4U39A

Crystal structure of ftsz:mciz complex from bacillus subtilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
294
Chain Sequence
b'SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIALDFADVKTIMKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 99
structure length 294
sequence length 302
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4u39A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4u39A01
2XKAA 1SA0A 5MN4A 4EI8A 5CA1A 5IJ9B 4EB6B 5LYJB 4TUYA 2BTQA 4I50B 2Q1XA 4ZI7A 1FSZA 1TVKB 5KMGA 5C8YB 3VO8A 4O4JA 5IJ0B 1W581 3JAKA 4X1IB 2VAWA 3E22B 3ZIDA 5EYPA 3VOBA 1W59A 5JVDA 1W5FA 3CB2A 3HKDB 5IJ9A 5LYJA 5LOVB 5M7EA 4ZHQB 4I50A 4O4HB 5CB4A 4XCQA 4ZOLB 1TVKA 1W5EA 5LXTB 4HNAB 5IJ0A 1RQ2A 4O2AB 3RYIA 4M8IA 4X1IA 2VAPA 3ZBQA 3HKBA 4I55A 4B45A 5ITZB 3V3TA 3HKDA 1JFFB 5JQGA 5LOVA 1FFXB 3JAWB 5LP6C 4ZHQA 5JH7B 3HKCA 4ZOLA 2RHOA 4YJ3B 2XKBA 4HNAA 5KX5A 5IYZB 3WGLA 4O4IA 4IHJB 3UT5B 3WGKA 5JCOA 4EI9A 3M89A 4TV8B 5ITZA 2R6R1 3RYCB 5EIBD 1JFFA 4EB6A 4WBNB 1FFXA 2Q1YA 3JAWA 5JH7A 5GONB 3VPAA 5LA6B 5MN6A 5C8YA 5EIBC 4DRXB 3C8LA 3WGNA 3WGMA 5IYZA 4X20B 3E22A 3UT5A 5CA0B 2VAMA 4B46A 1RQ7A 4U3JB 3RYFB 4LNUB 2RHJA 2R751 3R4VA 4TV8A 1W5AA 3JASB 3RYCA 5J2UB 5EZYB 3JATB 5BMVB 4EI7A 4WBNA 4O4HA 1OFUA 1W5BA 5GONA 5LXTA 3HKEB 5LA6A 1SA0B 5MN5A 4I4TB 4DXDA 4FFBB 4DRXA 3RYHB 4O2AA 2RHHA 3N2KB 4X20A 3JALB 4KWEA 2BTQB 5J2TB 4U3JA 1TUBB 3JARB 4O4JB 5LP6B 2BTOA 5J2UA 4O2BB 5EZYA 3JATA 5BMVA 5EYPB 1RLUA 4YJ3A 2VXYA 3HKEA 5JVDB 4I4TA 4FFBA 3VOAA 2RHLA 5FNVB 1Z5VA 3RYHA 4O4LB 3N2KA 3JALA 4E6EA 4IHJA 5CB4B 3N2GB 5J2TA 3ZBPA 1TUBA 4IIJB 3M8KA 3JARA 4YJ2B 4U39A 4F6RB 5LP6A 4O2BA 4X1KB 4X1YB 3RYIB 4TV9B 3HKBB 4I55B 5JCOC 5CA1B 4TUYB 5FNVA 5JQGB 4O4LA 5CA0A 4ZI7B 3N2GA 3RYFA 3HKCB 4LNUA 3WGJA 5KMGB 4IIJA 1Z5WA 3JASA 4YJ2A 4F6RA 3RB8A 3JAKB 5KX5B 3VO9A 4X1YA 4X1KA 4TV9A 4O4IB 2GVIA
chains in the Genus database with same CATH superfamily
4LBZA 5CG1A 4QJ4A 3ELDA 2IZZA 2OCLA 3G85A 4HWSA 2OORC 2JLSA 1JG2A 4G9BA 5D84A 5FBLB 1Z34A 3ZY4A 4J2OA 3P71T 5LYYA 2GHIA 4I50B 1P8AA 4HP8A 4JAVC 2HWYA 5FBZA 4ZK7A 1HH4A 3HM2A 1KVTA 1NW7A 3V1YA 2Z6UA 1EESA 2PD6A 3E22B 2VK2A 5IZ4A 2FDCA 2UXDB 2JA1A 2PUHA 1J0BA 4DR6B 4DV1B 3JY6A 3SSNA 4F5ZA 2WHEA 3MMNA 1OC2A 2QX4A 1NHGA 2AXNA 4G5SA 1WV0A 1YR1A 2EP7A 2XUIA 3KQUA 3QBJA 3TJZA 1SC3A 1CRWG 2EHDA 1M2NA 3ZJUA 1O58A 3AIOA 2F90A 1G5QA 5F7XA 3LDUA 2O7NA 2RHRA 1SU4A 5K3BA 5C3UA 4Q24A 1UUFA 5CT8A 3V4PB 4GRDA 1OHHA 1PG0A 1Z2AA 3HLKA 1A96A 2HB6A 3ZWPA 3B7WA 3SP1A 3PRYA 4MV6A 1MIHA 5LMZA 3PD1A 1NU8A 2J67A 2H2AA 4OLBA 3C1OA 3JU3A 1ZIDA 2ES4A 2JAWA 4AX8A 1KMCA 2PAFA 1MXHA 2CV1A 4BUCA 2ZTVA 3DSRA 2CBGA 2OZPA 3FYUC 5FA6A 5C3MA 3PUZA 3RYCB 1QTNA 3CO5A 4EJ2A 3MTGA 2VJAA 4QGBA 3I92A 4O4HF 4RVGA 2VRBA 5K51A 5DM60 2CFOA 3U4QB 1ODLA 2YC2C 3DZBA 3CCVF 4OQQA 2UV8A 2JJMA 1MEEA 3STHA 4C1BA 1XWFA 4UDNA 2Y6VA 3QV1A 5ALZA 5EPOA 2Y4OA 2M2IA 1JHUA 5L6LB 2QVCA 2GERA 1DWPA 3MGKA 1QLJA 2DX7A 3W05A 2O2ZA 4XWOA 1MRNA 1BFDA 3IX7A 1B0AA 3M6VA 3S81A 3IQIX 5ETJA 2WZCA 3QVGA 1G5RA 4IVRA 2O8CB 4TL9A 5HY2A 4MKFA 4EHLA 2P27A 3I6QA 5GPBA 3TNYA 2PKYX 4F2WA 2XIJA 2J3IA 1DJPA 3QVSA 3DJFA 4G5YA 4IUCS 1G41A 1G7TA 4H15A 5HZGA 1G64A 1YGPA 3IQHX 3R7BA 1UWVA 3BMQB 5IDXA 3ADKA 4LRQA 2EFDB 2UZIR 4YAGA 3O8OB 1NONA 2BSAA 2LKDA 3K53A 4FDAA 2IYPA 2HJWA 1EINA 3IUEA 4Q3LA 5DHQA 1MG0A 1NP3A 2QAGA 3QKWA 2NZYA 3SHOA 1OFHA 2GZMA 3KVNA 4HB0A 5IH7A 4B4WA 2J9XB 2GCOA 4UCQA 3VTKA 2G83A 3LIPA 2PTHA 1VZ3A 3I5AA 5AI8A 2G70A 5HQ3A 1T8RA 3SDSA 3QVVA 5J1SB 2NXEA 5DGHA 1DWOA 1P5RA 3V80A 2W6JD 2ANCA 3L4BA 4YIKA 3C7TA 1NFQA 4NPHA 2V6IA 3IO5A 4LYJA 4MIEA 1GYRA 1GO2A 1W29A 5DN6D 4A0SA 2Y71A 1L4GA 2O0HA 2WOOA 1Y3HA 4MQFA 4S24A 5BSVA 2VNIA 4DVJA 4MI6A 5IFKA 1ZMBA 5C1DA 1UBSB 2ERYA 1NLYA 4I5FA 2XNHA 1F2TA 1KMMA 4IDHA 1BXGA 4QRHA 4E14A 1VXOA 1RAHA 1VKHA 2VEDA 2WVHA 4H6PA 3LT2A 3BB1A 3U5ZB 3EPHA 1RYHA 1Q0SA 4QU8A 1J0AA 1Q95A 4RGQA 3K0AB 1E2NA 5TQ2A 1ZNZA 2ZYGA 1QTIA 2H5EA 2C58A 1W4CA 4G24A 4H0CA 4KIWA 3TDNA 4IJUA 2R8BA 4U2CA 3R77A 5T6BA 2P9GA 4EEKA 1RAAA 2RK3A 4YO8A 3NDPA 1UBKS 1WD7A 2Y0EA 1XJCA 3STWA 3RA6A 1L4LA 3EVGA 1N6NA 3BCRA 1AD2A 1R5OA 3JR3A 4D96A 4Y2SA 1CUAA 3MUNA 4XFJA 4KREA 2IXFA 3O3CA 3K9WA 4G97A 2XZOA 4PC6A 2A57A 1JLKA 2B0JA 4PYRA 2WWIA 4IIGA 3U7RA 2WPNA 1CJBA 2VBGA 5B8FA 1Q77A 4LFBB 2CDAA 1R00A 2Q6IA 1C50A 1HDRA 2C8KA 3O82A 4PF1A 2NWQA 4BB6A 3DEHA 2CXPA 5JY1A 4IHQA 1F1BA 5AOCA 3KKQA 3A7DA 3PDUA 4Z2YA 4AJOA 1ODEA 5AVTA 1U40A 2IU3A 3L2OB 2EFYA 3I0ZA 3NT2A 4N18A 1CJTC 3GRUA 2FW7A 2Q5QA 3H1FA 1A3CA 5CW1A 3UCFA 3QEOA 1Q5PA 2QPOA 1C9YA 1VB5A 1JQJC 2C5SA 3G0OA 1OX5A 4G4JA 1U1DA 4HR7A 5DI3A 4HEHA 5EQTA 3P2MA 1LDYA 1D1PA 2EWWA 4NBNA 4RVHA 5LA6F 3V4DA 2Q5IA 2N47A 4FZ5A 4ZVOA 4CE6A 3DXZA 4MQ5A 3PKIA 1JMKC 2X9VA 4LZWA 2XVYA 1OWMA 3EG5A 3F7MA 3OECA 2Q2OA 3OCWA 4BPRA 1N6KA 1VJTA 4PSDA 4J0JA 2VZ9A 4FZVA 2R751 2P3OA 5TPZD 5BWOA 1PZHA 1X2EA 1OREA 2MU1A 5KTOA 3ANMA 4DQLA 1I7QB 2GAJA 1BIFA 1X2BA 2VC2B 1UP4A 4IY1A 4IX1A 2AG8A 5IN4A 1RI4A 2NSJA 4AW9A 3ROKA 1YNSA 3BRSA 3RTBA 6ADHA 2CHQA 4AP6A 2AMFA 4GXRA 2BFOA 4HVAA 5A06A 3D6AA 4X44A 3HJHA 3RFTA 1XCLA 5K9ZA 4MR9A 2J9YB 5TT0A 2DB3A 2C29D 2WTNA 3CA8A 2PRJA 1X9HA 2HPVA 5ALDA 1USGA 2YWHA 4JVSB 3TL6A 4BTLA 4DV7B 1ZR4A 1Y5RA 3JX9A 3WHPA 5KJ1A 2W42A 4KXNA 1V71A 4MR8A 3VOAA 1ML3A 3N5CA 1GDHA 5LD2B 5FI3A 1FC0A 2R62A 3ZHOA 1ULUA 2ZJ7A 1YJ5A 4QYTA 3H1PA 1H0KA 1UK6A 2Y77A 4XYBA 5IANA 4MR7B 3C3YA 4MVJP 3QE9Y 3D5TA 2GKGA 3GUVA 3DDUA 1BEUB 4I1RA 5ALUA 4WY2A 3C9TA 1KNXA 5EERA 3ZKAA 4F6CA 1SC6A 1TE2A 4G89A 4NZPA 3ZWQA 1MNQA 1U2PA 4BL5A 4Z0PA 5DW3A 5FTLA 2VHCA 1WB4A 3RIMA 4CTMA 4Z9XA 2OXIA 4AS2A 1HG1A 5D1HA 4R7GA 3GK3A 2UYQA 4FN5A 3GCDA 2XODA 1YAJA 5IDYA 2IPMA 4C04A 4RTQA 2WG0A 2OFPA 3R8CA 3GYBA 1DV1A 4OK6A 1AS3A 2IP1A 1U9IA 5BUZA 3TOZA 2M1XA 5A04A 5CM9C 4XE5A 5FT9A 1J5EB 3GBPA 4BB0A 1E60A 3U4GA 3ZY6A 3T7SA 4R2MA 1AA6A 3WLFA 4ZZ2A 5J47A 2O57A 3WLSA 1ZAYA 1E7MA 2Q3MA 4DSOA 1R37A 5EP1A 3RK1A 3OWXA 1TYEB 3MTJA 4LY0A 4OQPA 4XIYA 1R4AA 4GOLD 4GZLA 1SXJA 4K3UA 2IX9A 3RKUA 4R5HA 1KH3A 3GLUA 4BLVA 3GFFA 2J6IA 2OE2A 3GLTA 3IMCA 4QEZA 4Q4HA 1TVKA 4QKQA 1FNKA 2EWMA 4M1MA 4AZTA 1QB8A 3OT1B 3NVAA 1FRVA 3RYIA 3GQVA 3M4XA 3F71A 3SK0A 4DWJA 3OZBA 2RGWA 2AKAB 2C57A 4U7HA 4A16A 4C0BA 1QE0A 1RKQA 3TW6A 4QWWA 4ZT3A 4C1NA 2DPGA 4AJPA 1YJWF 5FYQA 3THYA 2ODWA 2ZPTX 4MWZA 5KVVA 1DS6A 2H51A 1E3IA 3EW9A 4XWTA 3K09A 1YQXA 1KO8A 2JGIA 3ZP7A 1BRMA 1QCCA 3HGQA 2P5YA 2R97A 1RWXA 2P9CA 4PLTA 3DAPA 3ZVKA 1QF7A 2HH9A 1H4QA 1CQIB 1E6CA 3U40A 2CV0A 4OSOA 2J45A 1V9SA 2B82A 3OY2A 4L6AA 4LBVA 4MA0A 4B4DA 2PCLA 5E6UB 4ZMRA 3MD0A 4MRSA 4RE6A 5AJZA 3V3KA 2B1RA 3EIUA 5MHTA 3U3JA 3T99A 1D6SA 2P9FA 4JT4A 1RTKA 1KIAA 3LA6A 3R7FA 2XVMA 1O5TA 3AUAA 2I1QA 1CN7A 3FPIA 4MUIA 4F4JA 2C5EA 2VGMA 3OLQA 3KL4A 4DNXA 3B1WA 3GJ8A 1IPFA 3FUCA 2E82A 3RSCA 4DMCA 4I4TF 1N8TA 2OGWA 4Y6LA 2FF7A 3D8SA 3ZZUA 2E2WA 3T3EA 3BL5A 2JJQA 2ZG6A 5B5SA 3D2AA 3QQ5A 3EXEB 2XA9A 4M36A 1IPHA 3ONNA 1I1NA 3QFTA 1YRWA 5KOJB 2GUWA 2VI5A 4O08A 3C6XA 4NAUA 2KE5A 4MW4A 2QLBA 4BT4A 4PYOA 3GPCA 3ADBA 3C2QA 4YI5A 1E1CB 2FNAA 2IBMA 4EJMA 2IYZA 2O8FA 3KALA 4FJ2A 2IWRA 2WUWE 4ROSA 4DMFA 1TC1A 3HBJA 2P35A 5DHRA 1E5QA 3BUSA 3W5BA 1DCTA 3RS8A 1MC4A 3GY0A 5HWEA 1BKDR 1Y3DE 3WR5A 1HZZA 5CFLA 1H9AA 3IDSA 5A6SA 1P18A 3HRKA 3KUCA 3LQFA 4CHTA 5HP7A 3FVRA 3LBIA 3R6LA 2J3DA 5E7QA 3C74A 2ZJFA 3G1UA 4MYRA 4Y6OA 3WZMA 1NVMB 4L27A 2DU8A 4TMTA 2HDHA 4P7FA 3TYXA 4ZK6A 2WF7A 1N1GA 3EGDB 1PSZA 1KSGA 2ZJ3A 4L28A 4EVSA 1T8TA 4EG3A 4A82A 3T15A 1GCGA 1K6XA 1P7CA 1LK7A 1W0JA 3I04M 2IODA 3VDXA 4RJKA 7ADHA 1ZKDA 4TT3D 1FDSA 2GJAA 1EAMA 5FHQA 1Q15A 3N3AC 2JAXA 4G5HA 2XYGA 4A5OA 5CEFA 2BVNA 5M29A 4EJ0A 1QPBA 3GUHA 4YFVA 2HDOA 3OZAA 1T9KA 1U5CA 2QEQA 4ZO4A 3EE6A 3DTVD 2AXQA 1JR3A 1LVHA 5L8VA 4ZOAA 5SZIA 2FAXA 2CXSA 3S2YA 3LHKA 1JIQA 3VOBA 4ZDKA 4IMJB 1M1UA 4P38A 4ENTA 3NPMA 1HT3A 3CNQS 3S02A 1TYZA 2JBWA 4RJIA 4R69A 5KQGA 2YFHA 1LBQA 1W3EX 2G36A 3H16A 4YH1A 2JHFA 1T0AA 3PLAC 1U6JA 2Z4SA 3V6MA 3BMOA 3LSTA 1W5EA 4CHGA 3CLKA 1GX1A 4F60A 4UM9D 3U80A 3UUFA 3KUKA 3WRYC 1XK6A 5DNAA 4U9UA 3B36A 2NU9B 3SZOA 2HBZA 3LPLA 4Z4CA 3T0IA 1ABEA 1Y9ZA 3O8BA 3QMPA 4ERXA 3UJAA 4FT4A 4EMTA 3LPNA 1BA3A 2W98A 4DWVA 5A4FS 4MWOA 1O96B 1HSOA 1M0TA 2HTFA 4P3XA 1X1EA 1RXVA 3SPXA 3RARA 3WXMA 4L6IA 3ZIAA 5DCWA 2YRWA 1GSAA 4F91B 3SQLA 4F21A 4E88A 1Z6GA 2GPBA 3N0WA 4H35A 3GJ0A 3E3MA 3KJEA 2QTPA 1Z12A 2E18A 6CHYA 3EZXA 1OLOA 3JYHA 3KXDA 3AL0C 1ZITA 4KOEC 4H1WA 4ZYYA 1GNPA 4C6RA 2VDMB 1Y3CE 1UZLA 4NZZA 4PIMA 3L4KA 1SRQA 4PTLA 5DSXA 1WZ2A 3VVLA 1F0YA 4AMBA 4HDSB 4DRXB 2IXTA 4CM1A 4NJEA 4OUDA 4YCDA 4WGGA 3FSEA 3W3AA 1U65A 1YQTA 1MV5A 4FCCA 5C51B 1RM4A 2QAGC 4FSDA 2RHJA 4BCCA 4Z9BA 2XCUA 3GP3A 5C5EA 1Q83A 1SCKA 2VHWA 3WZLA 4US1R 1KEEB 3EEIA 3CKLA 3HWRA 3QHPA 3N58A 3NASA 4LWZA 1H0SA 1JG6A 3UXMA 1IATA 3L4BC 1RRGA 1BJTA 1RZRA 4KGVA 1TVMA 2OZLA 4L3VA 1MZPA 2QMEA 2NNWB 2PTGA 3VKVA 1OAAA 3FNRA 1Q8RA 3IILA 3MTAA 1PYOA 5FJIA 3S5JA 1EDOA 1JHRA 3H84A 1RRPA 1SVWA 3EXHA 3FCAA 4I99A 4RY0A 4EABA 1CUZA 1WRBA 4ZIRB 1NJSA 1G2PA 2OV4A 4OK3A 3VKUA 2H2IA 2G3YA 3V5NA 2JNBA 1Y8CA 4JJAA 3AUFA 4NFHA 4L8VA 2W6CX 1HNXB 5M3BA 4NCAA 2BEWB 1VPDA 1PS9A 1W36D 1XHEA 3CNBA 3GD7A 2NXJA 1JSCA 1IK6A 1U7TA 1G2OA 2YXPX 2WHPA 3L8ZA 2O8BA 2I62A 2F1OA 2P41A 4FLFA 5CVJA 1BQ4A 4BMYA 4B09A 5CCBA 1ZEJA 1ZD3A 4WN9B 2ZI5A 2JGKA 3U3OA 5LZ9A 4KAFA 1YMVA 3CKYA 3JWEA 3Q9LA 3F67A 4D4MA 4AJIA 1P1BA 2FGJA 3KT0A 4KLRA 5ALXA 3LX5A 3BA6A 3ZI4A 3PNPA 5H1YA 1Z6AA 4DCNA 2R48A 2ZRIA 5CDFE 5LZ2A 3FMOB 1INLA 2XWQA 4TPKA 4ZRMA 4Z4EA 2RD2A 1JJAA 1Z47A 4Y6GB 3W5IA 3E2MA 2ZANA 2XLCA 2R79A 3N6VA 2X13A 4AF8A 2XZPA 3EIQA 3QTLA 1E9RA 3GFOA 2XSZD 5TQ0B 3WS7A 5IJ9A 2C0PA 4N3CA 2D3WA 1F06A 2FWJA 2Q5OA 5I4KA 4V0LA 3ZS8A 4O4HB 2V1UA 1VE7A 1ZVVA 5KX5F 1SVMA 2B5WA 1WZEA 2PRSA 4DM3A 3R3SA 3L43A 3QFSA 2C2BA 3QU4A 3H9QA 1TAUA 3TS1A 1XKTA 2ILTA 4K1LA 2IU6A 3WMXA 1IAQA 4EHKA 3GJZA 4WUTA 1NW9B 1NMYA 4RH3A 5E6RB 1EDBA 1WQ1R 5HIJA 3ZTYA 5JH7B 3L0PA 4QPJC 3EQ2A 4R2IA 1KOGA 1YZYA 3FPEA 3KP1A 3CPSA 3AQIA 2FSVC 3KQQA 3HU1A 1H5QA 4Q9KA 5KYXA 1ZJ6A 5LSAA 5BN4A 1CY8A 4GM1A 3O84A 5AVRA 1G8JA 2XQKA 4LDNA 4YRGA 2WINI 3PFWO 1QVGF 4CVNA 4NMLA 2A7XA 4F5YA 2JFNA 2V9PA 3QA9A 4LGVA 4V1CA 4HK4A 2XNCA 4YY3B 3VV2A 4D9EA 3VCZA 1J49A 3KKNA 5AVYA 3DMNA 1Y37A 1SZDA 1T2FA 3EVBA 2JRCA 2YX1A 3PYMA 1Z0AA 1P2SA 1XP5A 4GSKA 3MTBA 4JI8B 3O91A 4BVQA 2G04A 3ODPA 1PFKA 4NFSA 5TJ9A 2QAJA 1PGNA 1TKBA 2YZ7A 2PL9A 4AN1A 1H2AS 2VHJA 3QVOA 4JLOA 4WKGA 5L6MB 4HL6A 2OHVA 2VUUA 2GEUA 4LZNA 2XDWA 3L5KA 4R41A 4P9NA 1XZCA 4CT4B 1OOEA 2GVDC 3PENA 1UIMA 2V4UA 5KNBD 4M0LA 5D5HA 2HRYA 3BXEA 3I0NA 3RNLA 3ZXIA 2VJYA 3CLSD 2H08A 1U28A 4P33A 3VYTB 3CWQA 5HMMA 4J90A 2YVQA 1U9IC 5JARA 3CJQA 2V3CC 2GX6A 1YI8A 2PBFA 3A14A 3AHGA 3E9MA 4L0MA 3IODA 3VM6A 1P73A 1N5OX 1BFUA 1OH6A 3LLMA 3TB4A 3L79A 3SC2A 2PZFA 4UATA 4S12A 4AJ1A 3GVHA 4MUYA 1SBZA 4EFMA 1BHJA 1KI3A 4M86A 3U0VA 4EHDA 3L7LA 1H1TA 4RQTA 1UJ2A 3SNHA 1DEHA 4BO6A 4NYIQ 3AOGA 4OLAA 4QJIA 3NOOA 1ZU4A 2E4YA 2OV2A 4BQRA 1JFVA 1M2HA 4AROA 3LC7O 3SF8A 1XHLA 3RI3A 2EZTA 3D8NA 4PS0A 4MJXA 3BE6A 3A37A 3L8DA 4B3HA 2IPXA 1QX4A 3GJTA 5AK6A 3CVYA 3T4EA 1Z4JA 1V2HE 3B70A 2AHOA 2GJ8A 4LJYA 3Q8KA 2XUGA 5JXHA 2ZRPA 3I58A 1U1IA 3BA1A 3KYJB 4IGEA 5JZ9A 4PFJA 1CUUA 2I8CA 3DCIA 2Y05A 4OXKA 3K1JA 1CJCA 2VJLA 1ISJA 3LIIA 3IAFA 1V6SA 2IYXA 3PFNA 2VT3A 3PUIA 3OQ1A 3PSHA 2YWGA 4B7XA 3I55F 1MDBA 3PL1A 3PBKA 1OGJA 3KVOA 4L8WB 1KBOA 1XQVA 4M54A 4RZIA 4PRKA 1F17A 2WT9A 1IULA 2O2XA 3BDAA 3L1IA 3MFQA 1DAFA 2G88A 1GAWA 1O0SA 2GNOA 2GTPA 3I34X 2LW7A 3KR0A 2ZR7A 1CY6A 3PFGA 1F8XA 2A14A 2EF0A 4TOIA 4HMPA 5HE8A 1DDOA 2BI8A 1KS9A 4GGOA 1DRJA 1VPVA 1Y82A 2LP4Y 4EG1A 1IYZA 2B4AA 4Y1RB 2MWMA 5JAOA 4DKJA 4KPYA 3KIPA 3G2PA 1N8RH 1QGZA 2BGMA 4EYEA 1SGWA 3ORYA 5ITZB 3NHSA 3W5AA 2VT2A 1W88B 2I7TA 1TJPB 3IVAA 5AHWA 3SZUA 5EAZA 4LY6A 4MPDA 5CM2Z 2BKUA 2PMFA 1U04A 1TUGA 1JJVA 3ZVRA 4CM8A 2JLYA 4DA4A 3LX6A 2DC1A 3GLHE 4X3CA 1KVUA 2P6PA 2PL5A 2YRXA 4ZN6A 2AG0A 2PH3A 2Z9DA 1GIAA 4MI1A 5DPMA 1SIOA 5GJVC 3L1HA 4U0JA 4JFAA 2GD2A 2A59A 4QHSA 3L6EA 3LLVA 4U9IS 3G2JA 2ZS9A 1TZ2A 3UJ3X 4FBMA 3ZUPA 1L6RA 5IHPA 1NQ3A 4F9FA 2JD2A 5K4GA 1AKVA 5EP4A 2QRKA 5T67A 2OCXA 5FH9A 2AYYA 2NZJA 1IUKA 2AC7A 5KDDA 4RIIA 3LUKA 1Y3IA 4KQCA 3JWHA 4J2TA 2TSYB 1IEQA 2AIRA 3VPGA 3KR2A 4J76A 3JAMM 1GZ3A 3C43A 3HUTA 3C8MA 5TMDA 5AQ1A 5F12A 1OYWA 1P0QA 3ZU6A 4QBIA 3DLBA 2ZJZA 4BUJA 5FBRB 2ZRLA 4OJYA 4E4RA 5BMVB 1ZRMA 5K8IA 4H7JA 1CRLA 2P9HA 4H3VA 5IH3A 2NP6A 5KVQA 1G2IA 1R6BX 1QB7A 3BEDA 3VDMA 1DUIA 3ORSA 2IZOA 5I8PA 2HIMA 1MDFA 4FUTA 2FH5B 3VZPA 2HVYD 1JKJB 1HEUA 5I9LA 2VF4X 3ZOPA 3HEMA 2VJCA 3CUEF 1JBQA 1GT91 4JEHA 3FJYA 2B2NA 4C4SA 5FCDA 1Y5MA 1GEEA 2QM7A 4KGZA 4AWBA 1W36C 1C1YA 1K75A 1US8A 3ZWYA 1YIDA 1KI1A 1COZA 4EY3A 3BB3A 3N3BC 6ABPA 3IOYA 1UK7A 1UXJA 2A0XA 2M98A 2LNDA 1XNRB 3W9BA 3RYHA 4ZQCB 3GFGA 4LDRA 2E37A 3HSYA 4ESHA 4K5QA 2BKEA 2KPOA 1JEEA 1G19A 1G6OA 2HMYB 1CP3A 3BERA 3M8KA 4O2LA 4D9JA 4CKEB 5JNRA 3U49A 2XDAA 4J29A 2PSHA 2DFPA 3WK6A 2QTZA 1TAGA 4LV8B 4PSAA 3ESAA 4V1CI 3B5JA 4YCBA 3E2IA 2WWGA 3Q0TA 5CA1F 4MW0A 1QCYA 1UFVA 2JI9A 3P19A 4IOMA 5HGXA 3WRXA 4L4RA 2Z4RA 3CH5A 3DZCA 3FD5A 4JUCA 1EDDA 1EGQA 2ONCA 3VU3A 1VQ9F 4GT1A 5JLAA 4H3SA 3TTSA 3SVLA 3CC4F 2XTNA 1FRQA 4UHJA 1I0ZA 1JE0A 1Q2UA 3U7HB 1KDRA 3GUCA 2AJ8A 2ZIGA 4NTZA 2VYFA 1ARZA 4OQDA 2Q0QA 4EFLA 3GP8A 2OGTA 2H31A 4G8BA 1OQAA 4JDUA 1U0HC 2FG6C 1OT3A 3PG5A 1RTTA 2BUCA 3RS9A 5B4VA 2EFEB 1UANA 1H48A 4WLUA 4FWTA 1GDDA 3NONA 1ZH2A 1ZA1A 2HA3A 2ATEA 3MBOA 1TUEA 3KHKA 4YP1A 3CRNA 4LHEA 5J63A 2D06A 3QNMA 4FDUA 1SHUX 5LOVB 5ESRA 2JHAA 3ECCA 3ZU2A 2QM0A 3SX4A 1PWXA 3PQ2A 4QRDA 2PMKA 1T1GA 3SQXA 5BQ5A 3ROGA 1AF4A 2MSWA 5JSUA 4YP6A 3KSAC 1K5GA 1OYYA 4LCJA 1WDKA 3DXFA 1K0UA 2P2DA 1E7RA 1NMZA 9GPBA 1W8DA 4TTSA 4EFNA 2HFJA 1J6UA 1UFOA 1E79A 3WL5A 3WNDA 1SY7A 3EZ6A 4ISBA 3W5HA 3AEQB 1QYXA 3P9PA 2E4UA 3R44A 4QO8A 4ZDWA 4WDQA 1D9XA 3B3AA 3MT0A 4QARA 5CFPA 2P3SA 1DQRA 2H1OA 1YZQA 2J1LA 2YNMD 4K6MA 4CDMA 4LXXA 1I2MA 5IUJC 5B7NA 2X22A 3T3IA 2Y1OA 3LBFA 4EB8A 2IS1A 3I53A 4WESB 4GECA 3LWOC 3RG2A 1F3OA 1WZIA 3PC6A 1R5JA 3HB1A 3IKVA 1U0JA 4XIIA 2AJCA 4ZOLF 5KU7A 1I7DA 2R1UA 4J1TC 2QI2A 3TEMA 1EB9A 3DD1A 1E58A 2ISSD 4JNCA 1XVLA 2VHYA 2ZBDA 3HFJA 1XIVA 5FOVA 1USIA 2A9FA 3ZDYB 3MQFA 2HK8A 1AG9A 3EZLA 2O3TA 3SDZA 4CPDA 3ONWA 1L5YA 3K0CA 3V7NA 1VHQA 3DO8A 3OBBA 2NU8B 1E1LA 3UMYA 1BDMA 1IEWA 2OM6A 1FMJA 3ZY3A 4CMEC 6GPBA 2Z8YM 3PK0A 3T7AA 5EMJA 1VI2A 2VTBA 4NBRA 2C4UA 5LWQA 3IYLW 1QAMA 2D0DA 3EIXA 1KO4A 3NK6A 1OA1A 2IYVA 2P2CA 1L5FA 2IYWA 1RE0A 3REQB 3GEMA 4BO8A 1CD5A 3NBMA 2RB9A 4X92A 3R5HA 16PKA 3BQNB 3ZXYA 3CWCA 5DP2A 1V7CA 4FP9A 4WCDA 1V9LA 4TXLA 3ZBPA 4YECA 3ABIA 2XQVA 2HAEA 2O0MA 4MV5A 1KDZA 1JG4A 5LP6A 1VPEA 2IJGX 2JGAA 3I6IA 5ALQA 1XA0A 1PKEA 4B3DA 3GN2A 2V5AA 1EKXA 3ELWA 3H3FA 4IDBA 2W2MA 4X8OA 4D5EA 1EK0A 1XXHE 2NO6A 2LUOA 4FQ5A 4KX5A 4YT8A 4Q19A 1XRLA 2JDIA 3BZWA 5EWMB 2VZEA 9ATCA 1RJ9A 3OKCA 3RW9A 3KWJA 3BT7A 1DINA 4N47A 3WQBA 1Q84A 2P65A 2WAAA 3OPYB 1SKUA 1KAOA 1SO8A 2VNSA 1C80A 5KSOA 5JHHB 1ODIA 4G5RA 3ERNA 4QXQA 3E1KA 3EZYA 3Q8MA 4QM7A 2BSXA 1WZUA 5JBNA 2WG1A 3GLKA 4UNNA 1A8HA 3OVMA 3K3PA 2AG6A 1NI5A 3O0TA 4S1PA 1FSZA 1E7KA 4L2IB 1A88A 2JBAB 1HLFA 3PA8A 2ODTX 2XOEA 4OA8A 1EFVB 5H68A 2ZDGA 3ED1A 3LDAA 1VHLA 3KT6A 4RORA 4UXJA 4FXOA 4D9NA 2RFLA 5L3QA 2O8FB 5K8JB 1IN1A 2CBXA 3LHDA 3K0EA 3I05A 1TLTA 2FJPA 3MCWA 4Q1FA 5C37A 2CN1A 2IVFA 1V8ZA 2PZGA 3LDFA 4ZALA 1P7WA 4Q9JA 3WB9A 1L4MA 4C4XA 3MN1A 4H1HA 3U81A 1QTRA 3G1TA 2ZBPA 3HJFA 3IUSA 4MKGA 3U0BA 4PG7A 3AU9A 2Z1EA 4QPNA 1ES9A 2HSEA 5F33A 4ATNA 3BD6A 4EA7A 5JHGB 3H5OA 3RS2A 5GANK 4KW7A 1IB6A 2EKQA 2ZVYA 1Q14A 2NZXA 1KYXA 4DC1A 1NNLA 4CKWA 2ZBUA 3M1IA 3JZAA 5CBPA 3GPLA 4XH9B 1N6IA 1SAYA 2VPQA 4UOZA 1Q22A 2X76A 4MV3A 1X52A 1QP4A 2YY6A 4PYLA 3ETLA 2OLEA 1NJ1A 3ZCXA 2PZMA 4Q7LA 5FWYB 3T61A 4HAWA 4RHUA 2OWDA 3QBDA 1NM5A 2RHTA 3KHSA 4TROA 2P91A 1P7VA 1QK3A 3VR6D 1ILEA 3KSUA 3TD6A 1YCFA 5JCXA 4K9KA 3FNIA 4L5CA 4ZAWA 3VZDA 3WL8A 1T5OA 3FH0A 3IAEA 5CFZA 4O33A 3UPTA 4MIYA 4E2WA 3AQ4A 1P77A 2FPIB 3W0LB 1YZ3A 1Z2PX 2HWWA 5B2EA 3KAQA 4BMVA 4IH4A 2RI1A 4FFBB 3S2GA 1H42A 3V1UA 1E3EA 3N2KB 4B17A 4D79A 1P75A 5AXCA 2JFFA 4DV5B 1IMJA 1RXWA 3R3HA 4EIWA 2CMGA 1G8KA 5A7FA 2AS0A 4BBJA 4LJAA 4DJTA 3U4MA 3P0HA 5IULC 4V0RA 3PFHA 3UA3A 3TECE 3LQ1A 2ENWA 2MHCA 3QVLA 5CD1A 1X38A 2J5XA 4DUGA 1N78A 1RA4A 4WJKB 1AQLA 1ZXXA 5BVGB 3A6KA 1N0UA 4GNKA 4JUBA 1JUDA 1C7QA 2C77A 1KI7A 2PKEA 1ZO8A 1UBOS 5CGZA 5TS2A 1JTEA 3IE0A 1PG2A 5ADWA 3NOVA 3ISVA 4CFZA 3GG9A 3DE4X 4FYMA 1N6OA 1NIJA 2CJYA 4OLFA 5LZ5A 1UKZA 1UPTA 1RYEA 5E3IA 1FXUA 5FUBA 1CFZA 2JD0A 3VR2A 4PANA 3KL2A 3PXUA 1EWVA 3PQDA 1LQ2A 5CPBA 4QPPA 1EAYA 1HNNA 3WWEA 2K6GA 2W70A 2JAHA 2VIIA 1KY4A 1I3OA 3E0QA 4ZVSA 3QYJA 2J5RA 5KX5B 4RVDA 4UCWA 1DBQA 1EJ0A 3R2JA 1KI9A 3H9GA 4GQAA 4U7FA 4EA9A 4FW9A 2PXAA 2W2QA 5EE0A 1NQWA 1DBRA 1DHTA 4C5AA 3CUYA 4QYMA 3KEGA 5IJXA 3SM9A 1C8BA 1JIIA 4MNTA 1Y3FE 1Z0UA 2G9NA 1SN7A 1E6WA 4G4GA 2JVKA 3D43A 3R3VA 1ETUA 1M8FA 5DGDA 1Y3AA 3K2XA 3O95A 2OUIA 4HXGA 4IV5A 3ZWKA 5JZBA 3FOFC 3ND8A 3HJNA 4XX0B 2QE6A 3TR6A 3K1YA 5CB8A 1KERA 4Y9SA 3FWKA 5C1OA 2ZE8A 3AG5A 4N0PA 4A6EA 5JJLA 2IOHA 3AFGA 2CK3D 2WM8A 4V0SA 3HY6A 4CMHA 3KQHA 3DE2X 2Z57A 1K6JA 4MGHA 1XMOB 1FF9A 4BFCA 5IBQA 3UMJA 3AO0B 5JAPA 1Y63A 4IWYA 4DBLE 4HDKB 1J2TA 1F0NA 2GT1A 3IS3A 1X7HA 1REQA 2AG5A 3NWBA 4OHFA 5BSEA 4ZV7A 2J0UB 2EKBA 2J4CA 4R84A 1GAJA 3G7UA 4HDOB 4I2VA 1GN8A 2DEUA 1C9MA 4GOJA 1CDZA 5DHUA 3GLFE 1N75A 1W9MA 3LOUA 3M9WA 4WADA 1KNJA 3KZOA 5AK3A 5HK8A 5BQPA 2P1DA 3J7TA 3WX0A 4J7AA 4AO8A 2EFJA 1RLJA 2HNBA 5CEEA 1LRKA 1PUXA 3GVPA 2ACEA 5E1MA 1CT9A 5MN6A 3CXUA 5ERXA 2K4MA 5IAEA 4BNWA 3DR5A 4V0KA 3IP6A 3PU6A 1CUCA 3BL6A 2I6RA 4HMOA 1E6UA 1SK8A 2PU7A 3HO8A 3E22A 4PC7A 4UBLA 1NF2A 3ELCA 4FDLA 3BK2A 1GCIA 3HV0A 1SOMA 3QUBA 3V34A 1DC3A 4I4CA 4AK9A 3EY4A 5B1EA 1XMQB 1LDBA 1R0SA 4OMFG 4EMUA 1IHXA 4QQKA 1L7RA 3H5RA 1SVUA 1WCWA 1WCV1 4S0XA 4WXYB 4N3AA 4JBXA 2QRJA 3H18A 3GELA 4OHUA 4QHTA 4RZXA 3RG8A 4DLXA 1UFYA 5F1PA 2XTAA 5CIYA 4BNFA 4NHEA 2IK8A 3VPDA 3IEMA 2P0YA 1ZKMA 1UKYA 1OUMA 3NORA 4MDEA 4D1YA 5IUNC 1I7NA 1E3TA 3G5MA 3NWOA 4IJ5A 1P1CA 4QYIB 2WY2D 1OH7A 4NENA 1JMVA 5K6TA 1E59A 2PR2A 3NW9A 3ITDA 4IJQA 3RRMA 1V5GA 1XCPA 3X44A 3G23A 1OXMA 2B6HA 2AXEA 4R0NA 4X41A 3S1AA 3KQLA 1SG6A 3L7QA 1RXUA 3GCGA 1KMHB 4NC9A 3QF7A 5GIOE 1RC8A 1V5EA 2WRZA 3ZWNA 4E5YA 3SFVA 4U39A 1EFPA 3LT5A 3B1VA 1FFWA 1JDNA 1XTRA 2PXCA 5DGCA 3RTDA 3ZDFA 4C20A 3ZCVA 2AMLA 2HRQA 5JNWA 2PMEA 1F0PA 3OEHA 5HJ2A 5FNVA 3S29A 2CHGA 2FQ1A 4Y2UA 5KMGB 1PF5A 1N4AA 4BRZA 3F90A 3E7FA 1OBCA 3GJSA 3PEUA 5GGXA 1PQWA 4CDNA 4L73A 1WQ4A 4YXWD 1PZXA 1CJVC 3DDWA 4C29A 3FTDA 5MN4A 4TLCA 2WD8A 5L7WA 1O97C 3RC3A 2PO5A 5DKFA 4W6ZA 5J3JA 1GAEO 5LP1A 5JO0A 1NMQA 4KKVA 1ZGZA 3WLIA 3R09A 4JJIA 1JR2A 3KKOA 1U0FA 5CLGA 2PS0A 1ZVQA 1STOA 1SQGA 1QYCA 4FSXA 4YB8A 2FPRA 1NMEA 3M70A 2ZUTA 4DJFC 3UV3A 4UOQA 3ZIDA 5HZKA 3RAGA 3VSBA 1VPWA 1DKNA 3E3OA 1EBFA 5KOIA 1NTRA 4JP8A 3ZCRA 1X13A 4CM9D 1BU5A 2RJ3A 3FVVA 3HVKA 4BQOA 5IX8A 2P4QA 1DZ3A 4B62A 1IVYA 1ULTA 3S40A 4ZV9A 4CI9A 2C7PA 1ODFA 1WVIA 4MV4A 1V4BA 5JZVA 4D0RA 1GU0A 1GR1A 2VSYA 2WZBA 4TVKA 3ZW8A 3AEYA 2H00A 3L01A 4EHHA 2E5LB 3NVIB 4P32A 3L40A 1WMFA 2P9ZA 2FEKA 4MRVA 2CJXA 4HGNA 4FGKA 5JUWA 4EITA 1ZM4A 1VRVA 2ECOA 4E5KA 1ONNA 1M2OB 5EJGA 3GJRA 1U5BA 4QFMA 3DDHA 3I9V1 4C87A 1YBFA 2VZLA 4D45A 4M60A 3T1YB 2XRYA 2CLDX 4HNQA 5CH3A 4C0HA 1G20B 1KQGA 1IV4A 1KORA 1CUVA 4J3JA 4Q3AA 3HYNA 3WJRA 1KPGA 1HYHA 1ENYA 2ZB3A 2XTZA 3HXMA 4UVIA 4MW1A 5EJIA 1AK1A 1JF8A 3NOQA 3L6UA 3PSAA 3VMFA 4YRZA 2O50A 1KAMA 4LDZA 4JUIA 2AFHE 1A7UA 4P3YA 3G82C 5AKXA 2CL6X 2D1FA 4K81B 4L9AA 4E7PA 3NS7A 1CZUA 2HLDD 4W9RA 1P60A 4RPCA 2BF7A 3NAQA 1DJOA 1IY9A 2BEVA 1NE7A 4QOEA 3VSDA 1MIOB 3LPDA 3PFKA 4OLJA 4YRQA 5GONA 1KI2A 4JROA 4DYDA 2ZVPX 4RHXA 3E1YA 3F74A 1RWWA 4IDFA 2WD9A 1OV4A 5JAQA 1Z2NX 4I46A 2XMPA 1UBHS 4DBZA 1KZ4A 4UHDA 4YMLA 2WKWA 1PW7A 1XTQA 2CFTA 3O2SB 5B3AA 1OXKB 1EVQA 2QDXA 3FCEA 4Z1MD 3OCZA 3W9YA 3FNQA 1M0WA 1WSWA 1WXGA 1NE2A 2BJVA 3AUYA 4I1OA 5H02A 2ALJA 3IXMA 3IEWA 2G07A 2D5CA 2XB9A 4IYRA 5GINE 4ZCTA 3CBQA 1DG9A 2VSXA 1XDUA 3DZ8A 4NX2A 2WZDA 1QQBA 1EUZA 4CKBA 1ADYA 4UPEA 2A94A 1TKAA 4JQSA 1XTTA 5BW8A 1S7CA 5HOQA 1PS8A 1OI7A 3LQ4A 1VQOF 2JIZA 3O4FA 4V2IA 3RUEA 4B1FA 5HM6A 4JD5A 1FNDA 1K4YA 4B76A 2ATVA 3I61A 3RASA 2EGHA 2HPHA 3ERCA 1KDOA 2JL1A 3BXPA 3WIEA 1JE1A 1GGMA 1SUEA 1D2AA 1GITA 1WE2A 1GKUB 3DBVO 1H7MA 4BV3A 2QX6A 2ZRKA 5A3RA 1U9JA 3OSUA 1PDWA 4LJ9A 2JIPA 2VPPA 1PN3A 4X84A 3DEYX 3H4VA 3GWZA 1OLUB 1J1UA 1P3DA 2G67A 3CURA 4G8JA 3F0FA 1R88A 3M84A 4YYZA 4OBEA 4RLHA 1FRFS 3V6LA 1S3IA 4IXMA 1Z8HA 1USWA 3VOTA 3HM9A 3BIXA 4NPCA 3O8QB 5I9BA 2YFQA 5AJYA 3WYDA 2GGSA 1JAHA 3ELYA 3ZW7A 3A25A 2Q45A 2REQA 5BOSA 3GDOA 5I01A 5KPDA 1GPWB 3MUOA 4H31A 5K3AA 1QR6A 4K6HA 1QORA 4MVJE 4X64B 1B76A 4D9KA 3OWOA 4Q6WA 2CUZA 2QRVB 4MGYR 1FVXA 4N6NA 4YMWA 1EK6A 1JQDA 3R6DA 1WU7A 4Q6BA 3T1TA 2CLFB 2IE0A 1AMNA 5A02A 2WFLB 4FOPA 1GGHA 2W5UA 1Z0FA 3LBYA 4UVEA 3ZP4A 3WKAA 1YRYE 1MO4A 1T2DA 1P74A 4F9EA 4ZOLB 2W58A 1POXA 3EDMA 3CS3A 4UVGA 5EJ2A 3TKAA 4BY9E 1FS6A 2ACWA 4NG4A 5DV9A 1N2CB 1LC0A 2EAUA 2ZRHA 1VQLF 2WD7A 4HPWA 4F93B 2XIQA 4J4BA 3PJGA 3I12A 4ANFA 4ILKA 1QHEA 2BGLA 4DR4B 3ODGA 2BD0A 3B6KA 1E9FA 1MHPA 3E5HA 5ENZA 2HRDA 4MULA 2OM2A 1PYGA 1JHDA 2OXCA 1Z17A 4BLPA 3TE7A 4AL4A 1IZ0A 1P2UA 2F3UA 3IV6A 1AURA 5D87A 1KDTA 1P2FA 2OAEA 3AOEA 1RVV1 4PQEA 4U5XA 3LBHA 4G2NA 5DGXA 3OLXA 3WK5A 1IHUA 4RA6A 1PU2A 5AHOA 1SZQA 3IVGA 5AVZA 1G8PA 4AY6A 3OJ0A 2WSSA 3LMKA 3TZCA 4WPGA 3A1WA 3SSMA 4XXHA 3QEBZ 3JRXA 1NBAA 1SRRA 4XSVA 2YICA 3CPWF 2QGNA 3NANA 4RDIA 1LZKA 2BDTA 2VLBA 1W6UA 3SHFA 3C6QA 2XGGA 3UPDA 1UXHA 3IIKA 4F92B 1M7GA 2QYOA 4HZGA 4GLOA 1RQPA 3S3TA 4Q48A 1FSGA 2BT4A 2W2LA 2Y1DA 3V48A 2PS9A 1TA9A 1NU6A 3H5LA 1E2MA 2HUPA 1R10A 5CCDA 4D4LA 3OT1A 3IEIA 4OHZA 4K8RB 3SVZA 3DMGA 3FCXA 3HDHA 4G0ZA 2YVKA 1GXSA 5DGTA 3SZRA 4AIIA 2XDQB 4IFTA 2BE7A 4KIJA 1XA4A 5H9WA 5KDLA 2REXB 4MJLA 3IHKA 4N65A 2V4MA 1N2EA 4KLAA 3UW1A 3CC8A 3BTUA 5DYIA 1UAGA 3ICVA 3TQQA 4OB8A 1BOFA 4JODA 3IXQA 1JIXA 3H65A 1NAIA 2W2NA 4HQKA 4TTPA 1G5FA 2DFNA 1Z36A 3MCQA 2H1LA 2N75A 1RZVA 1SURA 1VSQA 3E7XA 3PF9A 5BT9A 5CVDA 3X1WA 4PZPA 2VHEA 4ZQHA 1SWWA 2Q9BA 5BOVA 3RUIA 4I3FA 2PMWB 5DM0A 8AT1A 3AC0A 1X87A 1PGOA 2WTAA 2XD4A 1FMTA 2JLAA 3W1WA 3BFKA 3OE5A 5DM1A 3AM5A 1E6LA 1RW4A 5A9SA 1MA0A 4M1QA 2E5WA 1ND5A 4XFKA 3UJ7A 2PKCA 4JWTA 4L75A 4CEJB 1U0SY 4MI9A 1KFKB 3DOIA 4E31A 2HT1A 2VYNA 5THXA 1OR8A 3GGPA 1UPFA 4DWOA 5HS4A 1KBZA 5ALHA 5BWCA 3AJEA 3KLMX 4RF2A 1E5XA 1OW3B 3AIKA 3MMSA 1NXSA 4G65A 4D6XA 2OD9A 5H83A 1BU8A 2I76A 1FJ2A 2OV1A 1QV9A 4Q34A 3QITA 1T2CA 1WCYA 2EATA 5CFOA 3LXRA 1D4OA 3OEWA 4ZCSA 4S05A 4A1OA 1J8VA 3ZV6A 3K9HA 4HNHA 3WHKA 5B2ZA 1JHXA 2XQJA 2ZYWX 3QJYA 4JLDA 4NNJA 4UBJA 5FWNA 3G88A 1NI4B 2O5CA 1HPLA 2CDRA 2GJSA 5KDOA 3PF8A 5AW8A 2C20A 2FVYA 4F4FA 4DVGA 3UK0A 4O3FA 3ZHXA 4D3FA 3OOEA 1KTIA 1ACMA 2JLRA 4LE0A 1Q0HA 3DZDA 1M34A 4M0FA 721PA 3EVAA 4IWXA 3ZTTA 2GA8A 4V0QA 1AXEA 1MJNA 1KYWA 1J20A 3S06A 1AKYA 3UK6A 2FLWA 3WQRA 4DJAA 1P2BA 2OK7A 4V2UA 2D5BA 1B2LA 5HIKA 1SHKA 3UXYA 2EFHB 2FWIA 1FEZA 1K68A 2XUFA 4I1YA 2UKDA 3T3DA 4QU0A 3IAM1 4MEJA 3AR9A 4R83A 1C5KA 1MO6A 1Q7CA 1XD2B 3UFXB 4D3SA 2AWNA 2L26A 4EA8A 1O95A 2XXJA 1AK2A 2Z58A 3ER8A 2FGKA 2AMYA 2K7FA 3NNSA 5L3VA 2YQ4A 3QWIA 3SR0A 1UXGA 3SIUA 1PJTA 1ZGCA 4U2BA 1YQ9A 3FSJX 1UEXC 3JRWA 3O1HB 4QHYA 3TZEA 3PHIA 3GLGA 1RKUA 1UQUA 5K99A 3FPFA 4OMCA 2WMNB 1B6GA 4HEJA 4P81A 4YWHA 4ZODA 1C1HA 1JDPA 3DOEA 3DMPA 3FDIA 5EIBD 1UP7A 3A2MA 4M9RA 1P31A 4TMWA 5JAUA 3L7DA 1VMDA 1TT5A 5JAIA 3EAFA 2IYFA 4LRWA 4RADA 1YKGA 4GL2A 1T9ZA 2AQKA 2IL1A 5KTSA 5FAXA 5KYNA 2AX4A 3QFHA 5LUBA 1TQHA 4FMDF 3TIXB 4BRUA 5ILOA 2AJBA 2HV8A 9MHTA 2YW9A 5LQSA 2GEVA 2F8SA 4MA4A 3AP3A 2JI7A 2QR3A 2R84A 1T91A 2C03A 3LE8A 1CVIA 3EDOA 3ZHRA 4PLFA 2O06A 4DABA 1FNSA 5DTJA 3DE5X 3H4TA 3Q98A 3CF4A 2GF2A 4PU0A 3DR3A 4RX1A 3LRTA 2ZAIA 4CN9A 4WOBA 4URYR 4BKOA 2VUHB 2XCTB 4AX4A 1DKRA 3CE6A 3NKFA 4HFRA 2QX9A 2C61A 1Y8AA 1CSEE 1P2GA 1XBTA 3QUQA 4ZAZA 5AUQA 4EH1A 4TTTS 4DDUA 2VT7A 2A9QA 2OCPA 3DVAA 4RHAA 1KI6B 3JQAB 2HADA 1O96A 2X15A 3OOHA 1PX0A 4LYDA 3ZTWA 3X2EA 1YC2A 3W78A 4ZO6A 1CR0A 5LJLA 3O38A 2YMLA 4HNRA 4MOWA 4MQBA 4FK8A 3WGZA 1RYYA 5T6MA 3T5BA 1CK4A 2N3ZA 3O4VA 2FXIA 5K0SA 3FHLA 3TQSA 3DCYA 3CEPB 4OOFA 4QBFA 1I6LA 1SXPA 1C0EA 3LA8A 4GSYA 3M1LA 2RHWA 1MC8A 3OMWA 2WABA 4IIXA 1M6WA 1XRPA 5LPNA 1WHTA 5TEVA 1V8BA 3BORA 4WXPA 3PUVA 1E0DA 3CZCA 4P98A 3WB0A 2Q29A 3TTUA 4C88A 1I94B 1KRXA 1BMFD 4M1WA 4YJFA 3F6YA 5BRAA 1T5HX 1X80B 2ZJAA 1EK1A 3G17A 4AJ9A 1QBGA 2V9CA 1E18A 3DGFC 1KMNA 3PXCX 1T34A 1XCJA 3CZQA 3M6XA 4RULA 4MQEB 1KPIA 2V4ZA 3CM0A 3Q2IA 3PITA 3SHWA 3GTZA 4M98A 3TL2A 1XQXA 4LCKA 2IQQA 4F4UA 1T8WA 2PSDA 4XARA 5EZQA 2I8LA 3TQTA 3ZE1B 4L7QA 4MVWA 2RBKA 4NCIA 3UB3A 4Z51A 3FIJA 1DAGA 1QRRA 1H47A 1NNEA 2AOWA 3KTDA 3PFBA 1S9HA 3BWDD 5K0NA 4DILA 1RMQA 5CB4F 2BGIA 2HA4A 3HXQA 4I1IA 3QNWA 3WBFA 4W5JA 1VPTA 2PV0A 2RKBA 5IJ0B 3HA5A 1QO0A 5FP0A 1QIDA 1PUIA 5KYYB 1TYDE 3M9LA 1NGSA 4XX1A 1WB5A 2CFCA 1GPMA 3LVBA 4IRXA 4TLLB 3GNQA 2G25A 3BAFA 1NSFA 4FHFA 2C0QA 2FZ4A 1EGAA 5HY0A 4GH5A 2QJFA 4F1KA 2A5LA 5F21A 3S0YA 1FFYA 4CEIB 2PLFA 3C9RA 3SQMA 2GXSA 3D02A 3EXIA 3OTQA 5EIOA 5BV7A 3F6RA 3B82A 1U11A 4P92A 2J3EA 4M8IA 4EF5A 5K8VA 2QXYA 1BMQA 1PSWA 3CCLF 2DOKA 2W48A 4Z4FA 2CB9A 4X5OA 1CLUA 1J21A 1HL3A 1M54A 3FFWA 3JVDA 1AA9A 4JLAA 4IMIB 2XUZA 3JAWB 2HQSA 5T8KA 1G8SA 3K71B 1PJRA 2VKQA 5DK4A 1P0IA 1FSFA 4WX2B 4HAVA 2C94A 4URXR 3QLUA 4CLRA 2Z2IA 3NVKI 4PFKA 3LDTA 1RAFA 5DWDA 3WAKA 1MO3A 2DHDA 4I8XA 1VCOA 4OQMA 4RZ3A 4EL5A 4S1NA 4TYYA 1NN3A 2OPBA 3V2GA 3GP5A 1RC0A 2FZGA 4YI3A 3TTWA 3KB2A 3LPCA 1I4LD 4KR9A 4NI5A 5HOEA 3AEKB 1UF9A 1P91A 3LQKA 1L1QA 3FN4A 3C9SA 3LI2A 2HJHA 4YUWA 4HGPA 3NRBA 4BC0A 5LQNA 3RS5A 1FX1A 4C3UA 2ONKA 1CLEA 5JMOA 1QX3A 4WOCA 5KYVA 1Q2XA 3COPA 4B8WA 1R6AA 3QVKA 3NHUA 1UDRA 1FYVA 2H11A 1VSUA 4G81A 1HE4A 4RM2A 5AI4A 4WKNA 2MINA 3FPLA 3T3NA 4O4HA 2ZROA 3AGPA 1SIUA 2YOGA 4BLQA 5EUMA 4OJTA 1VXRA 3M4SA 2D1SA 4XJTA 5KTMA 1KKUA 1TO1E 3USCS 4M1YA 1LVGA 2JEOA 4GGMX 3WPWA 5AKZA 4C2UA 4U5QA 3VTFA 3OESA 2WZQA 2DFKB 4C6TA 4KITB 3SQNA 1I30A 3C45A 2HPZA 5EYPB 1XTIA 5A3SA 5H16A 3DHVA 3ILHA 4XI9A 2J30A 1MNAA 3OE7D 3D1JA 3HWX1 1Q44A 4OHCA 2XB8A 3FY4A 1ISIA 1Y1SA 1I6KA 3N2GB 2H7YA 1IDN1 1R64A 2BGKA 2GR9A 4REQB 1WSBA 3RANA 5EUBA 3TE6A 2JGDB 1BCRB 2B83A 2AJLI 3H6HA 1QWSA 3LP5A 3GRFA 1A77A 3H5NA 4X1KB 3DT9A 3L7BA 4J94A 4MGKR 2YN4A 4ZAGA 1C9DB 5EVCA 3WSWA 1M1NA 3EIEA 2B61A 4N7JA 4EFKA 4JL5A 1Y8QB 1M1YE 2JS7A 5AKJA 1JSXA 5EINA 3WXBA 1I1QB 1T13A 3NT5A 1QHNA 2GLXA 2Z5FA 3AKDA 3JYLA 1U8FO 1B93A 3V1LA 3ZU3A 1GNQA 3O8DA 4C82A 1M8JA 1TLLA 1JY8A 1LPPA 1B8VA 3FM9A 1HKUA 4NV0A 5T64A 3TEJA 3R74A 4TLMB 3S99A 4BP8A 4B85A 1DKLA 4EUKA 1T1JA 4TWJA 3UMSA 1VL1A 1W87A 1O54A 2O2SA 2H7VA 5IK2D 1U2EA 2OV8A 2Z98A 5EIHA 2PQ6A 4LK3A 1C1XB 1RXEA 4HNGA 3VO8A 2QA5A 3TLMA 3RLIA 4OI0A 2EL7A 3FD8A 3GEDA 5CNIA 4XR9A 3FWHA 3G8DA 1NBMA 2WJ3A 1KE2A 4OHOA 1W59A 2JGNA 2O8VA 3BBLA 2NV2B 4KRXA 5IABA 3AOEC 3ZC3A 2YXZA 2A1UB 3DMHA 5UKDA 3ICQB 1WBBA 5H81A 3VAYA 2DUNA 1Z37A 1FRNA 2XHZA 1QYVA 4K9DA 4C4OA 3OJEA 2DRIA 1JG7A 3B6NA 2HSZA 2PBLA 2QQ0A 2OZEA 1WA5A 3W1EA 1CPYA 3N5KA 4HLDA 2V7QD 5BSHA 2PXHA 4IDCA 4QTXA 5FL3A 3A1NA 3BH7A 4B4OA 2Y66A 4ON9A 1KFJB 3P2KA 4RIGA 3TRDA 5EB1B 4KV7A 5A5EA 5G1PA 1T0UA 2WJYA 3W6PA 3ER9A 1Y33E 4YR9A 1CE8B 4QA9A 3RUHA 2LGJA 2PUEA 2NTJA 3P2EA 4KBFA 1XMSA 4AZSA 1YO6A 2JHCA 2RSLA 1T5LA 4CG1A 2QY6A 3IRUA 4LWQA 2F8TA 2GHTA 1E98A 3QU5A 2HSGA 4LHSA 3SEZA 2ZIXA 4KDCA 1CVLA 4D9GA 1QD9A 1X7DA 3IOEA 4K6KA 4PTYA 2BC9A 1LTHR 4GI5A 2CHSA 4NVRA 1FY2A 1E0KA 1G8YA 5DYTA 3ZI0A 4RZQA 3R7NA 1Q17A 2CVHA 2QP3A 4CR8A 1VL2A 5JXGA 4FI3C 5E4FA 2JI6A 2YUTA 5ALGA 3EAGA 1U3TA 3HJGA 2RC6A 3MRXA 4HH1A 2A5YB 2DT8A 2H2DA 4FYVA 3ZJ5A 5GZ3A 3BDIA 3NTXA 1H4SA 1JAYA 2FQXA 3CPQA 1RZ3A 3OE1A 2GO1A 1KFEB 1NN1A 3HL4A 3KYDA 5TGZA 1HOTA 1VBMA 3OOSA 4DPMA 2WKPA 3QP9A 4M7OA 3FHCB 3DFFA 4PPNA 1EZZA 1VKJA 1G0NA 3OPNA 4GOMD 4EW3A 5I7FA 4JBWA 5LA6A 4R05A 1CUGA 3R3JA 4EJFA 3OJCA 2RAUA 2IY8A 2L19A 3I2HA 4DA7A 1TB4A 5EJ6A 4S2EA 3VDRA 1PX2A 4YRLA 5JANA 2QSUA 2I34A 4X24A 3ZDAA 1SOVA 1N5DA 1NPTO 3JD0A 3KQVA 4X94A 4PN3A 2Z4TA 4EHAA 2VF2A 3ADOA 2IS4A 4M37A 2IPLA 2LBXA 3O7MA 4OIMA 1N5LA 2HHHB 3CKKA 2VXOA 3G2KA 4QSHA 4DNPA 1SMKA 2ALEA 2F9MA 2Y1XA 1A5SB 4XGRA 4R5MA 3KKKA 2OTLF 1NVKA 1YZTA 3K4QA 2ZVDA 5KKCA 4J0EA 9ABPA 3LX4A 4BPBA 4C4YA 3K0KA 1JVBA 1NWCA 1PGJA 1TA4A 4J03A 4UASA 3T5CA 1FZTA 1QGYA 2QJTA 4HLCA 1QQAA 1VH8A 4YRRA 1YI2F 2HPAA 1DE0A 3PA6A 3AJ9A 3C8ZA 4X3LA 1UFRA 1A2QA 4AJNA 2WHYA 1P7ZA 1CJSA 1R8YA 5T3UA 1U02A 2W22A 1WOMA 4DPKA 1QGOA 4XLTA 3E6AA 3JQ9A 2GKSA 3R24A 3QXJA 1O5OA 3DKPA 1AC5A 3DEJA 3ZBUA 4Q4AB 3ZV3A 5A0TA 4IVPA 2NUTA 3V2IA 1RZUA 4B7AA 2EQBA 2OESA 2HX1A 1DC6A 4QULA 3GAFA 3S8MA 5D86A 3TSYA 4B32A 4BFXA 1O95C 1OFGA 3OOWA 2PT9A 3CR3C 1IN8A 5GMOA 4KU4A 3CH6A 1PLKA 4J6EA 4X6UA 3OLVA 1LPSA 1CB0A 3HJAA 4WWHA 3SBXA 4FB5A 3OO1A 1VQ1A 4DTIA 3Q9NA 1XLTC 2Y27A 1FPQA 2GD1O 2ZLBA 1Y1RA 1JKMA 4WT7A 5I51A 4OATA 1GRVA 2HT6A 3FSRA 2NG1A 1VQ8F 3K94A 5ERGB 3TUZC 4C4PA 2J0SA 1TO6A 1KD1H 3TXAA 4KP7A 1H69A 1QV7A 4TXJA 5MF6A 5TNXA 1YTUA 4H7PA 3UMVA 2C2MA 3EPRA 1AKTA 4CDGA 5BWBA 4KIGA 4L02A 3QE0A 3R41A 3OAAD 1P4HA 1T9CA 3PQ6A 4LN1A 2Q9CA 1C30B 2QLFA 3T1QA 4JXZA 2WUEA 4LJSA 3UFBA 3GR6A 1Q92A 2Y1KA 1ORDA 4LNHA 3RRFA 3V9AA 1GILA 1I51A 1QHHB 4ZO7A 2JCBA 4U7PB 2AZ4A 4QXPA 3KELA 4TZ0A 3RSSA 1CERA 1T43A 4OAOA 2GEKA 2PQ2A 2I9KA 1LTKA 1NVUQ 1I7SB 3I39X 4K8OA 4CIDA 5BVHB 2BHTA 1QMGA 4HDMA 3ANSA 1J22A 1K3TA 2BMWA 3VPAA 1ACJA 1FSSA 4M83A 4QTYA 4B83A 4LOAA 2ZW9A 4OMDA 4P08A 3B60A 4JBNA 3L7OA 5FL7D 1P80A 3A1CA 2J08A 1X0XA 2ECPA 3DD5A 3OQ6A 1NDQA 2P6MA 3JASB 2FV8A 2J8ZA 3LOQA 2YIDA 4ZO8A 2DR2A 4A8JB 4M8SA 1XDBA 1JQLB 4M2LA 4M21A 2ZIFA 4CQMD 3VC1A 2NSHA 2HF2A 3R7SA 2RKWA 2P79A 4KI0A 3G7SA 2H8KA 1T2VA 1XVTA 5LNK1 1NJ6A 3IBTA 3RYTC 3AUXA 2BEUB 4MUKA 8ADHA 1IVSA 3J7AC 1SXHA 2V65A 1JHQA 3BBPA 4L9WA 5LDDC 1W2GA 2YC4C 4DANA 2ID9A 5JRZA 5IVHA 2GZDA 2AUTA 4UHCA 3V2HA 3ACDA 3H7AA 1J8QA 2M6LA 4I4TA 4L50A 3HWUA 4HPXB 3OCCA 2ZR8A 4X85A 2IS6A 1YD7A 5EHIA 5EFOA 1Z5ZA 4FFRA 3QX9A 3KUXA 4LWPA 5IM5A 5IG2A 3H8WA 3C3EA 4H6VA 1VBNA 4YJ2B 1IOZA 5K3FB 1JEDA 1JPVA 4YV0A 3KZCA 4HQFA 4IVNA 1KWGA 1Y6QA 2QTTA 2XUHA 5FFNA 5BQOA 2Q3BA 1AT1A 1GTVA 1S01A 3QTYA 4HV4A 3GH1A 5BSGA 3BM5A 3DV0A 5HM8A 5F3WB 3LKVA 2R2GA 2IPOA 1E5TA 1ATIA 3HCBA 2Z5LA 3UWPA 3MRSA 5EKDA 2C3UA 1E2QA 3BD8A 1K3UB 4PS1A 5BYKA 5C7YA 2O8DB 3VHXA 2PHNA 2GBGA 4BVJA 1QLHA 3R76A 2NU8A 3B2EA 2AVDA 2HFKA 2VP0A 1OHHD 2I22A 3JVEA 2M6SA 4P93A 1YFZA 4U63A 4YAFA 5JCJA 4LMAA 4QT0A 5K09A 3CW8X 1A1SA 2PZKA 2G5GX 3A9CA 2R85A 1JDTA 4ZREA 5MGNA 1S1CA 2F3TA 2ZI3A 2G0NA 4Z4HA 4G09A 4I7EA 4XW2A 4XCVA 5I8WA 1NXTA 2UYHA 1OJLA 1YZFA 5F3DA 3ESXA 4ETMA 2Z56A 2QMOA 1CF9A 3GA0A 2QHXA 3HBLA 3RE1A 2BKLA 3AJ8A 2A4KA 1VJRA 2VDPB 4NQZA 2G9ZA 1VMKA 2MYPA 3PEEA 4EPXA 2YN2A 3G2NA 3FSGA 4BX8A 1G21B 1OAPA 1JLMA 2CDCA 4K87A 2HMAA 2CY0A 1QGAA 4RHFA 4X00A 1W2HA 1DAMA 5BR4A 3D4LA 3VIUA 1KYTA 3O9VA 2R6CA 4A8JC 4B4UA 4CL3A 3UAWA 4EGSA 1EFTA 4OI4A 3LFUA 4IXTA 4PAQA 2NV6A 3U39A 3R0QA 1UBMS 2QTVA 4FMDB 4PC3A 3LO5A 2GZRA 1DL5A 2FP4B 2WI8A 3NBXX 3Q5DA 4HB2A 3WYAA 4IAOA 6Q21A 1B6SA 2IT1A 3TI9A 1MJGA 4RSRA 4TS4A 4JUFA 4R8LA 1YB5A 4FJ1A 5BRNA 3KLNA 3ZD8A 4KXLA 1KBQA 1K4MA 4KQ6A 4GOXA 1GADO 1V8OA 1L5GB 4BQPA 4GWLA 2I0FA 3AKZA 1GN9A 1U3GA 1Z16A 2ZCUA 1E2LA 2C4WA 2R8EA 3AT1A 4V0OA 4EQZA 4D99A 1ISGA 4GP6A 4Q00A 2BBTA 2QD2A 5KOHA 1DT5A 1UKEA 1Q57A 3ENZA 1WZCA 3K15A 2DH6A 1X9IA 2GOYA 3J7AR 4GBMA 4AP5A 4PONA 4QDZA 5M34A 3CNLA 3WYEA 2RHDA 3RHFA 1P0CA 1ZIXA 4W6QA 1RLGA 2PRYA 2RCYA 3OIFA 3R6GA 2J6HA 4L2IA 2JBAA 2Q7XA 5AIAA 1MB3A 2FPGB 5CHEA 4BO4A 1QVWA 1T3GA 1RPAA 1BXZA 1C2YA 4NU8X 1TM5E 1E9SA 1QHYA 1QYWA 4RWZA 4DMKA 2OGUA 1RZRD 1TX4B 1BD3A 2IEBA 1WXEA 3GJ4A 3MWEA 2C3OA 1C3JA 4ZVNA 3CVOA 2HJRA 3C6YA 4K2HA 3VC7A 1M8GA 1DMSA 3M5DA 1L1FA 3VJKA 2BDEA 4JX8A 2JGEA 1GOTA 4R9VA 1JPNA 3V4RA 1CC1S 4OGKA 5DOZA 1IXZA 2FX3A 3IEQA 4HKTA 1I6MA 2OCIA 1DPGA 1FQJA 4YHHB 4M7PA 2Z6AA 4FFWA 3THSA 3GEGA 2F4NA 4ENVA 4CQNA 5CYGA 3KTAB 2WFMA 1S2OA 2B8WA 3VYSB 3DL7A 3ITKA 1WY7A 1WSDA 3AY7A 3OM0A 3QFRA 4IZIA 2XCOA 2IKSA 1VQNF 2VRNA 4A0RA 1I2BA 2IITA 1T29A 3FDZB 1E1DA 2EBWA 5CB4B 3ACBA 1U0OC 3QUCA 1GZ7A 4QDXA 1MO2A 2IEDA 3RKRA 4UHEA 1XJ5A 4KO4S 4FS3A 4K3VA 1QE5A 2QN9A 4M76B 3UJBA 1ZINA 2OT3B 2QYTA 4TKUA 1V39A 2WWWA 2V7VA 2CFIA 3C6KA 4C14A 1NLUA 3ON1A 5FWYA 1OFTA 5ALRA 3T06B 5DBOA 1T24A 4TQ9A 1N2ZA 1FFDA 4YCJA 2G1KA 4YP9A 5AVMA 1VCNA 1R15A 1X6VA 1X7WA 1LTQA 3CZRA 3AHFA 2EIXA 4O5OA 4BV2A 3FFXA 5A2QA 1LLFA 2YV2A 2GPAA 4QOJA 4TRMA 1PWEA 4BW0B 4NJMA 2ABWA 3TZ6A 4DIUA 1ORRA 5TXGA 4CIAA 1GQRA 4H27A 2CLOB 5LKRA 3ZKWB 3D6TB 1SUWA 1ECGA 1JQEA 4EYOA 5DMXA 5C5CA 4LOLA 1LXCA 1XNQB 3W2EA 2BM9A 3PCRB 4ESOA 3KLOA 1DVRA 3PR3A 1X70A 1UZMA 3PT9A 1YONA 2A4MA 3BN3A 4OYRA 4BFZA 5FQOA 3F0GA 1U3DA 2QGZA 4XD2A 3TH5A 3MLAA 1LWOA 4PGAA 2K7ZA 4CUKA 3IHWA 2JFOA 3N2ZB 4MKHA 2C7VA 2XUKA 5DXAA 5KQMA 3QBTA 4JH0A 1EGMB 2YIVX 4BMXA 1Z83A 4F96A 4EVRA 1XQWA 1BWPA 3VO1A 2FB9A 4NCXA 3HFRA 3OJOA 3WGOA 5LQKA 2V6BA 2WNSA 1Q3TA 3IBFA 4KVFA 4OB7A 5TF0A 2PT5A 4XGNA 4N54A 1PR0A 4FS8A 4WEQA 5EJ4A 4NLLA 3L1UA 2XKKA 1M67A 3PUKA 4K9PA 4NCJA 4RA9B 4RLQA 4CXMA 1ZR2A 1IUNA 4LK2A 4D4IA 1CCWA 1XWIA 4BQNA 3VYSC 3ASUA 4KACA 1CY2A 3NMUF 3JQ6A 1PGPA 3OT4A 4PGHA 1G8GA 1DTWB 4ZAYA 3WDKA 2PUDA 2A0KA 1JU9A 2C1XA 5KX5A 1I01A 2D00A 3NZEA 4I8DA 4PSCA 4BQEA 4HG2A 5EE1A 4JBHA 2WJIA 3SNKA 1UDXA 2C98A 4PAMA 4HWKA 2PMBA 4BATA 2C1ZA 4E5PA 1R3UA 1Z4PX 2O5VA 2NU7B 3B7PA 4GR9A 2C5HA 4WZAB 4QLBA 3INRA 4TWBA 1W1IA 1QOZA 4RPJA 1VJGA 1WP4A 1T9GS 3N1UA 3WGUA 1GCAA 1PFUA 1P9OA 4DOMA 5IYZA 1ZCFA 3WSTA 1RM0A 1EM8B 1AS2A 5I7SA 2QBYA 1H4VB 2Q99A 1U8UA 4IDEA 4J91A 4UNQA 4XX0A 1BHO1 3DTNA 3QGMA 1M90H 3JQDA 3QE2A 1QGUB 1X74A 4OYYA 4JLJA 2D1RA 2BJWA 1HQYE 3U4IA 1A9RA 2J41A 3JQ8B 3FNGA 3M3PA 4Y2TA 3VH1A 4BZXA 3OIDA 2PD4A 3B51X 2FPPA 5E38A 5L4NA 3GJXC 3CYPB 2W71A 3TNJA 3IP5A 3CRZA 4B3CA 3OQHA 3W1VA 1D1SA 2UDPA 3HEBA 1WX1A 5AI9A 4E07A 3VI6A 1FTWA 1YK1A 2CL5A 4IEFB 1WIWA 3JQ9C 1Q82H 3ZE0B 1N0IA 3E8MA 1ZRHA 2YN0A 2OFXA 5ARDA 3EORA 1SG9A 3OPYI 3EBOA 1ZBQA 5CPFA 5DNWA 2AMTA 3UV6A 1KK2A 5AVOA 4EZEA 1ONSA 3P0RA 5E2AA 2P4EA 5G1OA 4X7RA 2ZUSA 1FA9A 2HYIC 4R1NA 3BIFA 4F8JA 3E0XA 2IYRA 1OAKA 2NYVA 4WJZA 3I5UA 4NMWA 3VOSA 1S5PA 1BDJA 4XVUA 2EEZA 4PWZA 5JD6A 4KQFA 5JS1A 3BX1A 2A3NA 2ZRMA 4BECA 1SEPA 4MUMA 5ICEA 3BF7A 4ND3A 4OTZA 4RFLA 1JPUA 1R50A 3QTTA 3QX8A 4KRYA 5I47A 4I9GA 2C9ZA 3V4ZA 4ZWNA 4C01A 2HA2A 3RS3A 3NBFA 5HIMA 3RB8A 3E5MA 1X92A 4BGIA 1IE3A 1K6MA 1DT3A 3LXUX 1WCIB 3STTA 4Q1BA 5COAA 1NVVQ 3GGGA 2R6ZA 1IV3A 4LUCA 4UM8B 1CS0B 3FNBA 3MM4A 3K0SA 4ZANA 2O2DA 5ELMA 3TB6A 1BXKA 4Y1EA 4BO5A 1DKOA 2I78A 4CLDA 1E92A 4L5IA 2FY8A 3H6GA 4X91A 4F3RA 2I99A 4JJ8A 4GIBA 4R2LA 3SJZA 4AMYA 3IAS1 2BMDA 3B3FA 3AETA 3EVNA 2LIVA 3M33A 2YHUA 3NCTA 3C7CB 3QUTA 4RYLA 4LPKA 5GM1A 3WGGA 1SOUA 2H29A 4ARZB 3C39A 4ZKDA 3SBOA 4X66B 2HU5A 5LU8A 4ZJYA 1H1LB 1NJFA 3NTQA 5LIRA 3G3EA 4KNWA 2ZB4A 4B34A 5B30A 2UAGA 2WU3A 4FEEA 4QAJA 3DTVB 2YS7A 2BFFA 3L0SA 2NSLA 2WSYB 4M6WA 2IV3A 1A8SA 1ZONA 4H60A 4OKNA 3L8CA 4TYWA 4DV2B 1MJFA 1Q3KA 1Y48E 1YIAA 1H2EA 2I9PA 3OBIA 1Z28A 3QOFA 4QNMA 2R5NA 4W9NC 1NTOA 4FX5A 1GRNA 1HOXA 1YL7A 3R3WA 2XKBA 3D4BA 1ODJA 1XVUA 4BNZA 7MDHA 2YZ2A 1OLXB 2Q8NA 4MCAA 1GGEA 3RC8A 2H7XA 4OHWA 4Y2JA 3WL4A 2P4UA 2CL0X 4P4GA 4UM9B 2H06A 4DCGA 1JHAA 1QP8A 1RJGA 3EHDA 2ZFUA 3H11B 1LX6A 5CDTA 1H3EA 1QYIA 3V8QA 4BP3A 3L7NA 1V6CA 1HQKA 2FW9A 1U7ZA 2IXDA 3A1SA 3QPCA 4RD1A 4BWGA 4O2AF 4QL3A 2DTXA 5AICA 1Z6PA 3FDFA 3BKXA 4KMRA 1OXTA 3GRPA 5BWLA 1XYVA 4HDCA 1M2VA 4PZEA 1DO0A 1YS4A 3QF4B 1W5AA 3AW9A 3DLPX 2ZI9A 3WL3A 1JR3E 3CIOA 5HP4A 4J07A 2AD1A 2LXNA 1T35A 2QV0A 4P86A 1G59A 1JALA 3CZAA 3GLHA 1E3WA 2WICA 2W8BB 3K9CA 1R2QA 5DCLA 4CKEA 4F06A 4UAGA 3FETA 3VR3A 3N76A 3TCKA 4Y18A 1A8IA 3GIWA 3UHFA 3VNQA 3CNHA 4MRMA 4JUAA 3IMFA 3KSRA 3EOAI 1TXGA 4WZBE 5BW5A 4JFRA 3TLGB 3LP6A 4KX3A 4MRPA 2Q7OE 5BUCA 3PC8A 3R9IA 2ZVJA 4L16A 2BR3A 1VE1A 2XXAB 4CNBA 3ST7A 2KYRA 1VPLA 3GUZA 5HEKA 3U2QA 4WNAB 4C0AC 2JAUA 1E3LA 4R9RA 1AUOA 4MARA 2ETVA 4DHEA 3JARA 4WV3A 5G1NA 3ZWVA 2N9UA 4URHA 3SOZA 4BC1A 1Q7RA 3MEQA 4JJGA 2QTRA 4A2CA 4C3VA 1RXIA 1RWOA 1QYDA 2ON6A 2GTIA 1BS9A 2PKWA 2G82A 1TEVA 1KMQA 4CV2A 4CCWA 3N8DA 1ISRA 1UH5A 4TUYF 4PRZA 1N7HA 1DAOA 1XNJA 2RARA 3A1FA 5J2TF 4O4LA 2XQFA 2X0EA 1V1RA 2PGNA 4HUJA 1B16A 2CMFA 2SBTA 3NBUA 4G9GA 1J8YF 3GEEA 3TZKA 1V3UA 1XRJA 1DG3A 4F6RA 4GMHA 1NUAA 1R66A 1QH1A 3NVMB 2DT5A 4JB2A 4JBIA 4F7DA 1EHCA 1OWPA 4DLTA 5IPFA 2JHGA 1W36B 2O4CA 1TW3A 3MINB 1B43A 2EV9A 2FEPA 3ROEA 5KHOC 5CA1A 1NQ5A 3IEVA 3EVFA 1ODCA 3FDJA 4TTAA 5K3EA 1IBMB 3P0IA 2C4VA 1GSIA 4A91A 1SBNE 4QBHA 4BCDA 1F4LA 1VSTA 1WABA 2QS9A 3S2ZA 4K0KB 5AHKA 1F38A 1ZAKA 2PZAA 4GBJA 1ZMXA 4ICIA 3FBAA 1EGHA 3KQSA 2BTEA 3S6JA 1JL3A 5HBGA 1KTVA 1SELA 2FEXA 3HKDB 4G0XA 2CYAA 4DIEA 1MLDA 4BNHA 2BP7A 4JYBA 1BW9A 3PQ8A 2B78A 4KIUA 4DN6A 1S8FA 4NBUA 1GSHA 4TKLA 2XMQA 4D9HA 4ER3A 5FA5A 2IHYA 1FMCA 3COVA 3CMAF 3DVQX 1R0ZA 1NZJA 3COYA 3IOBA 3UC9A 2FFHA 3U7QB 2X42A 2PKQO 3CG4A 1N5RA 4E13A 1IQUA 5JZOA 1OBOA 4FJ0A 3X1XA 2BGJA 2QOEA 3A6HA 3F5FA 5BSWA 1UDAA 1Z18A 1Z7YA 3ABSB 3GDHA 3KC2A 2IPNA 1GLGA 1U3VA 4OFWA 3C87A 2R6GA 5EXPA 3CCUF 1YOVB 4LJ6A 3A3OA 1YNOA 2HP0A 5CXSA 4XJSA 4HNAA 1XF9A 2O23A 3IVMA 4HBGA 1ESZA 4QBKA 3A6JA 5H82A 1VHJA 2DE0X 1W1WA 1YKSA 1FK8A 4XPIA 1SCUB 2ZTSA 2OB2A 4CEHB 2VH5R 3L6CA 5ALWA 3TL3A 2PGIA 4Q1EA 1KS2A 2DBRA 3EQ9A 4YNBA 4UW9A 4GAEA 2BFDA 1H3FA 5T4HA 5AXAA 4DLWA 2GRJA 3H8VA 3UCEA 2ADMA 5GV8A 3D1VA 3OU6A 4L08A 2GNAA 1WWKA 2Q4RA 3SC4A 4FR2A 5JFOA 4EGAA 1OZHA 3B8EA 4UMDA 5E8RA 3F3SA 5JNTA 5EP2A 4V39A 2W37A 1TU3A 3OD1A 3CV3A 4B5KA 5KNDH 5KNCA 2A6PA 1QQ6A 2Z0MA 3GFBA 1VDZA 2AG1A 3WWOA 3C3XA 3S2EA 5JC1A 3H3JA 1AU9A 2HK6A 2HTEA 2NUAA 3HDJA 1ECFA 221PA 4B3JA 2QTLA 2VRCA 2IF2A 2XOKA 4CV0A 1JLRA 1SQ5A 3EEBA 1M7BA 1NXWA 2GB4A 3FKQA 3TKYA 2XECA 4BFUA 5JV5A 2ZT7A 3TM4A 1BH2A 4Q37A 2M6KA 4R1QA 3K1ZA 4IDQA 2V7EA 4MUNA 3PQ5A 5F9HA 4ZJZA 2EDCA 3HJTA 3ZK8A 2XMSA 3D4IA 1KC3A 3HU2A 4TMYA 4U9HS 4YJHA 5E0OA 1SU7A 2VL7A 5CA0F 3K6SA 4OL0A 2QUJA 2C9BA 1GPUA 3SY8A 2FR1A 3JD4A 4IIJB 3AB8A 1VIMA 3B5IA 2IE8A 2FFQA 3RV3A 4EG4A 1D04A 3IVXA 4KO1S 4KQMA 3KJHA 4X1YB 3OJLA 1G8MA 1R0KA 2ZUUA 4CG3A 2H07A 1JILA 1SC4A 2R8XA 4G1BA 3P9XA 4N7RA 1CUXA 5E4JA 1HFWA 1EH5A 2YHIA 2QN3A 5ED0A 5LZ4A 2JKYA 1W85B 2L42A 4TGLA 1UBLS 2XUJA 4RVUA 2IUTA 1D3AA 3IV7A 2R00A 1J2RA 1MH1A 1Q1GA 1A72A 4IG4A 1V16B 2XZDA 1ZUWA 1CHNA 3K8ZA 1EXDA 2I54A 3CCJF 3G7NA 3DC2A 2PGLA 3S27A 5ITSA 2OBBA 3M3HA 3QJGA 2F48A 2J6CA 4JS0A 5GJBA 3D2CA 5THKA 1ABBA 4UUBA 5ECGC 2HRCA 3CTMA 4EF6A 2Q5EA 3U7IA 3PWKA 2OK8A 2DJIA 2GYVA 1TFUA 4NCHA 1GG9A 5E0KB 3T5DA 4YRBA 5TMPA 3F5QA 1E4OA 3IC5A 1MX1A 1EK2A 2V7PA 2G5CA 3JR7A 1UP6A 3PWZA 3IR5A 4QNRA 1VSBA 3AM3A 5DIZA 5FIUA 2OBFA 5EQDA 1EIWA 5DCVA 1W5FA 2QTAA 2Y4NA 3C1AA 3B85A 3KEMA 2PX8A 1MT3A 2R6FA 2CEAA 3VKHA 2GN0A 4ZHQF 3EIOA 3VKWA 4C43A 1BHSA 3JWIA 3VR0A 4XJXA 1S2NA 3C48A 4GP7A 1YJ9F 1IWBB 1RP1A 1UQRA 3GLIE 5E9AA 4PZLA 3DAHA 4P4NA 2PVPA 4P5PA 4M9ZA 2C9CA 2FUG1 4LRTB 421PA 5HYVA 3QPDA 3AVYA 4ZC8A 5AOAA 3OBWA 3SDBA 4C5BA 1X14A 3BQ9A 4DCVA 3T1VA 1FMFA 2ONJA 3X2SA 4AJJA 4QQFA 3M6FA 1KMIY 4BN4A 2QRMA 1EMDA 1EVIA 1LK0A 3L7AA 1P72A 3BGIA 2AOTA 1XXLA 4LTDA 3OCUA 4ZK2A 4W7SA 1CY4A 5JCOA 3LSYA 3SXJA 4WJLA 1XZJA 2ODBA 3BE8A 3CY6A 5JCZA 1W55A 3MWYW 5K6AA 1A7JA 3SKXA 4XVHA 1YZHA 4P4SA 3VSEA 1QZZA 1HWYA 2PFSA 3UJNA 3U37A 1KZHA 4ZTUB 3DFKA 5ES4B 1NI4A 4J7CA 4CCAA 4CLOB 4JYMA 1FQKA 5K6RA 5CLHA 2OL4A 4OF4A 5LWHA 1P5ZB 4OFZA 4G1CA 3N87A 1M9NA 2Y68A 2VDJA 1WDWB 4I08A 4N8EA 1GLNA 4F6LA 3IH5A 3JD3A 1SKYB 3NHWA 2QLMA 3IQWA 1VJ5A 1E9CA 2BN4A 5DI3B 2GN9A 4ECEA 1EWTA 3RROA 3OZGA 3T5TA 3VFDA 3ZX5A 2XLBA 3UFXA 1XD2A 4Y6PA 4DF3A 1NV8A 2AEJA 4NOMA 4XDHA 2QAIA 5J2UA 2WU4A 4MJ3A 5GOTA 4IIBA 3BJRA 5EGSA 4JI5B 1RLUA 2PZ8A 4FGJA 2NX2A 2OR3A 3CMCO 3ZV4A 2H5JA 3K6KA 2LBWA 2G6TA 3PPYA 5TGTA 1YI1A 3KR1A 2IY7A 1VYUA 2X0IA 3ZK9A 2VJQA 5JS7A 2CV2A 1Q6ZA 4F5WA 3IUYA 4MWEA 1QFXA 4NNPA 3C4QA 5CVEA 4CCSA 2DWOA 2IHZA 1ZNXA 5E2IA 1OKKD 1XF1A 3FR8A 1LX7A 4Y6SA 1M5UA 2P6NA 4YC7A 4AC9A 1RI3A 3BREA 2EERA 4K9QA 2CCKA 4X8LA 4B6SA 1Z2OX 1FUYB 1MEJA 4ZI7B 4OPMA 3GLRA 4C4AA 2W2OA 2RHGB 1FFCA 2C2WA 4PGGA 4W99A 1W35A 2G4CA 1KSJA 1GCOA 2IYSA 2O7QA 3TF5A 4GSLA 4O1IA 1LFAA 2E55A 2P90A 3KKMA 3Q7EA 4Q7EA 4HH0A 2I6DA 4EB6B 4RPLA 3T12A 5SZHB 1XB2A 2PUVA 3L3BA 2XB6A 4Z7JA 4UCFA 5DTRA 3IULA 1E1KA 3ISTA