1GSAA 3AERB 3ILXA 3MCUA 1J5XA 2W6ZA 3SSNA 1IEXA 1MQ9A 3EC1A 3HVKA 4I99A 1OC2A 1JR6A 5EQFA 4WLUA 4U2BA 1PSZA 4KPGA 1JKXA 3OBIA 1NIJA 2FUG6 1KWKA 3AM4A 1UI9A 1Z6AA 4PRKA 4I1SA 5J58A 4KZPA 1SBNE 4E5UA 3ETNA 3H05A 2BEUA 4YYEA 5AVKA 4EG3A 4YR9A 1Z8HA 2PT5A 1VSUA 1T2CA 2A9OA 5CHYA 3TOZA 3ORYA 3QW2A 3ZI4A 4V1CA 3ZV6A 4TPKA 3EAGA 2ODPA 3O90A 2YASA 3OAAD 3HFJA 4QBKA 4NCNA 4IJUA 5IJAA 1FDSA 2P0YA 5AVSA 1Q14A 1ZVVA 1X3LA 2XSZD 3AGKA 2CBXA 1DEXA 2O8BB 1FOEB 1DELA 2XGOA 5F3RA 3GLFA 5KC8A 1JI0A 4BP3A 1XAGA 5MF6A 3K9FC 3BXPA 1RXSA 1VYHA 2V0NA 1EDOA 2IEGA 1BCSA 4JYBA 4MKZA 1UOQA 3M6MD 4RK5A 4QBGB 3F49S 3AEKB 3JYPA 3RYHA 2DG2A 1QCDA 3C1UA 3UJCA 3EX7C 5KTSA 3G6WA 3CH7A 4OQNA 5M2QA 3ZVNA 1SURA 2R751 1QHGA 2AB0A 3EN0A 3GRCA 2PWAA 4X1KB 4KTVE 3NTUA 2CWWA 3ZWNA 1CZHA 1T5BA 2R6DA 2XMGA 4FGWA 5ED4A 1LLQA 1IY2A 4DY6A 3H2GA 3H7IA 1HK7A 1D2AA 1WKCA 2CVFA 1C9EA 3FCCA 4FSDA 1W25A 4RD1A 3QSYA 1SUBA 3H1FA 1QPGA 3V7UA 3WLJA 2KB0A 2SHKA 3E7XA 5KB3A 2JLYA 4HWTA 5I47A 1NY5A 3D1VA 4AG6A 9ATCA 4Y6OA 2HAEA 2C7PA 3K0SA 3W2GA 4B87A 1V1MB 1MV8A 1EB9A 2C3YA 4DNOA 1DMRA 1M3SA 1R9NA 4FIDA 5TQ2A 3UT5A 8OHMA 2G70A 3W04A 5IDXA 1GPYA 2NADA 4DARA 3QXXA 4X85A 3ZLJA 2C4KA 3DZFA 3TEJA 3QG1A 4IM7A 2B1IA 4IMIB 4R9VA 1TTQB 5HZGA 4Q93A 3MJTA 1J0DA 3H2IA 5EB0A 3I9LA 5D3QA 2V65A 3WYFA 3A2LA 1S3IA 4CLOB 4HVLA 1ZCAA 2H7YA 2NO6A 3DBRA 4MQUA 5IRCD 3RQSA 5ALPA 2AC4A 2RI6A 4G4SP 2HHHB 2YFKA 1F8UA 2PNFA 4LDRA 3SXPA 3RRXA 2WTAA 3P9XA 4ER0A 1HQKA 2AG6A 2HQSA 4MQEB 3QJGA 4NZNA 1I10A 3WA6A 2VRCA 4R05A 4Q4JA 3EVCA 5I8ZA 3RJMA 4KVZA 4BCBA 2AOXA 5B53A 1GZ3A 5EZQA 3ZD7A 2J46A 3DEKA 2O8DB 4JP5A 1IK6A 2JGKA 3PQ8A 4UJ3A 5FO1A 1ZX1A 1HUQA 1U5AA 3CNEA 2ZRFA 4II2A 3TBFA 1K7SN 3V00A 3KJKA 3VJLA 2NU7B 3FB1A 1UPFA 4YP5A 1N2HA 3CF6R 4J16C 4ZOCA 2VXOA 4F3CA 4LDPA 4F7DA 1C29B 3WK4A 3W3AH 1A4RA 3FYTA 1GRCA 2P9JA 2V6JA 1E6MA 1NBMD 4UTNA 2BW0A 1L2TA 3BK7A 3IILA 4S12A 3WY9A 1NXVA 1HYGA 3NBXX 4KW7A 2QLBA 2VF8A 1X7WA 1DZIA 1KKLA 2XYVA 1GUZA 2I1QA 3RIHA 2J85A 1RC0A 1FW8A 2HLHA 4I5GA 1UDXA 1AA9A 3EIEA 3MWYW 3P4YA 4XD7A 4BBPA 5JHHB 4MWCA 1AQIA 1IZYA 5COQA 4R8KA 3SDBA 5KX5F 1OFHA 2V7QD 2ONJA 3FUCA 5A4KA 4R9RA 1E3IA 1U4OA 1C3OB 1KQOA 2O1XA 3I0MA 3PNQA 3FD8A 4LXQA 4U5QA 1IWPB 1FYFA 2Q4BA 1Y3AA 2QAGC 3OPYI 5BT8A 4E5PA 2Y27A 3TN7A 4DABA 3WB9A 7AT1A 3KJJA 2ZRAA 1YMUA 4E08A 1KYIA 2YL2A 1EVIA 3R6DA 2P6NA 2CJWA 4YT5A 1Z0FA 1VRVA 3L7CA 2VNJA 3SJBA 4ZHSA 5HKOA 5I4IA 1CETA 2EW1A 1Y4DE 3GRVA 4K9PA 5A4MS 1MH9A 2AF3C 1KMMA 2V6MA 4QXQA 5GV7A 4DTCA 3AM5A 2QY6A 4I9FA 5CDYA 1XYYA 5LD2B 5AW2A 4H27A 2M9MA 3CJRA 1Q22A 2BFDB 3MT7A 1QS0B 3HDVA 3P7MA 4KO1S 4CQMB 4Q82A 5K8UA 1B1CA 2R6CA 2GPTA 4P81A 3FBGA 4WASA 4LY9A 1V8DA 3KOMA 3ORRA 4X71A 3AYXB 3KEOA 3QW4B 3WMRA 3SWWA 4D9CA 1OWNA 4FCWA 4N0MA 5BNZA 1AU9A 1HDXA 4YR7A 2W2NA 1DAIA 1Q95A 5TT0A 4ECEA 3OFND 3GLSA 3B36A 3DV0B 3MXTA 4IXNA 4IQ4A 4XQ0A 4YFVA 3IBYA 3HU5A 1E8NA 4RCVA 2VPTA 3CH6A 3MRTA 1IJKA 1YB4A 2O8VA 5HCUA 3TTVA 3QG5A 4TRNA 4BN4A 5CD9A 4HYYA 1USWA 3L7AA 3F3SA 5DGDA 4RKFA 1PVDA 1ZONA 3ADPA 5GOZA 4YXWA 5H3CA 2D7DA 1E0AA 5F2EA 1XVLA 2UDPA 3U4QA 4EHLA 1SVIA 1LPNA 4YRSA 2IS2A 1Z5OA 3IEWA 2CHGA 4IIDA 3SQMA 1MFPA 3V1YA 3BWVA 1CDDA 3I5YA 3DB1A 1ZL2A 3FPBA 5BWOA 4K9OA 2H4WA 4A73A 3KE8A 4OHKA 4AJ1A 3GJXC 4DYDA 2WJWA 3EIFA 4OQYA 2EGUA 3M1AA 4LRUA 1AJEA 1P3Y1 1Y0BA 4PQRA 4BWVA 5IJXA 3EGXB 2WALA 4DA9A 1O1YA 1P73A 3N58A 4C87A 1PJ4A 2G9IA 1X1EA 3WPXA 3CSDA 4G5RA 1J2TA 4ZPXA 2H8CA 3V55A 4B6SA 3EPJA 2SKEA 3HB5X 1NF9A 1Q1BA 5F1OA 3X1MA 4FGLA 1G20B 2JAOA 5K0LA 3ZXSA 3RVOA 3B70A 3DE7X 3KDAA 3QXJA 2H9AA 4TLEA 1SKAA 1OFUX 2EJTA 4ZT5A 1YZ3A 3DBLA 4JAVC 3UATA 2GBCA 2G7ZA 1XPJA 5JATA 2DHQA 1UJNA 3G8CA 4HLCA 4UMVA 3U3DA 4V0NA 4MYTA 4LGMA 5B6IA 4MP3A 3A6JA 1CUJA 4WNAB 2QRNA 4ZO6A 1WF6A 4FDTA 4R83A 2PDAA 4C0SA 3LG2A 1CE8B 1ECFA 2WHQA 4G3XA 3RV4A 4U9UA 4IGAA 4IIJB 3H7AA 3DDSA 3FUUA 1UP4A 2HWYA 5BOSB 1K7FB 3PX2A 1AMOA 3G9UA 3IKFA 2OBMA 3C3XA 3KVNA 3PUXA 4HB0A 2JNBA 1IG0A 4YONB 4D3XA 3WTBA 3VTIC 4MV5A 1BDJA 3FYUA 2UYCA 2ZYSA 3GPDG 1JU4A 1V16A 2GMWA 3ILSA 2D0DA 1V9SA 3L8CA 1QFXA 3UK0A 1Y81A 4NHEA 3AOGA 4C1NA 1C7EA 1RHMA 4X3PA 1OXBB 3DVAB 2OA0A 5EZ5A 4M1SA 1Y4SA 4EY5A 3EBLA 3JQ9A 1U8AA 3LDFA 1J8DA 1V7PC 2PVSA 4XQEA 3HZRA 2LCQA 2KTUA 2GFHA 3AVWA 5KO2A 1GG9A 2G7MC 3C6KA 3ND6A 2OXFA 1RRFA 1UBHS 1NPTO 3EF0A 4KFSA 3L0IB 4ZGGA 5CDFE 1PYDA 1Z38A 3FTEA 4OGWA 1EB8A 3K35A 4KRGA 4LOLA 2J9YB 2Y93A 3CFYA 3UJBA 1RAAA 4ARBA 2G36A 4RK0A 2X8JA 4FFOA 3VPFA 2RAFA 1IN5A 3A27A 3R6WA 3K0BA 3QKIA 4HCJA 1VJ5A 1SU6A 4NX2A 4UARA 4IINA 1DNPA 3DTVA 5ICSA 2BEJA 2EKBA 1BDHA 5K0GA 1FE8A 2JEZA 3WSWA 1E4EA 2RJOA 4YFYA 3T3IA 1FUEA 3JQPA 5IC6A 1YRWA 4BO4A 2J0EA 5CFZA 3OQVA 3QENA 5JJKA 2ZR0A 3H3JA 1K4KA 1K7CA 1U7XA 3RI3A 3A1DA 3C7TA 2NVUA 4XYMA 4D92A 2X2OA 1MN6A 1T8TA 3DT6A 5CT9A 2CSLA 1LCIA 2DR3A 3TW8A 1O9GA 4BB9A 1JXOA 4MA4A 3FVWA 1CK4A 2AIFA 2B69A 1D03A 4FLMA 3C5VA 1RWWA 3WFJA 4XZ3A 3O4HA 4DMGA 2PKRA 3EXFA 1SCKA 1CR2A 3PHHA 3AUKA 3LBIA 4KAJA 521PA 5AJYA 3RUAA 1EGAA 1LV7A 3Q9NA 1LW7A 4KVGA 3TLAA 2ORIA 3OTWA 3LDTA 4F92B 1FX0A 3L7YA 3DV9A 1FDWA 1G7RA 4K1LA 1RJFA 1CTQA 3R3VA 5K8VA 2XXAB 1Q74A 4RD0A 3FUVA 5C51B 3T34A 5DOVA 2G5TA 3RIXA 3ZHUA 1RI5A 3QQPA 1HT0A 4HXYA 2DSTA 2X9LA 3ZWAA 3AUYA 4RA6B 4PSCA 2DERA 2Y6VA 1XRGA 1W5EA 1G5QA 2PZBA 5L6LB 1KJNA 4G4VA 4A4DA 2J3MA 1G2OA 1BYUA 1TFUA 2JFWA 5HRUA 1RTKA 1YB5A 4NFHA 3KL2A 4L73A 4YYZA 2RI1A 4LWPA 2IE8A 5K4GA 1UF9A 3D6TB 5AK3A 1QIMA 3EZXA 4M53A 3DD5A 5JJIA 1YJBA 4O4JB 1Q7EA 2C88A 4OV6B 1GLGA 4XRRA 5L40A 2AQ8A 4QLOA 1E1NA 3CZMA 1VG1A 1Z29A 3E03A 5F9HA 4WVFA 2EBHX 2DM6A 4IHJA 4NEHB 4HT3B 1B23P 3GEGA 4HNRA 1T35A 4KH0A 1I7NA 2PUDA 1P2FA 4IV0A 1FJXA 3OE5A 4CBVA 1JNYA 3D4IA 1QVGF 4W7HA 5G3YA 2YZMA 4X90A 4OO3A 1Z47A 2D8MA 2VQSA 3SZGA 3BXFA 1LK7A 2XCUA 3LVBA 3A9RA 3WQHA 4OGGA 1EGMB 1J8MF 3K6SA 3VKHA 5CLFA 4Z0TA 2VDOB 2VJDA 5P8WA 4DCTA 2YRWA 3GZNA 2FX2A 3KNZA 1OA1A 2Z4RA 2ODBA 4YJ2F 5EL0A 1CUSA 2OOSA 2WD7B 5A6SB 1QYXA 4KCGA 3IALA 2FCRA 4C0HA 2ZM5A 3PSAA 2IDMA 3AB3A 4R1UA 5KYUB 3U5ZB 3A28A 2JIZA 3ZLVA 2CNBA 2GN8A 2VUIB 3DWEX 1T1EA 4OSEA 4OLHA 3ZXXA 1YDFA 1LX7A 1UM9B 3S40A 4Y18A 1ZN2A 1YIJF 4MV3A 2XZPA 3EFOA 2ZJ4A 1A97A 2CNOA 2CLMB 1C1XB 1V6CA 1M10A 1XU9A 3DFKA 1DBWA 3W2TA 3FGPA 4RJIA 4M9XA 3WIVA 4ZYTA 5LOVF 3PXEA 5J4YA 2QAGB 2YINC 3GJQA 1P18A 2QT9A 3PJGA 4ITUA 1WHTA 3LP8A 1RC8A 5AR1A 4UE6A 1DRWA 2PQ6A 3QU9A 4QL3A 3C7CB 4G1MB 3EG9B 2NVOA 1DOZA 1SK9A 4ETMA 4GXQA 3KX2A 1W57A 3OZSA 3HJNA 4DPLA 4BNUA 3VO1A 1LPSA 4K9QA 4N47A 1DLIA 1NFQA 4KSCA 1KFKB 3RF7A 2FYTA 4A9AA 1YQUA 2VTBB 3NIGB 2GR9A 3I1IA 5A6VA 5A9SB 2M6KA 3HWX1 3GNTA 2W4MA 4DW8A 5JT1A 1K7EB 3Q4GA 3SSMA 4BO0A 4OLFA 3AUXA 3G2NA 3TINA 4BO3A 1TRHA 5A05A 4EY6A 4Z5XA 1I3NA 3S99A 3TSCA 2EATA 5BPHA 2MR6A 3A1FA 4JJGA 4P4GA 1R6UA 3X2SA 2GK7A 1FYVA 4GECA 2CDNA 1I8TA 3H2KA 3OZAA 3QUAA 4IFBA 3D5EA 1SC4A 3QEAZ 3RU9A 2N47A 3HWRA 4XUDA 4NCHA 1XD2A 4D80A 1YK1A 4D9BA 3SQWA 1F8GA 2G1AA 2DH5A 1IN1A 2YHAA 3G1TA 4AI6A 3KM0A 3QFSA 4MQFB 4BVBA 1FP4A 3X1KA 4PLTA 2MU1A 2WQZA 5K8JB 2WA1A 2P65A 3PHLA 5CW1A 4ZV4A 1N3BA 3RE3A 4P58A 1CG6A 4M1MA 3THOA 3NBZC 2WTBA 5IT9M 3UT6A 2FU5C 2J4FA 3NGXA 1OBCA 4B45A 4FYVA 5JCJD 4JB0A 4GDFA 4TYYA 1AKUA 1V9CA 4R9UC 4GC5A 3E3LA 1PTJA 3AZPA 4C2TA 4J9UE 1CJVC 5FUXA 4ZZ3A 1JEOA 5EIBC 1C4OA 3R4VA 4UCWA 3ROKA 2PYZA 5IXJA 2HOQA 3PFGA 3USZA 1BDBA 2X77A 1SQGA 2G08A 2G88A 2GPJA 2OQ2A 3F8WA 2QQFA 4HAVA 2G9NA 1M2EA 3EVEA 2QX6A 4GM0A 4WX2B 1SBIA 4KO4S 1KBOA 4LHYA 5CB6A 3UN1A 3JQDA 4UHJA 5AM1A 5G40A 4DYVA 4RY0A 3MAJA 3GDOA 5LBTA 3WNCA 1ZOLA 1FZTA 4M38A 2CVPA 1W52X 4IP0A 4JVLA 2XXBA 1U2DC 2VCEA 3ESBA 3K0CA 2NU6B 4NBVA 4Y8VA 5DT9A 5H82A 5FFNA 3ZY3A 4ASUD 1X52A 1G0NA 1U1FA 2XT6A 2GPBA 3I34X 3I62A 1C0EA 1GDHA 1L7BA 4WBNA 2GEFA 4FCCA 4HSEA 4MJ7A 4RHEA 4C3OB 3CXRA 1NF8A 1OD6A 4RSMA 4MYDA 4HNSA 4PHCA 1FPQA 2CXQA 4L5BA 1H5NA 5AICA 3W05A 4QG3A 3WGKA 2ADOA 2DQ4A 3QVXA 3OZIA 5HFAA 4JCCA 2XI4A 3ZJYA 3B9RA 5C7OO 2J5XA 2BBWA 1E77A 2SCUB 2LBPA 4ITVA 2OV4A 1QK5A 1FXWA 1PJSA 1Y82A 3E9EA 3EQZA 3SCZA 1VHQA 4LQ4A 4EVQA 5JADA 1KZ1A 2HQRA 4FS8A 5CNJA 2A92A 2B1GA 3T5DA 1VCNA 3UMMA 4WUVA 4M86A 2OM2A 2OYCA 2BH2A 5BXYA 5JSUA 2K87A 4B6QA 2W8BA 5HQTA 1OAOC 4WADA 4JY7A 1HT2E 1ZD8A 4ZARA 4I55A 2VDLB 3RC8A 4PLWA 1U3WA 1CS0B 1V2GA 1H2HA 1LD3A 2NUPB 2R87A 2PZJA 3CLRC 3FLMA 4IF6A 5K3FA 1G55A 4BFYA 4DB2A 3CXUA 3VPCA 4WPGA 2XWSA 3S6JA 2LXNA 2W00A 2QMYA 2YNMA 4JJ6A 3LPNA 4FCVA 3CKLA 5J1TB 4GYWA 4OAPA 4WEOA 4YRCA 3EGDB 3U0VA 2G40A 1NXWA 4YDQA 1WB6A 2BEWB 5LXTF 1OLXA 3KZ1E 3Q7QA 1JJBA 2E5FA 4GXTA 2ATEA 2ES4A 1AVTA 4X94A 4BMCA 1YTLA 1JMVA 1AHIA 3LUGA 2Y4OA 3HBNA 4OGLA 1NV8A 2G71A 3BXOA 3OSZA 3SGLA 4Z54A 1P5HA 2ON6A 3DAHA 3TNDA 5FOSA 4DANA 1I4WA 2RAUA 5SYMA 2OKGA 4B2IA 1KK0A 3PEWA 1J5PA 1C9MA 4ED9A 4BZZA 4C4TA 3JV7A 4GOXA 4BU0A 2V8BA 4JMPA 4BVTA 2J8ZA 2NUBA 4OCZA 4PSKA 3SSOA 1X15A 1YB7A 2I6QA 2B92A 5JARA 4ENVA 4HQLA 4UD6A 3KQUA 3Q7EA 3HS3A 1Q2UA 4K2AA 3BXXA 3R6LA 5AI0A 1XA0A 2PUJA 3SD7A 2IUYA 4C43A 2PGOA 3IPYA 1B16A 4NJMA 3WJ2A 1G21B 3I04A 5BWCA 4U2FA 3OCZA 1P29A 1VKNA 1U8UA 2X5XA 4MZDA 3QPBA 5IF9A 3I72A 5CH3A 1ZGAA 2NO9A 3QMPA 5D7BA 1WDLA 1US8A 3Q40A 1NRJB 1Y3FE 2AF4C 2AQKA 4MEAA 2E4VA 2PV7A 3ZU2A 4AROA 2WJ3A 3WJ7A 2WR8A 3TRDA 3VR6A 5ICMA 5SZHB 1XZNA 2LDXA 2YMMA 2R1TA 3JQ7A 3OIUA 3U4CA 1OQAA 2HXYA 2YN2A 2UYQA 3I2KA 2C9DA 1IBRA 2K7ZA 4DMCA 3STTA 5DHQA 2Q5JA 1FRZA 1YHYA 3N3AC 4MO2A 3V4SA 3FTQA 5TIIA 1PJLA 1MB2A 2I8AA 3I01M 3WRXA 2K1SA 4QTUB 3ANLA 3BCHA 4I8IA 4KQFA 4TROA 5FJIA 4F60A 2R1VB 1UKAA 3P96A 3HCFA 1D1TA 4KFRA 4NR0A 4JT4A 3ZNPA 1Z0DA 2ZRHA 4UM9D 5KPJA 3QJYA 3FE2A 1P1HA 4QYTA 4G9GA 2GDJA 3LUHA 3DBHA 1CRLA 2B78A 2COUA 4OTZA 2IKSA 3PVCA 2CBZA 1MUUA 2YR0A 2ZROA 3GUVA 1UBLS 3SJ7A 2D59A 4B62A 2PKWA 4Y2UA 1TYEB 3LA6A 4JBLA 5ICEA 4CM4B 4KO8A 3QWAA 3P0RA 4LBZA 1Z5UA 1DQSA 2H7XA 2DQSA 4YLYA 1P2TA 2ZJFA 3H83A 4W7IA 1IH8A 2OHGA 2XKBA 5D86A 2G1UA 4WWHA 1L5KA 1OAKA 4ZQCB 1WVMA 1Z4PX 1JSRA 3ZQUA 4CJXA 1H2WA 4FHZA 1QRDA 2VRCD 4CLRA 2B1RA 4DXAA 3EVBA 3C24A 5IJ0A 2A14A 2FZLA 2G1KA 3L41A 4B71A 5CT5A 4C29A 1CQZA 3SZRA 4E46A 1DKOA 5HR5A 1XD9A 1KZ6A 4EEKA 3CEPB 4ZALA 1UEXC 2IXGA 4EG6A 5J63A 2ZCJA 1WDWB 4L27A 4N8EA 3FW1A 1FUUA 2G9QA 2XE8A 2XF8A 1C7FA 4C0KA 2ZTLA 2W48A 3U48A 3QY9A 4PWYA 1EGVB 3IUEA 3AEXA 4KPEC 2NNWB 1NRIA 3RABA 3U44B 3GA0A 4EKIA 3WWCA 5A3RA 3CCMF 3Q88A 3I3OA 1AGRA 3GGOA 3EORA 4M0KA 5FLKA 4BECA 4MP6A 5A5GA 1IWBB 3CINA 5JZBA 2QTVA 4E5NA 4XD7D 1L4BA 1SUDA 2LP4Y 4G8CA 1AXEA 4X45A 4ZT6A 2VOJA 3D64A 4D9IA 2ZWMA 2XEXA 3WOHA 1GP2A 2RE8A 4LF6B 5B7GA 2I6TA 4G4WA 1C30B 2A94A 2H54A 3B3AA 1IPEA 3DDCA 3EF1A 1R18A 4BU1A 4ZMSA 1J56A 2D7JA 3K2QA 1YULA 2OPBA 2JLAA 4NE9A 4YQFA 2VPZA 3B1JA 4F46A 1FX1A 1SK8A 3F1KA 3OJLA 3H2ZA 4ACAA 1OBVA 3LC0A 3COPA 2DU8A 4LOKA 4LXXA 4E22A 2XMBA 2JBAA 3L7BA 1YR7A 3ZDCA 1JJIA 2OBFA 4KQWA 3D59A 3RFFA 3NWPA 4LRTB 1OV4A 1IQPA 3FDIA 3FVTA 1ZD3A 1CCWA 2K6GA 2XF2A 3EZ9A 1HEUA 4UATA 1UPAA 4ZT2A 3ZE6A 1EHYA 4CI0B 5H68A 2Y9PB 1PO7A 2IXDA 3OBBA 4MUYA 4YJ3F 1Z37A 3U4DA 2JHGA 3FMFA 2ZB8A 2PS3A 2EGGA 1ENZA 3K0HA 5L53A 1CXZA 1T5LA 3H5WA 3SSAA 3LZDA 4RTKA 2JVJA 4QU5A 4Y7DA 2CLIB 2HGSA 3GK3A 5TMDA 3TBKA 3T41A 4K03A 4YNBA 4WL0A 2OESA 4OBXA 2CLOB 4K9LA 4HO1X 3X1DA 4UUQA 3LUFA 4YXWD 4EW2A 1LQTA 4X3CA 1FNNA 3B6NA 2WKPA 3GF4A 3Q8KA 5I3ZA 3I9NA 1W19A 1N9GA 2GBPA 2NZ8A 4FKZA 4ZT4A 4GPEA 2WDZA 3JU3A 4LZWA 2ZBUA 1XL0A 1U2GC 2I7CA 2XW6A 1QIEA 3EA0A 4KWTA 2F48A 3GV0A 1VK3A 1G5PA 3MMXA 4UHHA 1CY0A 4GR4A 3INGA 5BSFA 3LH5A 2V59A 2B20A 2ERCA 5CFMA 2ZZMA 1II8A 3PU6A 4G0NA 2CUKA 3V7NA 5MGBA 4FTWA 1OA0A 2AIRA 1EAYA 2JKZA 3N2LA 4TLBA 4PYJA 5BORA 1S7GA 1XUOA 2A33A 5FWNA 3BQ9A 4MROA 4A15A 5B55A 1AGXA 4L3OA 4B75A 1ECBA 3BXEA 3BGDA 1QB8A 1NQVA 1U7ZA 2R11A 4L9RA 4OBBA 3MCVA 7YASA 1E2PA 2FGKA 4HPWA 2LDBA 2EW2A 2QWXA 5B8FA 2DHRA 2B8WA 2H4JA 3DV2A 5LNK1 3VU8A 2W22A 2BGLA 3BFXA 1NXXA 3CKMA 2WWRA 2XCSB 2AUTA 1QFZA 2ZUVA 2OD2A 1VE1A 1UXJA 3ITNA 4YI5A 5FPYA 3SIWA 4F4UA 2PKEA 1MOSA 2WG0A 3B48A 3QEMA 3VJMA 1JEYA 1Y63A 3NFYA 5CITA 3UWKA 1A9YA 1B14A 3NEJA 3SS7X 1LDGA 4AO8A 4V3BA 1A9TA 4WESB 4D42A 2IC5A 2VF4X 3MPUA 1C0LA 2ZR8A 4Q7JB 3BRWA 1JS1X 3DVRX 4II3A 3NW9A 5ARCA 3A3OA 3JCZA 3COWA 5DLEA 2FWIA 2C1XA 1PZHA 2VPPA 3N9IA 1O6GA 2D6FA 3ZWWA 5AHRA 5ELMA 4QPZA 3WTCA 1UCFA 1V96A 2DTDA 3DL4A 3FOCA 4MKIA 2P1RA 4Y7CA 1KERA 2PKQO 3C4JA 1Z13A 1KYZA 1RAIA 2DPGA 3OUZA 4D98A 5LQUA 4C4WC 2XVZA 3A1WA 5C2JB 3PL5A 4NYIQ 1LNSA 2HF8A 5JI3E 4LXGA 2C3UA 1X1DA 2ZIEA 4YMWA 1XCPA 2SKCA 3C7AA 3QGMA 4L5CA 1DJNA 2O1SA 4TTRA 5T4HA 4YRNA 1XRQA 5E6UB 2GZ1A 2QN6A 1PR6A 3GQVA 5KSYA 1U7WA 1HYBA 2L17A 3W6NA 4I4IA 3W2EA 9LDBA 3HJGA 4RIFA 4M21A 1N2ZA 3NHMA 4OHVA 3QLTA 1UADA 2RC6A 4H6XA 1CV2A 4IUDS 4XCXA 4EF6A 2OT3B 3DTVD 2O57A 4EG8A 3I45A 4I4LA 4YJHB 2ZYRA 4J2HA 4EB0A 5JNLA 2XRZA 2PEZA 4C04A 4K5QA 1X7XA 4RSHA 2EXXA 4DLAA 1X7GA 1VMEA 1UAGA 3CT6A 5HK9A 4Z4IA 1FTQA 5FIUA 5A4JA 1UMDA 3NT5A 5CAEA 1XNRB 1G41A 1ZJZA 2DBRA 1VHWA 2Q7XA 2LW7A 2PMFA 1AKNA 5J4KA 3AEUB 3VI6A 1IXKA 2CMKA 3I4LA 5J2UB 1IHPA 3KKOA 3M34A 4MOWA 2R7AA 4HDRB 4MW0A 1BSVA 1AM4D 1DCKA 1OJ7A 5G0WA 2HFKA 1BJTA 1P75A 4QHSA 1K75A 4EPVA 2OFWA 1R9JA 1ES9A 4PCUA 3KUKA 5DDIP 4AAYA 6REQA 4PFJA 4IJ6A 3GT0A 2HX1A 3HEAA 5L4LA 3HKBB 3Q2IA 2Z5GA 3IBFA 4JQYA 4LWQA 3FCXA 4LVNA 4PNPA 3HMQA 1GQSA 5K3BA 1BW9B 4QT0A 2J0QA 3IA2A 1GO0A 4I2VA 1GL9B 5J2TA 1MABB 3CLVA 2H92A 2PN1A 2HSGA 4FW9A 1WB4A 3Q9UA 2HR1A 2DUNA 3CX7A 1MQ8B 1J07A 4XUEA 4DCPA 2AMLA 1E3TA 1NZFA 1ODIA 3D5QA 4J0EA 1T5OA 1KDVA 3BMQB 1A9SA 1DOHA 1ODCA 3PQ2A 1YVPA 5J40A 4BP9A 3O8BA 4XWKA 5KQGA 1EWQA 4CLXA 1Y8QB 1ABEA 1YDEA 2D5IA 2IXAA 4O63O 2HDHA 1QMPA 4PICA 2UZHA 4RH0A 3O8RA 4P2GA 2MCFA 3P0FA 4J8PA 1AQYA 5JALA 5JXWA 2WZBA 2PV0A 1KI6B 1EP3B 1Z2NX 2UYNB 2OEPA 3OIVA 3GNSA 5EB1B 3SC6A 3VKWA 5AUNB 3T99A 4HLDA 4MDYA 1JIIA 1RAHA 3PD7A 5CH8A 1IVYA 4MRMA 4QLAA 1AIPA 5LQCA 1U2PA 2Q0HA 1YS2X 2AW5A 1PD1A 3O8QA 2HMSA 4JR2A 4NARA 5JDCC 4HB4A 4KL8S 2FW9A 1G38A 1N8RH 4EY8A 3AJ9A 4OXRA 4UE3S 2E82A 4L2IA 4CLEA 5A04A 1JQJC 4XWAA 4B48A 1NUSA 1EDDA 3F98A 3PBKA 1EIWA 3ZU3A 5KWVA 3WGLA 4B7CA 4BUZA 1MX5A 2CL5A 1S3SA 2ACKA 4N82A 1AA6A 1FJHA 3LQFA 2ZYWX 3GFFA 3WMEA 4CT4B 3QVLA 5I48A 2HY7A 2X0IA 4XDZA 3GRAA 2JZNA 1BH2A 2V3WA 3AU8A 1YVEI 3EXEA 2L0XA 3P9CA 3JASB 2GN9A 2N1BA 2RIPA 3QLUC 2VUUA 5EUMA 2P9GA 3ML1A 4PSAA 2Q28A 1XZQA 3IIIA 5CPFA 1E9AA 1K08A 2JIZD 3A4YA 4GOND 5GGYA 3D9QX 4HAIA 4FI3F 3TW0A 4Q7QA 2OHHA 5HILA 3VH3A 5D51S 5LA6F 5JNWA 3SQOA 1YJ9F 4MVJE 3UCXA 2GM5A 1U1IA 5FA8A 2Q5IA 3E48A 5HBGA 4HK4A 3UAGA 1AO3A 1IOZA 1TJNA 1DFGA 1L5NA 2V5VA 5K45A 1T6BY 1Z4KA 2B99A 4GH5A 5J5AA 3TVTA 5B3KA 1S8FA 2R9VA 1BX3A 1XWFA 1YR6A 4AMUA 2HPAA 5CEJA 4DB4A 1U8CB 4R84A 1K7YA 4P3XA 5HJ2A 3ZHXA 1XNHA 4OYRA 3W5AA 2YX1A 1NLYA 3FGOA 2J0SA 3DF7A 1AK9A 2RGUA 3WB1A 3B20A 1YRYE 2R48A 1G60A 3RVJA 2W4QA 1REQB 4OU4A 2PZ8A 2EHDA 3HA7A 2PMCA 4QUJA 3UH1A 1EWTA 4DDMA 1ZI6A 5K0CA 1QR6A 1BGXT 2CE2X 3IVXA 3LBAA 2FVYA 4GQAA 3H1AA 5FOVA 5L3QB 5THKA 1AUVA 4OK3A 3QOFA 5I4KA 1N2OA 3M1YA 1KYWA 4JT9A 4JYPA 4N49A 3V6MA 3V8BA 4L5IA 4ZFNA 2FRVA 3NK7A 4MWZA 1SWWA 5EJIA 4RMGA 1D1PA 3OMXA 3T3MB 1X87A 1FFAA 1TA9A 4PSVA 3UXMA 1SVSA 4C20A 4JZKA 2VNAA 3KSUA 5DXFA 4FMCF 2AMFA 2V9PA 4RMHA 3WIOA 4GOKA 3ZLTA 1EJ0A 5AKIA 3PC4A 3L6UA 3QHAA 3U40A 2ZATA 2PLRA 4BV3A 2EERA 5CD1A 2B6NA 2DUJA 1UMCB 3OEWA 1J23A 1OREA 3DBVO 4ND5A 1YUNA 2VO1A 3GX1A 5DWQA 2C99A 3RVLA 8ADHA 3QE4A 2ZS9A 3K70D 3BFPA 3ZHTA 3LTNC 3QTYA 1UJ5A 3AUJB 4KTTE 3PK0A 3U60B 1E92A 2FZGA 3C2QA 3KTDA 3MLEA 4QFBA 4QX6A 2RGDA 3IAFA 4ZO7A 4L6IA 4CF4A 5FLYA 4C82A 1N0IA 1EU1A 1VLLA 2I1VB 2BR4A 2C1ZA 1VPWA 2WYHA 1W5BA 5H4HA 1ADJA 2J3LA 4ZEMA 3JAKB 4Z49A 3FYHA 5KTRA 1L1FA 1GAQA 1NNUA 1PHRA 2QRZA 2XHZA 4X20A 3JALB 1QFJA 1YBAA 1QDEA 2Q62A 2VP6A 2Z5FA 3HH8A 3P71T 2QJTA 1V95A 4LYEA 2VEOA 4EHKA 1OH6A 4LZJA 4L76A 1LF5A 4XGRA 3U7JA 1V3VA 1ID1A 2HIHA 2ZRBA 3OQHA 2EAUA 2QUIA 2RG1A 3S8YA 1P0PA 4KWCA 4DQUA 3VO9A 4QDOA 1N3IA 5AVRA 1S8AA 1WCWA 2E55A 4MH0R 4BYGA 2A86A 1BXKA 5AD1A 2PX6A 3QBDA 3PLRA 3VZDA 4QQ8A 2PL5A 3TW4A 4E2FA 3WGUA 2HLDA 4AZSA 3I39X 1YD7A 4NF2A 3BZBA 3LXUX 4M0FA 2I6SA 3KB8A 4NENA 1L4GA 4S3MA 3KQMA 5AOCA 4ZEVA 1SH7A 2JVKA 4BGIA 3WKAA 5G0VA 4IAOA 1M8KA 1Z45A 2WPDA 4IDFA 1RKVA 1ZVKA 2VPYA 3I1FA 4J0JA 2NUAB 3LPCA 3TB6A 1BEUB 1J2EA 4GOOD 3B8EA 3QPDA 9MHTA 5KYXA 4GU5A 1V8FA 1WZEA 3AUSA 2ZULA 3LQYA 4MS3A 4N9WA 4OQQA 2C2BA 3QIVA 1D2RA 3PXCX 1AMNA 4RZIA 4UPDA 1FIUA 4WAUA 3UT0A 1WZIA 4GKAA 1NUHA 6YASA 4OQZA 3QNWA 3TIVA 3D00A 3W9BA 3ZHVA 1AQUA 4EYQA 4HUTA 1E3SA 1K0FA 2B5VA 2WU8A 5SY9A 4EGSA 3BL5A 3SC2A 1JJ7A 2B30A 1KYYA 4LX8A 1MLDA 4NYIR 2QN3A 3TPFA 4EMBA 3T15A 2P41A 3RVSA 2CFRA 1VQLF 2D74A 2I62A 4MVJF 2YMQA 5F7JA 3ZWXA 4X1YB 4O4IB 4M37A 2NU9A 2QRVB 1XPOA 3A6EA 2Y1WA 5BRAA 2IK8A 4M8IA 3EFBA 3PENA 1ZRMA 4MINA 4DGQA 4BNWA 3K12A 4UTVA 2VSOA 1YWGO 1JGTA 2BCJQ 4LV6A 2YNMD 4F91B 2H07A 2V0GA 5JFOA 3ED1A 3OPYB 3P19A 2IHTA 3C8DA 5CLHA 2FCAA 4QXMA 2R7LA 1KP2A 3FA2A 4QWMA 2V4ZA 4AY6A 2GAFA 2Y99A 1G8SA 1WY7A 1PSDA 3AGPA 4AM8A 5CA0F 2H5JA 1FDTA 2EL7A 1NQXA 1PR4A 2FQWA 3DMNA 4B2YA 5AVXA 3RUIA 1JR4A 3AVUA 3FTDA 3E7FA 1M6HA 2PA3A 3FI9A 1S2IA 1LRLA 3ICPA 3W3AA 3IQWA 5G4KA 1HR0B 3UOAB 1QZUA 1RWKA 2DULA 3CNBA 3JW8A 5CX4A 1G6HA 3UF0A 5HWSA 1GZ0A 1RKXA 1ZJ5A 4RHUA 4S2EA 5EAIA 4N76A 1JYSA 4CM8A 3EJWA 4ZVVA 1IXSB 3WG9A 1HPLA 5A9TA 2A1UB 4LECA 2JDIA 2NT4A 4B9AA 1VIAA 4NCIA 3A4NA 4ID3A 2EP5A 5TMBA 3B38A 1WXQA 1E7YA 1XALA 1U0BB 2Q4EA 1GTG1 1T9ZA 2ILTA 3K71B 1X8KA 5DSXA 5JXIA 5EKXA 1N2EA 2BGKA 4PPQA 5TSDA 1E99A 2Z6QA 1MDBA 2VR1A 1P80A 3VSBA 3QF7A 4RTLA 4JC0A 1K8AH 2OPHA 3K3PA 1OCEA 2GXQA 3OTHA 1HOXA 2WLTA 1SZJG 2VHQA 2IGTA 3PZRA 4WLFA 1XIVA 3UUFA 4HKTA 4BO7A 1YMVA 3T7AA 4TT8A 2HF2A 3BICA 4UNNA 3T1YB 3L0YA 4FYIA 1EUDB 1RQ2A 1TGVA 2ZR9A 4KNVA 3GTZA 1A95A 1ZZGA 3MWJA 3CVUA 2I2CA 3FROA 3LGSA 3MUOA 4ND4A 5E2BA 3PEUA 3VR6D 5J1SB 2IS1A 3K20A 2LR0A 3A1SA 3AO0B 1UXGA 3SE0A 3ZGYA 2C5GA 5HUHA 1Y4ZA 2Y1EA 4ALLA 3QXGA 4QGGA 3ZZMA 5K09A 1NLMA 3HABA 2PX4A 2V7EA 3DZ8A 1XCMA 4ZCQA 3B52X 3O31A 4IDHA 5TEVA 1R5JA 4PS0A 3FSEA 2X58A 2ZJZA 2GOYA 2QN8A 4CM7A 5BSVA 3GUHA 3BIFA 4ZVMA 2AYXA 2HPVA 3PFNA 3KHKA 3VC3A 3WMGA 3BWXA 3JATB 3CPJB 3JQ8B 1U99A 3AY7A 2HCTA 4ER7A 4D99A 4FEYA 3U7GA 2WSSA 4DGSA 3GNQA 3K0AA 2G9RA 2W0SA 4RHAA 4XB2A 1FU8A 2JCXA 4HNQA 3WJPA 1OI3A 4JYMA 1ZCZA 5AJXA 3ILVA 3EVNA 5CCBA 1ZINA 2ETVA 1HDZA 2ODTX 3M83A 4NK5A 1W44A 2Q2NA 4W1RA 4YJFB 4AYTA 3RBZA 4XM0A 1PT6A 1R0YA 3CYPB 5ICGA 1UDBA 1XMVA 3VSEA 3H04A 1SRQA 3ENWA 5WRFA 3PX7A 1GUFA 2JKYA 1SKYE 2YHSA 1N2XA 5FXMA 5AVJA 1L5HA 5LZ7A 4CDRA 4EA7A 5CURA 4CKYA 5A3QA 3B1WA 1T43A 4GMGA 2QTPA 3UJ9A 4HAWA 3WWPA 6AT1A 1ZNWA 2Z4SA 3DNPA 3T3EA 3VNAA 4X6XA 4CMCA 4MWGA 3HO6A 4G23A 4WFJA 1JJVA 2NYRA 3S7ZA 3WLMA 2FC3A 3P0JA 1OZFA 2JI9A 2Q8QA 2ZUUA 3NNNA 2PXHA 3V1LA 5AIBA 3OQOA 3LXRA 2NV2B 1DP4A 2WW8A 2YCBA 1JAZA 2Q07A 1RVV1 4G1CA 1IN8A 3TOSA 1PBNA 5J3JA 5JMOA 5BR1A 2XJ9A 2ZB2A 1E9CA 1ZGHA 4IG4A 4PIMA 5F52A 4C21A 2H2WA 1ISGA 5AW8A 3RVBA 4BB0A 4D9JA 4EHAA 1FYEA 3HE3A 1OZGA 3I92A 5D84A 2W70A 3SF0A 3VZCA 3AKYA 2QTZA 1CUVA 5CDUA 1RQLA 1XZGA 4QDJA 3HV2A 3CLSC 1HLGA 1WOMA 4BE9A 3WVNA 3KYJB 3B3QA 4DUYB 5BN1A 1KHTA 5C5IA 4KWHA 3M4ZA 3DVSX 4LV8B 4A0HA 2QD3A 2J7KA 4I3HA 1IRXA 1WW3A 2BOVA 4H2DA 3UWSA 1Q50A 1T36B 3WOVA 4F3RA 1CQIA 1F60A 2GPAA 4EJMA 1FLVA 1XVAA 5T57A 2V74B 1I7LA 4TZTA 3C6MA 1GNSA 1JTFA 2YJZA 3UFBA 1W85B 2OXTA 5EJ4A 4IH9A 1P0MA 1GZ6A 4TV9B 1HMYA 1LKZA 4HI0E 3PA6A 4MGHA 3CBQA 4CL0A 5KKAA 3U49A 4Y67A 4UUNA 4AY3A 3K5HA 4Z4GA 2C20A 1AOXA 4GO1A 3PHCA 4IW3B 3REQA 5E4FA 3RRBA 4CV2A 1I5OA 3PUKA 1XRJA 2B37A 3R7DA 3LS2A 2JGDB 4BB6A 1VHDA 1FTNA 3C8ZA 3IOMA 2E21A 3KXDA 4V1CI 1PYGA 2IE0A 1KFCB 4XGQA 3RGGA 1LH0A 2IXTA 2ZCVA 3AQIA 3OBWA 2WYIA 3F5QA 1H8HA 1I9GA 2OB2A 3GFGA 3GHYA 5DU2A 4N5LA 4YP0A 1E69A 4EMUA 2B8TA 2FEAA 3D43A 3KB6A 1VTKA 2I4NA 2V7XA 3DM5A 3Q3JB 3ELDA 4FKBA 4WZBA 4X3MA 4KUEA 5KVQA 3RQIA 3V80A 3WQRA 5MGNA 3B3GA 5B7NA 3DZDA 5LP6C 2X8WA 1WEHA 1XTBA 1Z6ZA 3NTQA 5FPHA 2FX3A 3L4EA 3LW8A 5B7QA 1J4AA 3TLBA 1F2TB 1R5OA 4CU2A 1N7HA 5F9FA 5LMUB 3HGQA 4J4TA 3KYCB 4OI2A 4WXEA 4S0XA 1ZK1A 2JAWA 3ZE8A 1RJEA 3ZE7A 1EM6A 5FX2A 1Q0TA 4MV7A 1H6CA 4Q1EA 1Y8ZA 1CJSA 2QM8A 4FDLA 4C0XA 4CDMA 1E2HA 3A7EA 4MW4A 4QSHA 4RD3A 2P6UA 4EYGA 1IY8A 2OWDA 1WMBA 1KZ9A 2R97A 3K09A 4BX0A 4FYJA 1K2VN 1EA5A 2AVNA 2HL6A 2XWBF 3FTCA 3H8VA 5U9CA 3CR8A 1E1KA 1LVHA 2VNSA 1VA4A 1F0NA 1P31A 2EZTA 2XD4A 4KR0A 1BTOA 5DLYA 2CT8A 1PW7A 1GL7A 1KDTA 2CLLB 2I6FA 3CVOA 1W30A 3GWZA 2GILA 3K31A 4ZRNA 3SIRA 4BKMA 1XXHE 4IL5A 1Q57A 2PUCA 1VE6A 3AJEA 4CKWA 2HHAA 3LTEA 4WK2B 5E9JA 3GLRA 3HZHA 4UFOA 3RTGA 4GC9A 3FVVA 3DLHA 4G1VA 5ESXA 2JFHA 3RIYA 3GRYA 4G0VA 2WOOA 1HDYA 2XPCA 1P9OA 3IT0A 3PC3A 3QBJA 4IGIA 4L8GA 1GFIA 4GICA 1JZTA 1O0SA 3B1XA 4NMXB 3RBAA 1KQFA 2J5RA 1O4WA 3IAUA 4LGYA 3MCTA 2GPNA 3S0YA 3HY3A 4EPRA 1Q0HA 2NUTB 1T8RA 3ENZA 3LXXA 3PXGA 1NM5A 2LKCA 1CFZA 1AUOA 2HDNB 4LXHA 3HYRA 2PZKA 2ZXEA 4TYQA 4FGUA 3O92A 3MOSA 3QWBA 4UBOA 1DGQA 1R16A 1YASA 4U0KA 5JASA 1EESA 4UNQA 2ZBPA 2DFTA 5JAUA 3E8XA 2B0JA 4YHHB 5JG7A 3T7CA 2D1RA 3BRWD 3PDUA 2PMEA 4GX5A 4W5OA 3FMIA 1E3LA 5CR9A 1YS4A 1H0KA 4DVJA 1CY8A 3V1KA 1IRIA 3AR3A 4FGZA 4B4UA 3JZIA 4AXBA 2LTAA 3A9VA 3ZG6A 1N0WA 3IX7A 3LT1A 3CLHA 4DSAA 2PXCA 3PITA 1SN7A 1E2QA 3SIVA 2BFCB 1D3AA 2HYDA 5BMVA 4LWZA 4EI9A 4MUGA 3ENKA 1JUDA 2RH8A 4OHBA 2Q5FA 3R75A 1TFRA 3UAWA 2I3ZA 4N8SA 3UGQA 4NZOA 4W6QA 4BC0A 2L69A 1YU6A 1YR3A 4BGUA 1DXQA 4CIXA 5T41A 1I0LA 4CQNA 3MAGA 4CMIB 2O3QA 2REOA 2A3RA 5H1YA 1OFIA 3X0DA 2EGHA 3RHTA 3VR4H 4TT3A 4XQ9A 4DSUA 4L4SA 2AXEA 2R1UA 1PGNA 4LCKA 2PT7A 3COVA 1KVRA 5AVTA 2Q6TA 2MYTA 3IV7A 4H7EA 2QU7A 1GZVA 3DL0A 4Y6PA 4D9NA 3DC2A 1ZMOA 4CETA 2P9CA 5DASA 3FHLA 3ER6A 3V4FA 2CMHA 5GAPK 3TAHA 4DG8A 5I9IA 4FT2A 4M7WA 1WXGA 5AOAA 1NATA 3ZOKA 3CCFA 1NBHA 2Z1DA 4PANA 3UMJA 4D3ZA 3FN4A 1KK2A 3C6XA 3DL2A 2JFGA 3AP3A 1QNLA 5ITWA 1OLUA 2GN0A 4PYNA 1Q7GA 4ERHA 2B4AA 5I45A 1W59A 5EXTA 1HM5A 2OFFA 3NALA 1QRSA 3DOHA 1U2TA 2G5CA 3P9QA 3S29A 3Q10A 3VTAA 3FPLA 4MX8A 1W4BA 3W1VA 1XTZA 4CKBB 3GYGA 5DJ5A 2GEKA 4BRZA 5A9RA 3PUWA 4K9NA 1V5GA 2HUNA 4C4XA 2ZYIA 3T5AA 3MTQA 1TW3A 5SZIA 4X1IB 4BE7B 4TYNA 3A1NA 2WQ7A 4KMSA 4O2BA 1G17A 1NKTA 2CHTA 1N1GA 1W87A 3FNBA 4HC4A 1N8NA 1JKFA 1V5IA 3ZBQA 4E2WA 1U9ZA 1BX1A 5FT9A 4CW7A 1FTGA 2AOTB 2QA5A 4O6VA 5BQPA 1JPVA 1KQSF 1IZZA 4P9NA 3FG9A 1U28A 3D31A 1NW6A 4CFZA 4ZOEA 5CW2A 2G63A 1ANKA 1IDOA 2A9FA 2SNIE 2YHIA 3WQBA 4GLFA 3ZTWA 3DEJA 3K1AA 3NWBA 3QHDA 1HLDA 2WEKA 5IAOA 2BYTA 3HB4X 3AV3A 4GVLA 1WOYA 3A0RB 4NWOB 2EZ9A 1XDDA 4OFWA 1PWYE 5AI5A 1N36B 3RSLA 4GGMX 1ULHA 1U4SA 5AW9A 5IZCC 3J81A 3NX4A 5M3BA 1ADGA 4IDBA 4EZIA 3TG2A 1J22A 1XKQA 2XLBA 4V2UA 4U5XA 5HCNA 3KQNA 1K5GA 3P2YA 5AUPB 3TCXB 1W36B 1JG1A 2VDQB 1Y3IA 1GLNA 1K06A 4FILA 4OATA 2WY2D 1QFSA 3R7WB 3VSAA 5AUQA 3D7LA 1E1RA 1RLMA 2GVNA 3JVUA 3I58A 4P82A 4IYRA 5FNVA 3KK0A 1YHQF 3GO4A 1G20E 4WLVA 5B7PA 4NS1A 4NH4A 5EZYB 5KOHB 5FI1B 1Y7PA 3SDSA 4GSLA 2Y68A 4E2XA 2Q0SA 3X1WA 1ADYA 5B6PA 2AOWA 3K4HA 2RGBA 4HNHA 3GQBA 1NBIA 1WZ2A 1F0YA 3A9CA 1AKQA 1YUBA 3AX6A 3Q8XB 4XCQA 3O5AA 3KLPX 5K3AA 1CRZA 3X43A 4ZHQB 3MS2A 4IDAA 2QOEA 3LLMA 4XJVA 2F62A 1OU0A 1ISHA 3G1UA 1UEIA 3A9SA 3H5LA 3E9QA 1Z3CA 1A4IA 4J2TA 4LYGA 1L7RA 1T0PA 4I66A 4LSZA 2WWIA 1CJCA 1F51E 4IIYA 2FA9A 5FTNA 4KBFA 1DRVA 1HETA 4LZLA 4RPKA 4EW6A 1X25A 2B8EA 3FMPB 4GKBA 4P35A 4QVGA 1WPXA 3ISTA 5JCXA 5JCOA 2NTEA 3UGTA 2QG4A 4V0MA 4X3LA 1KXJA 4AP9A 1XRPA 4PO3X 2EFEB 4GWLA 2P1DA 4KU4A 5KTYA 5LIPA 4WLEA 5L6MB 1KEEA 1CDOA 4BCCA 2ZE5A 4R2KA 4U2KA 2ETXA 2F3QA 3AR5A 1XO1A 2JAPA 3ICCA 4IZOA 4L74A 4CTOA 1NQ3A 1DIOB 4PWTA 1PR0A 1UIMA 2FKAA 3U6BA 1SCJA 2ZCUA 2A9RA 4G0OA 3B6KA 3LY8A 1SKQA 2C0CA 2PFKA 2IY7A 2HMYB 4CM3A 1E2KA 2D3WA 4URVR 3GPIA 1BXRA 4FEGA 1NNSA 3KWMA 3ZCPA 5FWYB 2A7XA 2VTKA 4FONA 2Y05A 1OZHA 5DNVA 3MCAA 4DLYA 5F7XA 2ZAUA 4EI7A 3GFQA 4EWLA 1P1RA 3MMSA 3ND9A 1NUAA 1OGYA 3VR1A 1OB2A 5LP6B 3DZHA 1L5FA 2PR2A 4I5EA 4IRUB 4GHWA 2V4MA 2OC4A 4HQNA 3LWNA 2QBYA 3ESYA 1A72A 3NUQA 2XTJA 1OFUA 2HRDA 4M7RA 1XKLA 2NO5A 4JR0A 4URWR 2GBIA 2XNJA 2DETA 2YWEA 1OBHA 1N1MA 1PT9A 1X1BA 2GTPA 1UMKA 2ADMA 2JPDA 2VHWA 3G59A 3PQ5A 4HUQB 4LJ4A 3NJRA 4BLQA 3WRYA 3U4MA 1LZKA 3DEFA 3F96A 4GOMD 4QKQA 4QE3A 2H2GA 1J9ZA 1U90A 1KEUA 2HLPA 2ZODA 5BWMA 1QZTA 3KHNA 4J1TA 2R6AA 4WOBA 1RTTA 3THXA 4E6EA 1S9HA 1O89A 3MT8A 3P9IA 4BVHA 4NJEA 4IHQA 4C4SA 5JZSA 5K3SA 1S2OA 1U0LA 5AVQA 4QNNA 2G8LA 3GJYA 2DUMA 2C98A 1QWOA 3L8GA 1K89A 2XR1A 2KHZA 5DBOA 2HLDD 1UPUA 4EKNB 1E5DA 2XB6A 4F9EA 2HVYD 3HJCA 3NTLA 1EHCA 4QAJA 3KT0A 4F21A 3UA4A 3PIIA 4I9NA 3TIGA 4GM1A 4XJTA 5KYWA 2WPDD 2HRUA 3FBAA 1VA5A 1Y7LA 1F9AA 1RYNA 1QGUA 2NAFA 4LI0A 3DXXA 4B4OA 4F04A 4YV1A 1GPDG 2B83A 2GEBA 1Z4QA 2O0JA 2UVPA 2WV9A 3D4NA 4HGYA 3RSSA 3RWOA 3ZE9A 1HX7A 5F5NA 5J59A 3LSTA 1KOFA 2D5CA 3TOVA 5F2NA 5CJJA 2ZOVA 4KQCA 3PFKA 3TM5A 4MRNA 3SI7A 2TMKA 3GBVA 4M76B 2J6CA 3O75A 4HFRA 1USKA 2IPNA 3ELWA 5JYDA 4QPPA 1J99A 2X15A 1RBZA 3WS7A 3GLGA 3TGWA 4JYCA 4I3GA 2DECA 4JHLA 4UDOA 3ERNA 2CDRA 2EP7A 1DAGA 4J0QA 3G0BA 4UVDA 5DCWA 2P4EA 4C4ZA 3O1LA 2IOQA 4AO6A 2R96A 5C7YA 1YB1A 4RPLA 4YRDA 5CBPB 5LFAA 2VZ0A 3N8HA 3AKCA 5BW5A 4A91A 5EWRA 1SNYA 1KORA 1JG6A 2Y1KA 2WU1A 3PFCA 1N6PA 2WIKA 2ZQ5A 4TM8A 5KOJA 3A05A 4JBYA 3ORSA 5LVAA 3EXAA 1KVQA 3GCGA 5DPMA 2N0SA 5EJ6A 1AZSC 1G42A 1V3QE 2VHYA 1VQ4F 5JD4A 4F2GA 2D0OB 1M8GA 2DQKA 2ZVDA 3MEQA 3UPUA 1RXWA 3ECCA 4HEHA 2XUQA 3F5SA 3VX3A 3QTTA 4R51A 1CK2A 2A67A 5AXAA 3LT2A 4DC1A 1W9MA 3E9NA 1YK0A 4G5OA 5B3JC 3DMYA 5LKAA 3BGVA 3QFRA 5EHZA 2A4KA 1V37A 2OCKA 2O7NA 1XELA 2YUTA 4XCVA 3IJRA 4KQMA 4S24A 4YLEA 1WF3A 1O0BA 3EQ8A 3LZ6A 3ZD6A 5I8WA 3SFVA 3KQQA 1DB3A 1JIKA 3AOEC 4JVNA 3W3AD 4B31A 2OE2A 2Y71A 1W40A 4UHEA 3WNZA 1SQ0A 1VHAA 4EKYA 3K30A 4IFEA 3H11B 3IUJA 4RKRA 5DLQC 4JP1A 1HDOA 3IEPA 1UAAA 1U5CA 4YWHA 3OM9A 1QG2A 4HYEA 1HQYE 2JDID 3N53A 3NC1C 3MGCA 2QPOA 3MQWA 3NRBA 1YGYA 2JFVA 1UQRA 4XWWA 3U4GA 4AX8A 1AHNA 1YHZA 4I1OA 1C4WA 5JVDB 1JIXA 3KSMA 4ILEA 1E9RA 3DSRA 4HRXA 4IVNA 3S4YA 1DO2A 2Z2IA 4UM8B 4DPKA 5ALOA 4BNMA 1WQ3A 1ZJYA 2XMPA 5HPYB 2JGEA 1NXTA 1KP9A 4NMLA 3FOWA 4HRAA 4NESA 5CVVA 4MW9A 3FSJX 4NAUA 4QYMA 4YJGA 3ZNNA 4G4YA 1D5WA 2WU0A 1CUIA 3GFVA 1E5VA 3AR4A 1QAMA 3F7OA 4PYRA 1L5QA 1GSOA 1QTNA 3W4IA 5FDFA 1I1NA 5DV9A 4MHTA 5FUBA 2P3SA 3R0PA 5J43A 1MA0A 4HQKA 3TMKA 3IFSA 4C6HA 5BR7A 2BY4A 5AKGA 5DCUA 2WMDA 3NDBB 4D7AA 5I7FA 4U7DA 3AHFA 4Y2JA 1GAXA 2WFLB 4CQLB 4IQ0A 3SM3A 1Q81H 1F8YA 3L4BC 5C80A 1FFHA 4I3FA 1R5BA 2F1KA 3CEHA 3HP1A 3KJZA 4JQOA 5H59A 3PTAA 3O3MB 1ONOA 4C7KA 4J0GA 4U3JB 1ICEA 4CMGA 3V4LA 2PSJA 1KMQA 2RB5A 2ZZKA 3CTPA 5LQDA 4OXXA 2QROA 3MCZA 4JEHA 5BVHB 1U9YA 3L46A 2YYZA 1ISJA 1QHEA 2I1WA 2ANCA 2IXFA 2R00A 2WSSD 3FZGA 3RFXA 3RW9A 4E15A 4Z3OA 2OQRA 2JLBA 3IPAA 4O4JF 1NMSA 2J59A 3QLJA 3BJMA 3M9WA 4OHMA 1T3SA 2C5EA 2RGWA 2ZAMA 4Y6LA 5LL6P 5FI3A 5DEIA 1VQ7F 1J97A 2ZF8A 2AN3A 3PPIA 3BMOA 4LRYA 5DNAA 1WR8A 2EKZA 3HVIA 4HBGA 3ZJ5A 3IVCA 2VEDA 2QYSA 2IWRA 3GOHA 3K73O 1Z6QA 1DOAA 1RYYA 5JHGB 5L8VA 1J8FA 2DPMA 1PK8A 3RWBA 2IBTA 1YZLA 1F38A 2DBZA 4GF5A 4MS4A 1ZK4A 3FCYA 2H1IA 4QNMA 5SZJA 2QDKA 2PTGA 2GD0A 4P7FA 3QKSB 5T5QA 4ZCMA 1UPCA 3X44A 3ER9A 5L3ZA 1W6UA 4E4TA 1Z4OA 3IDZA 4M1WA 1TF2A 1SVLA 4DRZA 2JANA 3WE7A 2P9BA 2O3RA 1BMFA 1QIFA 2V3VA 3DE6X 1H05A 3ZBPA 4OMCA 1DUSA 4R2LA 3LLVA 1NULA 3PLAE 4H1TA 3E82A 3ZS9A 3UJHA 6ADHA 4BT7A 2VAMA 3FPSA 3NONA 3UHAA 4KYUA 4REQB 3UAOA 5I7WA 2RGAA 1QZZA 3GZJA 3AL3A 3M5WA 2HA4A 1OAAA 1AUPA 1VSVA 2PYDA 2PUWA 4HYTA 4MCJA 5HIMA 3FRJA 1XQVA 3N2EA 2H4HA 4XVHA 2QRHA 1N33B 3W7AA 1RBMA 4HHEA 1JLHA 1JEJA 4INOA 4YCLA 3H9BA 3D3JA 4RXUA 3VNRA 1NVKA 1U0NA 3DOOA 3IQFA 3MB5A 2CVZA 3U31A 2HP0A 4RY9A 2VDMB 4R8RA 4UTOA 1ZHHA 1G9XA 1L5WA 1ZIXA 2QNBA 2I2WA 3L1UA 4RLFA 1CUZA 1YE5A 1PSWA 1Z5PA 2CUZA 2IELA 2Q2QA 1MVOA 2Z5LA 4K8RB 1Z8FA 5ALWA 2RGYA 3LC1O 4MLPA 4GPD1 4RO0A 4TOIA 1A8PA 3L7QA 1WUTA 4IHAA 2IWHA 3WL3A 4RNDB 2QLJA 5EIOA 7REQB 4CEHB 5EJ2A 1AXRA 1TQHA 5HWEA 1TTTA 2QENA 3JWHA 3L6OO 2M6LA 4U6QA 3SKVA 5KNBH 5LJIA 4XYEA 2QAJA 2B4QA 3KYDA 1RKQA 4Y0NA 4CKCB 1RACA 4ZOLB 5ULLA 4CEIA 3CMEF 2ATCA 4KO2S 1C7JA 3WWEA 4RVOA 4A8HA 3MFQA 1U3CA 1JHMA 4OPMA 3WLQA 5H81A 4TKLA 5HF6A 3DOCA 5E1BA 1J0BA 3CV3A 5EMJA 1SA0A 1H8HD 3BKXA 2HO5A 3D2LA 3HV0A 3DCNA 3LMKA 4ARVA 4D26A 3A04A 1P2UA 4DBVO 3RC1A 2OBLA 1N8TA 1VRWA 3F78A 1G2QA 4FLEA 2D2EA 1G21E 4JSTA 3WWOA 1QQBA 4AO7A 3H0CA 4ALNA 5TPZA 2QV7A 1N25A 4GNRA 2YJ3A 4ZC1A 1A5TA 2LVBA 4PTYA 4XFKA 3LCVB 1A2OA 3BWMA 2RGNC 3NBMA 3F5DA 3K53A 1U6IA 1LI5A 4HPXB 3ASVA 1U65A 4DLPA 1NVTA 2WJ4A 3HJBA 1B26A 1KO4A 2CLKB 2O4UX 1TJPB 1WNFA 2JG3A 3NBYC 5ALYA 4C5CA 1ADFA 3ZXIA 1M6NA 1R6DA 3OM0A 1QV7A 1GG5A 4M7PA 1D2HA 2EWCA 1PI3A 2QIOA 4WK0B 1IM2A 1II9A 3I6BA 4I4CA 1WKBA 1KJIA 4UW9A 2QN1A 2E5WA 1ZGBA 4YAUA 1EWVA 5IBQA 1JL3A 3N2NA 3T06B 1UMBB 4PG4A 2AXNA 1S8OA 3FF4A 4PHTA 3B7PA 1WW2A 1SB8A 2OP0A 3CURA 4QU9A 4KQGA 3U39A 1JJAA 2CB0A 3ZV7A 1THTA 3RFVA 2QB5A 4AMYA 4ND8B 3H86A 3MTJA 4JI5B 3M33A 2IKQA 5HTOA 3ZQKA 2PBZA 3EGVA 3T38A 1M74A 3QUQA 3GGSA 4O2RA 3T7EA 1NL3A 4JYZA 1WMDA 1V3UA 3IBTA 2JD2A 3AHHA 1DTWA 4AZ0A 1DQRA 1U3PA 4URHA 5CEFA 4LQDA 5E1MA 1T2DA 4JP8A 3VPHA 4JITA 3ZX4A 4YV2A 1AK2A 4Z7QB 1QP8A 1ZMXA 3L8ZA 4KIJA 4PU0A 5HMLA 1L7PA 3HHEA 2YXZA 1RWXA 2OCDA 4WN3A 2KBEA 2EYQA 3UVEA 4DS3A 4LE1A 3GT7A 4H4DA 3LWQC 2B5WA 3A0UA 4BMSA 3JVDA 5AKLA 1HE1C 2WAOA 3WO0A 4WJKB 5EESA 4WXYB 4ON9A 4FJ2A 3AIIA 5FWXB 4RYDA 2C57A 5KYTA 2VJOA 1HG0A 2HF7A 3E7WA 3Q5GA 4OOEA 2YICA 2WIGA 3LC2O 3UWOA 4OKIA 4BQQA 3DZIA 3LXMA 2ZVQX 1FMJA 3E3MA 3M1IA 2O5EA 5DNWA 2H9IA 3KQSA 3C3PA 3CLUD 4W8OA 2QR3A 2OILA 4YEDA 1KL7A 4R1NA 1N6IA 1LV8A 2LNDA 5HG0A 5A7GA 5TPWB 4MWBA 1IMJA 3AVPA 4HVAA 2EQ5A 4LZOA 4UULA 1NQTA 1C8VB 1HZZC 3FDZB 1D2MA 1NYRA 2CNNA 1Z2PX 3A4VA 5KNBD 3D01A 3THRA 1HDCA 2F55A 4TT3D 5ERGB 5BVGB 1JZSA 5AK0A 1ZISA 3MWGA 4RV4A 1SCUA 1XV5A 1EFHA 1A76A 3TAXA 5C1OA 2Y92A 2ORWA 3GL9A 2OO7A 4MYHA 3BEOA 3IP5A 4S05A 1Q83A 5EFZA 4CLDA 1PR5A 1HYHA 3K6KA 3UKJA 1SHKA 1E2NA 3VPGA 2ZDGA 1JYEA 3IAXA 5EIFA 2R6HA 1ZUNA 1JEQB 2JIPA 3GRPA 4DIMA 4LXIA 1O9BA 3MSXA 2VDVE 4P53A 3F0GA 3AB8A 4NBLA 3ZD8A 2I66A 3UPDA 3ET5A 3MGGA 2I9KA 2C58A 5IYZB 3R41A 1GPAA 1QH8B 1A7KA 2ZBFA 1USIA 2WF9A 1Z4NA 3KS9A 4WK6A 1F4VA 1UK9A 1GFSA 2VT3A 1OSNA 2O8CA 1CZNA 1SCQA 3EC2A 5AHWA 3A06A 2ZITA 4ZODA 2VPXA 3O2SB 1EEHA 1YR8A 3DC7A 1PGPA 1NNI1 3QX8A 3NO4A 5C8ZA 5KWJA 2QGNA 1A2KC 4N3AA 4KDCA 3WIUA 5KTTA 5D3MA 3BHJA 4NMHA 2F8TA 4LJAA 3QUBA 4YCMA 2WKRA 4FHCA 2BFEA 2IVZA 1NZJA 3ELYA 1IHXA 2YOFA 3UMFA 4WFIA 1D2GA 1LS6A 3FR8A 2BFAA 4PC7A 4WA7A 4F85A 2WT9A 2P9QA 6NULA 3BIOA 4BFUA 1JLSA 4F0JA 1TAUA 4A10A 1QIHA 5THXA 1GN8A 3F0EA 4HZUA 4EQ6A 4EO9A 3AKZA 3THWB 1O94A 3RVDA 1V35A 1DDGA 4PLZA 2XKAA 2RHJA 1OWOA 4HH3C 3ICOA 4XOIA 4D3FA 3P26A 2ZVYA 1ZCBA 1M0WA 2I4IA 2ZRPA 5IM4A 4FZ3A 4C7OA 2IEAA 3OA0A 3KTAA 4PX2A 1O6ZA 4AC9A 3CCRF 3F67A 1XZKA 1DUVG 4X3OA 2PSSA 3O3NB 1W29A 4DILA 2GLZA 2AKYA 2FSVA 3BWYA 4OP1A 4Y1EA 4XSGA 5HM6A 3BHIA 3GB9A 3ZDZB 4BMVA 3HXMA 1K3FA 2NG1A 1E1RD 1QRAA 3IP1A 3N2GA 2H4YA 3OOYA 4J0HA 1GO1A 2JJ2A 2Q7OE 4HNAA 4WNYA 1TUIA 2FHSA 3HDYA 3OWXA 2G28A 4J1NA 2Z1UA 1V39A 2IEBA 2J9RA 5KMGA 2GN1A 2FY8A 3GG2A 4LI3X 4KSBA 4TXMA 2QVCA 3NASA 1UFOA 3ZCSA 1PXWA 1WVGA 5A2GA 1M66A 3TSYA 4A82A 5K3EA 4PINA 3JAWA 5E2AA 3TWOA 1ZVMA 1ZXBA 2HQSC 3Q3IA 4N40A 3SLGA 3SYNA 3SEAA 5UKDA 2B4KA 4QQFA 3SQXA 3OIFA 4JK3A 4CV0A 1JLMA 2C4NA 3OLYA 4G5GA 4Z1MA 2NTVA 4WRRA 5F64A 2P6MA 5F5LA 3AW8A 3EAQA 2G06A 2I7XA 2YZGA 5ES4B 2IP2A 3D8UA 1SVWA 2V7VA 2XXJA 4JYAB 5I7RA 3DONA 3LVFO 2J0VA 5IKEA 1E8DA 3R3WA 3ROXA 1LK5A 5IKPA 3S0WA 1Y8CA 4NZMA 2I4MA 3OP1A 3A32A 4XAQA 1CUEA 1U5BB 2JGMA 4N12A 1QONA 2JGRA 3EXHC 5BXQC 5D01A 5AK4A 3WLFA 2C0QA 5B30A 1Q0ZA 2LPMA 4M87A 1P60A 2O5VA 2TMYA 1KHHA 1ELOA 1EXMA 3OHPA 5BV1A 1TM7E 2QLMA 1QUEA 3GRUA 4CTNA 1CRWG 1Q1EA 1G0OA 3QVVA 5EQTA 4ERNA 5K99A 3GLIB 5ECGC 3A3PA 5AVZA 3ABQB 4NFYA 4P36A 4WOJA 3REGA 4DR7B 5IC5A 3CJQA 1AN9A 2W2QA 4LC1A 4ZVQA 4EG5A 3C5CA 2ZUDA 4B0PA 4OM7A 5I5EA 2X4DA 1WU8A 4CGZA 2BSXA 2WIBA 2LCIA 3LFTA 4KXNA 3MRVA 5DB4A 3TLJA 3RPEA 3UA3A 4BO5A 2GEJA 5AYVA 3SZMA 3D02A 1Z56C 2Q6KA 3SYLA 3ZVLA 1JQDA 3DO6A 2Q21A 4D0SA 2WT8A 4TV8A 2JGIA 3NANA 2EQBA 4XSVA 5FYQA 5JE8A 3IVGA 5LCXA 2PE5A 1KAMA 4MA0A 4RKWA 2D1QA 4BWFB 1IJBA 2OG1A 4AECA 3B1FA 2NQTA 3MJEA 1DG9A 2FPGB 3TZQA 2J41A 2H7CA 4ZT7A 4BJ5A 3HNOA 1U1DA 2IYTA 3IAM1 1UZUA 4LMAA 4BZWA 3S02A 2EW8A 1MJNA 2REQB 3AZOA 2IQQA 3H4MA 2NPFA 5C4GB 4AQ7A 4CGYA 3IMPA 5C8YB 1QLHA 1B93A 3KZNA 3QKRA 3WGMA 4HDNA 5ALDA 3BN3A 2XCQA 3B7GA 3Q7RA 4RIEA 1C3VA 3GDFA 5CB4B 3Q2OA 2FSFA 2PM8A 3R7AA 3TNLA 3P9RA 3VR0A 2GARA 1Q6ZA 3I09A 3ZDQA 1BFKA 2XB8A 4FDMA 3ECAA 2KI5A 4OAOA 3D2CA 4W9NC 4IILA 3HCCA 4N5HX 5CB4F 5A3SA 2C5LA 1XBTA 2ZUSA 2FWNA 3B78A 2DHDA 4U6NA 4ZEOA 3UAVA 2O2IA 1GTSA 3BCUA 3KHSA 2KW5A 4GGPA 5BR4A 1E59A 3UK6A 3GUZA 1X42A 4H1HA 2QU8A 4KI0A 3RVMA 3W5DA 4X97A 5L51A 3PUJA 1SHUX 1SMKA 3O3OB 1GQ2A 5FNZA 4QRIA 4CHGA 5ERXA 1IZ0A 2YWJA 2F1IA 2JIQA 2UUPA 2ZSUA 2BEVB 5LYJB 1S9DA 3RA5A 3QFCA 2LBWA 1BKYA 3WB2A 1AHHA 1KGDA 2BCGY 3PXDA 4WKOA 4XPZA 4B6PA 1JKMA 2VAXA 3ZGLA 1N5DA 1LJLA 4UAJA 5E1DA 3ZZ1A 4AS3A 1OV6A 2HPHA 4P54A 5EKUA 2BR3A 3UYKA 1CJUC 4ZIRB 4MIEA 2J3QA 4G5HA 2H17A 3G89A 2APJA 3DZKA 1BYIA 1R1MA 2P67A 1VMAA 1E1CB 1IBSA 4HMOA 4A7PA 3EZFA 1PJZA 2H1WA 4AUNA 1R7RA 4PC2A 3RLFA 4AKTA 1VIVA 3OW2F 1A5SB 3QWFA 1JQLB 5A5VA 1WDMA 3JQCA 4DRYA