4U39A

Crystal structure of ftsz:mciz complex from bacillus subtilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
294
Chain Sequence
SIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIALDFADVKTIMKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
total genus 99
structure length 294
sequence length 302
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4u39A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4u39A01
1OFUA 5CA0A 5J2TB 3WGNA 5C8YB 1Z5VA 3JASB 3JAWB 3JARB 4O4JB 4I4TB 4IIJB 5EIBD 4ZI7B 5BMVA 5LYJB 3WGMA 4X1IA 4EI8A 5LA6A 3JALA 4E6EA 5JH7B 5JQGB 3JAKB 4XCQA 4X1YA 1JFFA 4U3JA 3RYIA 3VO9A 3V3TA 5GONB 4F6RB 3WGJA 2VAWA 5LOVB 5JCOA 4DRXA 5EZYB 5FNVA 5KX5A 3HKDB 4DXDA 3VPAA 5KMGB 1TUBA 3HKDA 2BTQB 4O2AB 3ZBQA 4B45A 1TVKA 5GONA 4F6RA 4ZOLA 3E22B 4LNUB 4ZHQA 3WGLA 3VO8A 1SA0A 4TV8A 5KMGA 5M7EA 3N2KB 1FFXB 4EI7A 4O4HB 5BMVB 1JFFB 2RHJA 3RYHB 5CA1A 4TV9A 4TUYA 5ITZB 3HKEB 4M8IA 4X1IB 4I55A 4O4LB 4YJ3B 5LXTB 2RHHA 3JATA 3JASA 4O4JA 4ZI7A 3JARA 5EIBC 5IJ0B 5LP6C 4O4IB 3M89A 2RHLA 2XKBA 2RHOA 3RYFB 5IYZB 3JATB 2GVIA 4HNAB 4U3JB 3RYIB 4O2AA 1Z5WA 3HKBB 1W581 4I50A 4KWEA 3UT5B 4X1KA 3HKEA 2XKAA 5IJ9A 2R6R1 4IHJB 5JVDB 4FFBB 2Q1YA 4O4HA 5IJ9B 5JVDA 3JAWA 1W5AA 1RLUA 4I50B 3UT5A 3CB2A 4O4IA 1SA0B 1RQ2A 4TV8B 4EI9A 4DRXB 5MN5A 5C8YA 4YJ3A 4EB6B 5JH7A 3HKCA 4WBNA 5EZYA 5FNVB 5KX5B 5CB4A 4O2BA 2VAMA 4I55B 4O4LA 5JQGA 3RYCB 4YJ2A 1FFXA 5EYPA 3C8LA 5EYPB 4X1KB 3M8KA 4TV9B 5J2UB 4O2BB 2BTOA 2Q1XA 4X20A 3N2GB 5CA0B 5LP6B 3WGKA 2R751 3RB8A 4X20B 5LP6A 3HKCB 4ZOLB 5IJ0A 3E22A 4ZHQB 1W5FA 5MN4A 4IHJA 4B46A 5LXTA 4FFBA 5JCOC 3JAKA 4X1YB 4U39A 2BTQA 5LA6B 2VAPA 3RYHA 5CA1B 4TUYB 3VOAA 5ITZA 5LYJA 5LOVA 1W5EA 3ZBPA 3R4VA 1W5BA 5J2UA 3RYFA 5IYZA 5CB4B 2VXYA 3JALB 3N2KA 5J2TA 4EB6A 1RQ7A 3HKBA 3N2GA 4YJ2B 4WBNB 3RYCA 4HNAA 4LNUA 4I4TA 1TVKB 4IIJA 1FSZA 5MN6A 3ZIDA 3VOBA 1W59A 1TUBB
chains in the Genus database with same CATH superfamily
2WD8A 4HQ6A 5BV7A 4XWYA 2I4LA 2BE9A 3OIFA 1B6SA 3FTEA 4KC0A 1K86A 4M53A 1GKIA 3M6FA 3A4MA 3OUUA 3WQHA 4XD7A 4MUIA 4OH1A 4Q7EA 4U8HA 3HXTA 1SXJC 4R8KA 5JWHA 2OP0A 2NLOA 2HT1A 2C5LA 4K0RA 3HCWA 3TRFA 2HS0A 1J0BA 4FFPA 4X54A 3BSSA 4U9IS 1EHYA 1K8QA 5F3RA 3EVZA 4CT4B 3N39C 3AM5A 1QVRA 1FTYA 2OCGA 3PWKA 2YQZA 1M33A 1PLLA 3KKEA 3A10A 4CIBA 3H97A 2DE0X 4CF3A 2DAPA 1P91A 2PH7A 4LRQA 3U3MA 5K6TA 1QO0A 5JG7A 4E22A 3CBQA 3HXQA 4X8LA 2ZRCA 4XM0A 4KO4S 1IOVA 5AVJA 4ZEOA 1GGNA 1PG0A 1IG3A 2OFOA 1AA6A 5E7IA 2PH3A 2GNPA 1C4OA 5EP2A 4Y98A 3EX7C 3DZHA 2CD7A 4RPHA 4XVRA 4A82A 1CE8A 4C89A 3ONWA 5EP3A 3IKLA 3KAQA 5TMDA 3Q1LA 4ZZIA 3DE4X 2QGZA 1A71A 2VJCA 3V1KA 1OU4A 1PFVA 1RKVA 3NS7A 3N70A 3BREA 5CIYA 4DSAA 2X8JA 1A76A 5K0FA 3OZRA 4L73A 2Q5FA 4V0QA 3ZD6A 1VHLA 5ALWA 5BSRA 4L22A 2BMVA 3C7DB 1H0HA 4S24A 5FADA 4EJSB 5JSZB 5HWSA 1ZMTA 4PO1A 4EFNA 2YMQA 3AV3A 2YDYA 3BQMB 1JLKA 1VPDA 4CLHA 3CRNA 3ZDRA 4X65B 2E85A 3K4QA 4P80A 1QC5A 2ZSJA 3MJEA 5C46F 4V0KA 2IY9A 3I52A 3BRCA 1NY5A 2IF0A 5IM5A 3EN0A 5ALDA 2TYSB 4PG7A 3Q5DA 2YZ7A 1AXGA 1BKYA 4ZICA 3CLVA 4M9ZA 5EFZA 3FJOA 4NMHA 1B8UA 5EZYA 1AK1A 1OHHA 1ZLXA 3SKVA 3OZAA 3C9TA 5BNIA 1LXCA 5JAPA 1HSZA 5BWNA 1RYNA 1YC5A 2O8DA 1Z6YA 3QTBA 1IVSA 2F1KA 5C31A 3B78A 3WYAA 1J21A 3UAWA 4RJ2A 3AJ8A 1GPWB 3L2OB 2XDWA 5CX1B 2QLFA 4EMBA 1MKYA 3TJMA 2H52A 1TM1E 1M2JA 2P35A 3LOPA 3UJCA 1XV5A 3DDOA 5HG0A 4M7OA 3I23A 4RSMA 1EVZA 1TVEA 3I9OA 2XTZA 5DTRA 4K03A 1WW8A 2HQOA 3UMSA 1N75A 3TGPA 2ZRJA 1VZ3A 1JDNA 4B79A 3ZGLA 1NLZA 2X5XA 4HQ0A 4MULA 1HYQA 3IERA 3G0IA 3ETNA 2GZHA 5K03A 3SIPA 3HBFA 3CX6A 1Q3TA 4BC0A 5C4IA 3DOFA 3LA6A 4W99A 1BMFD 3UG7A 4EKYA 1TTQB 1MO5A 2EWMA 3W4IA 4ALMA 4HTFA 2RFLA 4DIUA 2NYRA 3L77A 2ZUVA 4OMCA 4GZLA 1WCXA 1Z62A 4TLAA 3VTKA 4RF2A 3VU1A 1ZH2A 8ABPA 4KPFC 3A2KA 2AFHE 3U62A 4JYMA 5EJ4A 3HYSA 4K6HA 5EIBD 3CUYA 2Z09A 1QWSA 3I83A 4OK5A 1ZJWA 5DYTA 1KDZA 3LPAA 4N5LA 4RMIA 2VQ6A 1IXYA 1A2BA 4OXQA 2LDBA 5E8JA 4OHXA 3V7UA 4A9AA 4BMZA 4DR4B 4ABYA 1XRSB 2QTFA 3CZ5A 3ITNA 1QHIA 1I1NA 3PLAC 1UJ6A 4HAUA 4OP1A 5DASA 2D2FA 1C7ZA 2IYZA 2MJLA 1W93A 2AMFA 4XIFA 2BFFA 4KFTA 4Q3CA 3KSMA 3IL2A 5EMKA 4I9FA 1X0VA 3EMDA 4PGHA 4BX0A 1JR3D 3NM4A 4HDSB 4AK9A 4DPLA 1W57A 1Y1TA 4I1PA 2D8AA 4K6GA 2VJBA 5FO1A 4ON9A 4MUBA 4ARVA 3WWPA 5E3JA 3NBUA 1BXRB 5F1PA 5D2CA 4RK6A 4JU9A 1JRLA 2DJ5A 2FK7A 2GF0A 1WV0A 2VWQA 2C78A 1XMXA 2YJ5A 1YRBA 3SSOA 621PA 1DWQA 2EDCA 2Q4BA 4ID3A 2ODPA 4QHYA 3AHDA 3UTDA 4L9WA 1IUPA 4BP8A 2M1XA 3AF3A 2OLEA 1AGNA 2Y8EA 3HP4A 4QEZA 2BW0A 1Q7TA 1CQIA 2QW8A 5SYNA 5BV2P 4A6DA 1HURA 4FHDA 5DI9A 1A77A 5G4KA 3ZZ0A 3H3FA 2WIDA 5K3DA 1WE2A 3KB2A 4NCHA 1SO8A 1YJNF 3S0YA 3S8EA 1UZMA 2B3TA 2PAAA 1R6BX 3EXIA 3GHHA 4ZU6X 4YMVA 1DAKA 5EWJB 3B1JA 4WV3A 1NHWA 1AD2A 4G0QA 4NG4A 3BJIC 4UNPA 4EYQA 1ZD5A 1HQDA 2ANBA 3E9MA 1TU0A 1CUCA 2JLSA 1Y8ZA 2HCBA 1XEFA 3OBWA 3CWZA 1TEVA 1NUSA 2EIHA 2F00A 1ODLA 3LDFA 4V02A 3QELA 4JLNA 4YAJA 2HR1A 1BMFA 1PR2A 4J7CA 4TSRA 3QU5A 1ZCAA 4X5OA 4LWQA 4KGDA 1DZ3A 3OJCA 3Q12A 3ZE6A 4DSNA 1VYHA 4ML3A 4AQDA 2VGMA 1EFRA 4GXNA 3T3EA 4ZDJA 3R6TA 2VNHA 1VSUA 5AM1A 1JF8A 4M88A 1XNRB 5JCXA 2W83A 4DJFC 3RASA 5IM4F 1XXHA 1P2FA 3PZRA 1Q1GA 1EWTA 1F8FA 3G0OA 1R6TA 3OQIB 4IS3A 1JLSA 1I3NA 4Z8YA 5TPWB 3K0EA 4BU1A 2FHSA 3VNRA 3CLUC 5AWFC 2VSOA 3U40A 2DR3A 3BHIA 4QOFA 2XUGA 1NG1A 1MQAA 3NEYA 4IVNA 5C4GB 5LP6F 4Z86A 5F4BA 3X44A 1D1TA 3FOWA 1X1TA 1EYZA 4UXJA 3KR2A 4MWZA 1CX9B 4UDNA 1YZKA 4M1MA 3FTQA 4BBJA 2VUIB 1IRIA 5B55A 4PG6A 1RCFA 5CA1B 1MW9X 5IN4A 5FOSA 4J03A 3PGLA 4NG5A 3IJRA 4NPAA 2MYTA 2WPDD 3P9SA 2VQFB 3ZVKA 1XD2A 5CFQA 3PC8A 1E8NA 2P77A 1M1KH 5FNVF 1EM6A 4JC0A 3SJCA 3I56F 2VVTA 4M0CA 4WNYA 2O59A 3FZEA 4DJAA 3H16A 1JR3E 1XXHB 4K2HA 2CKMA 2XAUA 4I5IA 5DNUA 1F06A 1KVRA 2QRZA 4QBHA 1MVOA 2QN3A 1RRFA 2ZBUA 3BB4A 1B2LA 5JXIA 3VZQA 2J07A 3DTVD 2AEJA 4H6PA 3PPWA 4KIUA 3I9KA 3WSWA 1B2RA 2V6MA 2WJZB 2J9GA 2D4AA 3GLTA 4OSPA 1JEAA 4DQVA 3WG9A 1U2GC 1YL7A 2XCLA 3OHSX 3MOIA 4YCAA 5GIOC 2BCGY 3H5AA 3H9GA 4EYEA 4MS4A 3SAJA 3SP1A 1C81A 4POAA 1EP2B 2F62A 3WGHA 5JASA 3IE1A 4IOMA 4OJKA 1WMBA 5E1OA 4IXMA 4FXOA 3ZW8A 2IKSA 4ZVUA 2J59A 5MHTA 1BJTA 1ZK3A 4C7MA 2JFQA 3KKNA 3UAVA 2WSIA 2OR3A 3FUUA 1USGA 2BUCA 1I9CA 3G02A 3M3DA 3TQRA 3UOGA 4BO5A 2HXGA 3G8BA 2Q6LA 4L0QA 1PKXA 4J94A 3BWCA 4B4KA 1U3DA 3AHHA 3R75A 1KEVA 1ONOA 1AQIA 2WWIA 5EP4A 2JCBA 1IUOA 4TPKA 3DO5A 4N3GA 2I2CA 4N7JA 1ZGHA 4LX8A 4QFBA 1X39A 2W42A 3W77A 2D1SA 5K6RA 4EYGA 2H5JA 1JKJA 3M82A 4RZSA 1PHRA 1S01A 4LYHA 4XOIA 1F0YA 1XHOA 4M4SA 1YMUA 1OD6A 1YRLA 5TMPA 2ASVA 2JFYA 3ETEA 1LGYA 3VVLA 4ESOA 2ILTA 3IOCA 3X1XA 1RHKA 1RRMA 1E94E 3P2MA 4U7WA 3L1UA 1YJ8A 4MRAA 5HUQA 1E64A 4KOEC 3CO0S 4FB5A 2YUIA 4DR7B 5EAZA 1M7GA 3QPCA 4HQLA 4EFLA 3RVLA 2XIQA 3U7EB 4BXOA 4J1NA 2VTBB 3HZRA 3PUKA 1Y8QA 3G0DA 4R3WA 5IAGA 3X1WA 3RHSA 1PNOA 1UDBA 1XTZA 2X6QA 1HM5A 4OO3A 3A25A 4PV7A 2PD3A 3O90A 1OZGA 2OECA 4PC2A 5KC8A 2I6GA 4RK1A 4WBNA 4EUHA 1W85A 3GDFA 3ENKA 4WX2B 1E5DA 1QFYA 2O57A 2RBKA 4W8HA 1VBNA 1RI3A 2Q27A 1LS6A 1JJ2F 1PR5A 4V0RA 3DLPX 3WK9A 3ZWYA 1H2FA 4ZQFA 5FPQA 1Q3HA 1Q11A 3GLIB 2A9RA 1F1BA 3KE8A 3N3AC 2PL9A 1RPTA 1NOKA 1Y9JA 2FQ1A 3AO0B 4TMKA 2PZEA 1DNPA 1F38A 5B1YA 4WUTA 2H2FA 3U7IA 1NYLA 821PA 4TM7A 4R1NA 3V00A 1TMGE 2WU0A 3QUAA 4ZP1A 1ILWA 1A9QA 4PQEA 2BEVB 1UPTA 1JDJA 1UZLA 3EGOA 1L2TA 3HCBA 3UFXA 4OGKA 2QRMA 4O59O 4OU4A 3LDUA 4BMXA 2ZYVX 4Q7QA 5BN1A 1CJMA 1Q7CA 4L08A 1CKEA 2VDNB 2UV8A 4MOWA 3MINA 3RV3A 4Z4GA 4ZCIA 2R7MA 3ET5A 4E2WA 2ZZNA 2GBLC 2LTAA 3CQ9A 3L02A 1H6BA 1WEHA 1TF7A 3ZVRA 2FUNB 3NW9A 2F48A 1CUJA 3BGWA 3D8NA 1T9DA 4JHLA 4QXOA 5FR2A 3FRIA 3L4BA 4PX3A 1M8GA 2WP8J 1RAEA 1FL9A 3LQFA 1KVSA 4UMEA 3I1YA 4NYMQ 2KI5A 3JWHA 4OQPA 4X1IA 1CUEA 2FMKA 3PL1A 1L5HA 3ROZA 3UXYA 1NMXA 2ZRPA 1I7PA 3CCSF 2B33A 1QYWA 4XYEA 3JZFA 2GETA 3SSMA 4G41A 1RHRA 5D87A 4YACA 1U8AA 3FWHA 4MARA 4WHMA 1E58A 1GZ3A 2EXXA 3BEOA 4FMDF 3BE6A 1HT0A 3UPUA 1NVWQ 2C9MA 4J0KA 1RU3A 1JV2B 2PVSA 3T7SA 1GL7A 2X9LA 3FNQA 3EF1A 3WDLA 4S05A 1GPBA 2VCHA 5A71A 4R6XA 1T29A 1II9A 3K71B 3HFJA 1MO3A 5JRZA 4W5JA 5SZIA 2B8WA 4BQFA 3F8WA 1P2UA 3DP9A 1R9NA 2IPXA 4EA8A 3ELCA 1O3YA 2GJ8A 3T41A 3E5MA 4B4UA 5HOQA 1M10A 2AYYA 2G40A 2HA4A 1PJSA 2P68A 3OT1A 4R1SA 4IDGA 3SJ7A 2IYRA 5FWXA 4DR3B 1UMCB 5IT5A 2KJQA 5LU9A 1OH7A 1WZEA 3AU9A 2JIDA 2ERXA 1VIAA 2XTNA 3E4DA 3EGEA 4V0ME 5AHOA 4YAEA 1EDEA 1G66A 1EX9A 1U3VA 3NX4A 3Q98A 3QYJA 4LXIA 2PR2A 4C4AA 3WK7A 5J3JA 1TAUA 1N1DA 4TS4A 5IDVA 2GVIA 3T1NA 4DSOA 4FNOA 2HU5A 3TLCA 4XVCA 2DETA 3C3DA 1U4SA 2ZIXB 1M8PA 2EBWA 4OG2A 2Y6UA 2XOKA 5TIIA 1BA2A 1PL8A 2WP0A 2ZVPX 1Z15A 2J3KA 2CXUA 3IELA 4UOEA 1TZMA 3ZW9A 3W3AH 2DPHA 1ZM2A 1U2TA 2AN3A 2C61A 3CWQA 4HB3A 4IGKA 3IRVA 4RXMA 3U0BA 4MWOA 4BAUA 3BXXA 1Z33A 1XC7A 3X1DA 5I9TA 1EDOA 1XCJA 1YDEA 2R9VA 4CM9A 3BQ9A 4KTVE 4JXXA 4IXWA 2B8TA 2O1XA 4P4NA 2PT7A 3TRHA 2BM1A 3M9WA 1KVTA 1GZSA 3HDVA 1K73H 4IUDS 2ZVJA 4N1AA 4TTPA 3T3NA 2CLDX 1H0SA 1UIRA 4DWJA 2W4MA 1EGMB 3P94A 1EA7A 2GD1O 3GAMA 4NK5A 5D7NA 4ZAXA 4YAKA 2AFIA 3H17A 1J39A 3RG8A 4HSEA 5JNWA 4H0NA 5FUXA 2RI6A 3ZQKA 3E81A 1ZMRA 2P69A 1USVA 4M83A 2JLXA 4EHBA 2Y0DA 3F97A 4HNTA 2QI9F 1FFCA 4CG1A 3ICVA 4IIBA 4YFYA 1J8VA 4JI2B 1P1CA 3WB2A 3WGKA 3G88A 5L3QB 4OA5A 1II8B 1YVDA 1XVIA 1E7WA 4ZHQB 1SPBS 3FLAA 3N7TA 4GPAA 5BSTA 3VU9A 2YXZA 2PGLA 3X1MA 4P2BA 2CFRA 3ZI4A 4CR6A 1BE6A 4LSWA 4XARA 3SZRA 3EEIA 4QDXA 1RMTA 2O54A 3ORRA 3OCXA 2ID4A 3JW8A 1HYHA 1LTKA 2C5FA 2FQQA 2W98A 2YHBA 1XTBA 4I6GA 3UWOA 2F4VB 1RM4A 1QIFA 1DRVA 4NNJA 1Y37A 4TWJA 5A4AA 3TJRA 1XVLA 2JAOA 1IFXA 1J9ZA 2J0EA 4HJXA 4F4CA 1C1XA 1VJDA 1L1RA 2SCUA 3N1UA 2QMQA 3AOGA 1NZJA 1DU4A 3G9XA 3GMDA 4R9RA 5DYNA 2QLTA 4AJ4A 4CMKA 4P0PB 3LNTA 4G89A 1GZ4A 1MAWA 1T2NA 2J5XA 3EK2A 2X9GA 3TDMA 3WNVA 3U6BA 1E6LA 4NBTA 5AMXA 3IB6A 1CY4A 4LGMA 5DGCA 3LDTA 4CQMA 5KQLA 3INRA 3J81k 5GJBA 4OEHA 3QX8A 4ZU3A 4OHMA 1VHQA 5U9CA 1NV8A 3VH2A 2JFWA 3K0TA 3DKKA 4FFMA 3QOYA 4FGLA 3CZPA 4JT8A 4PSUA 1I01A 3CJQA 2VR1A 1RZVA 4F6RB 3KEFA 4UUBA 2E6UX 2DQ4A 3NORA 4EO9A 4KX5A 3HG7A 4CUJA 1C14A 2C8JA 4HF7A 4Y0NA 5FWAA 1Z0DA 1N0HA 2WYVA 3TG8A 4B3FX 3QXCA 1W6UA 4DMLA 5ALOA 5GONA 3QSGA 2WKQA 1T0PA 3MWEB 5D3MA 1YZYA 2Y1CA 3I45A 2GUWA 3LO5A 4Z7QB 1IZ0A 2GN6A 2QRNA 5TMEA 3I5XA 4WUVA 3A36A 5A5EA 2IT1A 2P2CA 5BW8A 4MVYA 3ESDA 3QJ5A 1OH6A 3RK4A 2E5LB 3MTEA 2YXBA 1W4RA 4MW5A 4WQMA 4Z3KA 3LT4A 1N3IA 2BBWA 4NCAA 3EZLA 4BFXA 4FC6A 2V5UA 2RSLA 2W90A 3LHDA 4G37A 3K09A 1X9GA 4S1OA 2P90A 3BMCB 3DQPA 4HX9A 5FNZA 2XBLA 4JXJA 4BAZA 1U1CA 3HB1A 2VQ3A 3D3KA 3PA8A 1R4NA 2LE0A 2LZ0A 3ADPA 3RREA 1G2QA 3TWOA 2HH9A 2BF4A 2P8JA 3W90A 2D2XA 4B44A 1RXWA 2I4RA 2YTZA 3Q7QA 3PIIA 4RHXA 1JW9B 2RHMA 4KAFA 4A8JB 4LZJA 1NOJA 5JJKA 3RU2A 1XZKA 4FHCA 1TW3A 3C2QA 4G5RA 1QDUA 4MPPA 3G71F 3AG5A 2HWKA 1B1CA 3LT5A 4X71A 3CC4F 2Y4OA 5EHQA 1QOQB 1Z4OA 3ZK9A 1U8CB 5KCMA 4JSTA 2DQYA 3ZZUA 1ZVJA 3QXGA 1NTRA 2FR8A 2Q21A 2ZVYA 5L8VA 3T95A 3OE1A 1QYVA 1S6YA 3WQSB 2RK6A 1DV2A 3NETA 4D6PA 3LV8A 3IEUA 3X2EA 4R05A 1XCPA 3BSYA 4FFRA 5T67A 4PZEA 4PYQA 3L7QA 2WJ6A 3QIAA 3IHLA 5GINE 3RVBA 4JEMA 5IWAB 3ASUA 2Z1UA 1W36B 3C6ZA 4UD2A 3Q8LA 4GOJA 2YR0A 3HA7A 3ON1A 1KP3A 2C5HA 2I2BA 2NU7B 1JDSA 2H31A 4EX7A 5F7ZA 5A3RA 4MVJD 5T4HA 1QB7A 1RC0A 3KO8A 5GZ6A 2YJ6A 3HGQA 3QFRA 5FTWA 3TAUA 1E6UA 1UP7A 3VSAA 1GUBA 1LK7A 3CLSD 1TVCA 1J0AA 2HU2A 5KYYA 2H48A 1UBKS 1S2MA 1ZGGA 2X0JA 4FMBB 3VNAA 1KY5A 3VCZA 3IGFA 4LJ9A 5CJJA 3CXCF 1P3DA 5J9FA 1LF0A 1WPQA 1Q15A 1HDZA 1RQNA 3DDCA 4R3UC 1XRPA 1ZA1A 1RQRA 3QKWA 2YWCA 1VYVA 4LXTA 1L4GA 4KRXA 4OVKA 3HKBA 5LCXA 4QDKA 4B5KA 3K73O 1KNKA 4YIKA 4DN6A 5FUVA 5CBPA 1UMDB 4Y2VA 3U09A 4DBLE 2WAMA 4Z1MA 2P65A 3IHWA 1FVHA 3G2KA 4KB5A 3IEPA 2M6SA 1NATA 2WABA 2JA1A 2WUWE 4AS3A 4NARA 2JK1A 3MM4A 5EMLA 1QPZA 3GWZA 2O1SA 5AW3A 4C4OA 1Q83A 2HLNA 2HCRA 2Z58A 5CIWA 3V4PB 3PGKA 4JI6B 5PGMA 2B92A 5KOHB 2X0RA 3H4IA 3E9EA 1GU0A 4PU0A 1MTZA 1A7AA 3SBDA 2BI8A 4HRAA 4NU0A 1WU8A 4HX5A 3LL7A 1CJBA 2XB9A 4M1OA 4CQLB 2HQRA 3IFSA 3RS5A 2COEA 4KFCA 1NR1A 1SOVA 2COKA 4N76A 1U8TA 3T80A 1WUHS 3LUBA 1PE0A 3SHVA 1NVEA 5J1TB 4DUZB 1V39A 3L43A 4KTTE 1VJ0A 1TJ3A 1ZBDA 4JKYA 3BGDA 2AUTA 4R41A 4BGUA 3AVXA 2YZKA 4QBKA 2IXBA 3FDXA 1P9NA 2AOXA 1Y3BE 3PHHA 2HO5A 2ZSFA 4R8VA 3WRXA 4A4DA 3COJA 1Q1BA 4XM1A 2ZOVA 1L4EA 1INLA 4GI7A 4QOSA 1S7GA 1FJGB 1T5DX 3NT2A 4INAA 1NOIA 5J63A 3D3NA 2WD7A 2QG4A 4BUCA 1ZQ1A 4E1BA 2HCTA 4I6EA 1R8YA 2HGZA 4KVZA 3WL7A 4F3KA 1IPHA 3Q41A 4XX0A 1L3IA 4PHFA 4ECEA 5KVAA 4W7IA 1NC1A 2DTEA 2EZTA 1VSTA 4NULA 2I34A 3RYIB 5IX8A 1HL7A 5KYWA 2BH2A 2FAXA 4RF3A 1EB9A 1QMGA 4JV5B 2BZ1A 4BTVA 3DBLB 1R0BA 2V6GA 4HNGA 1RYDA 2HA5A 3QVLA 2A92A 4O4HA 5FKJA 4QG3A 2I6UA 2B7LA 2FR1A 3IUSA 4GBMA 4G9GA 3T9CA 4QVIA 3P9XA 1NASA 5EN4A 5BSGA 4ENTA 2Q9AA 4F3TA 1EGVB 5KB3A 3HYLA 4DSUA 1YRAA 2FSPA 2QE6A 2UVDA 4OB6A 4K3VA 2XXJA 5HGJA 2IS4A 1YTLA 3DTVB 3ICOA 2P1RA 3CS3A 2JH9A 4JFRA 4WBNF 4NXMB 1T3TA 2ZTLA 3MLBA 4NYMR 1UQUA 2Q9UA 5TJ9A 4F5YA 1CUZA 1D2MA 1XF1A 2W11A 3QU7A 1CQZA 4L9AA 5H8WA 3KRTA 5F52A 1T36B 2PX8A 1E3DA 2ZJBA 2QR3A 4FYKA 4EG3A 5DK6A 1P1IA 1ZXLA 5BVHB 4CEIB 2WMNB 3EFBA 3K1AA 2X1MA 4F9TA 2FC3A 1NXVA 4EZEA 2BVNA 1B4DA 2AEMA 2JAPA 3ECCA 4KQIA 3ER8A 5CBKA 4BXOB 2AXNA 1E9RA 1OW3B 1KZ7B 4HQOA 5AJXA 5B1SA 3W2TA 3UMRA 4CKBB 2ZGVA 2ZJYA 1D9XA 1E2UA 1WBJB 4P58A 5T6MA 5HYVA 3U5ZB 2I99A 2OG2A 3E5HA 1L7MA 2R00C 4F4JA 1ODEA 4WA7A 2W2MA 1IY8A 3LKZA 4BTLA 4D9HA 4EHLA 4QU9A 3WRVA 5IDXA 4UEKA 5JNTA 1UXKA 1GSIA 1FU7A 1Q91A 3OTIA 1ISSA 1JLLB 3WHKA 1KH1A 5CH5A 4H1TA 1QRTA 5P21A 5DRYA 1E0DA 3KD3A 1V8DA 3C1UA 2I6XA 3KPJA 4K5QA 3CZ4A 3V97A 2QA5A 3GEMA 4Y6RA 3JWGA 1L7PA 1XLUA 3QITA 1U8YA 2XY4A 3MWLA 3T7EA 4E2YA 4NR0A 5LXTF 4CCYA 4FX2A 4UQPA 3MTBA 2XSZD 5E4TA 3L8EA 2ECOA 4KPUA 1JQDA 4ZT5A 3ED1A 3FMGA 2BKLA 2DRIA 4N7MA 4NCJA 2D1YA 4TKVA 3G13A 4QU5A 3ZTYA 4DCCA 3P10A 3Q5GA 3CNNA 5AKKA 1EFHA 2X3FA 3WA6A 4BFUA 1DBQA 5JATA 1M1XB 3ZJ4A 4B6SA 4UM9B 5JYEA 4BE9A 4DMUB 4YV2A 4RFSB 3TE7A 4ENRA 1DS6A 2RCNA 4MI3A 4YCBA 3E1YA 3GP3A 1NONA 1XNGA 2NX2A 3ZU5A 1A8SA 2RAPA 3FGNA 1HNXB 1X8KA 4GOMD 4TXMA 1SKUA 2KBEA 2X8WA 1BFDA 1C5KA 2WAAA 2ZT6A 4PYRA 4CL0A 2MSLA 4MDEA 1RADA 1WS6A 1YQDA 1ZY2A 4G81A 2VF2A 3JD2A 2GN9A 1CUIA 4NZNA 2CCJA 3EA0A 1QYIA 2CNNA 4HVTA 4L4ZA 3CVYA 1OX6A 2NYVA 4I55A 1IL0A 3QX3A 3ZDFA 1X7DA 4BRSA 2PBLA 3OTOB 1Y48E 4PAMA 4MRNA 4HS9A 5EJFA 5K8VA 3LXRA 1AO0A 1B26A 1QGOA 1TLTA 2ODQA 5HFJA 3PXCX 4YGXB 1XQYA 1UOOA 3FDZA 2X0DA 4NCBA 2OE2A 4BLVA 1PT5A 2W93A 3D7NA 1ODFA 3HL4A 3T1VA 1TAQA 5BNTA 3UT5B 5J2UF 3BSFA 4AZSA 4CHGA 1QHSA 5ALFA 4BFCA 5LD2B 2C3UA 1O6CA 2H1WA 3OEHD 3GHYA 1QRRA 1IC6A 5F5NA 3H42B 2PGAA 3L8ZA 3LI2A 4TWBA 5L6LB 4QGGA 2OQRA 3WIUA 1MIHA 4GRIA 3JAMM 4Q3DA 4QVKA 2A14A 4GWKA 5ELMA 5HCUA 1ISRA 3WX0A 4AMVA 3VKUA 2A9PA 3OQHA 3D8SA 3U44B 1V1RA 2WYWA 1LPMA 1XLTC 4RD4A 1XMOB 1G19A 3BX1A 3IAHA 4JA2A 2XX3A 4RIFA 5FWNA 1KI6B 2KW5A 1SVWA 5D01A 2P6UA 1CUWA 1T6NA 3KQWA 4Q16A 5ALMA 3T9EA 1P1JA 4DEXA 4DZRA 3AY7A 5BN3B 2QTRA 1QIHA 2O3SA 2VP4A 2H29A 4RZQA 4MMYB 3D59A 4QLAA 1BRTA 2EFYA 6CHYA 1A0OA 2WTBA 4NFHA 2ENWA 2B5WA 2G0TA 1XRLA 1ZEMA 2IEDA 2VPTA 3RPEA 1WXDA 4JKIA 3E7FA 4DE5A 1L5GB 4B35A 1W5FA 4YPFA 2PWBA 4U0KA 3F90A 3LC0A 1S3SA 2F1OA 4E7PA 3ACBA 2IZ0A 5KJFA 5LXTA 4F3NA 4UE2A 2NM0A 4ZV7A 5FJIA 4ZYLA 1SHJA 1C4KA 4IILA 4IL5A 1XZMA 2X86A 2BUBA 1E4YA 3K92A 3NYQA 5F5XA 4KHPB 3AX6A 5KSOA 4KXWA 1E3LA 3S1SA 1Z4IA 1ELOA 2QTCA 2VDWB 5JU6A 2O8EA 4D80A 3ODPA 1PI3A 4I5EA 1TKAA 1CNEA 3JQ8B 4HN4B 4QEKA 4QDUA 5EEHA 4X63A 4AIIA 2VP2A 2CEAA 2ZJ4A 3FFBA 5FBWB 4Z7JA 3PNMA 3MJRA 2GA9A 2OY0A 2HWXA 4P0QB 1VLJA 2X2PA 3E03A 3R3UA 2O3TA 2QRUA 5DX8A 1PT7A 1P39A 3TI9A 6NULA 1E7RA 2O0HA 2JLAA 2ZAIA 3BZUA 1DOAA 1UM9A 2ONKA 3KQQA 4BWYA 3WDSA 4KXVA 3TBKA 3AFIA 3DJYA 4L72A 4F72A 5LYJF 1AQNA 1XD8A 1ZR2A 4OGGA 1YL5A 2OD9A 1OYYA 4EF4A 4A8JC 5GONB 3K8ZA 4F9FA 3FGPA 3QI7A 2VHUA 3OEHA 2XWPA 4XPZA 2X0KA 2MT9A 3T7CA 3A4YA 3V1LA 4CFYA 5CEEA 4RIEA 4FFSA 1L7RA 3KV1A 2C4NA 4IEIA 5CLFA 4HHEA 3PRYA 4RDHA 1X7XB 1B74A 1HDCA 1JQEA 1L4FA 1BH6A 4GYWA 3RT9A 2XITA 4D0SA 2FQWA 2I1WA 3F0TA 1T4CB 1O2DA 1N9GA 4PO9A 3AONB 1S72F 1XNJA 4EUEA 3O9MA 3RROA 5JD5A 4D9GA 5JCJD 4CTNA 1A5ZA 3HTNA 1O8CA 2ST1A 2ZT8A 3KUKA 4IH4A 3LLVA 1JN1A 4ILEA 4R9SA 3LNCA 5HMMA 3ZOZA 1NUQA 2Y1EA 3N59A 1EXVA 3N28A 1JEDA 2O4CA 4NZ9A 4PLHA 1OZAA 3LT1A 1KMCA 2XBMA 2C3YA 2QTBA 3UXMA 1XDSA 3W5CA 1VK3A 4CDRA 2VDLB 4FT4A 4HB0A 4JLPA 4QELA 4H0CA 3UJAA 1NMZA 3QXSA 1DBSA 3ZXXA 4K9RA 5I8WA 4B3XA 5K4GA 4KUGA 2I76A 4V2UA 2HHCA 1UQRA 3CV3A 4NQRA 4GOKA 1Z4QA 5ICFA 3ORHA 5JSQA 5JUWA 2JGNA 2IVFA 4V2IA 4ZVOA 3QMPA 4AWXA 2EL7A 1Z0SA 5DOVA 1D1QA 1NU6A 2ZUFA 3F1LA 2QZ4A 2XTMA 4UBJA 2OHJA 3QHDA 4JITA 5K3SA 2ID7A 3T5CA 3V9AA 1UMBA 4NZYA 2VJDA 1NBWB 3G8YA 1QLJA 1JP7A 5E7QA 2I8CA 3OZWA 1LBHA 2ZUBA 3EEYA 4LK2A 1HLFA 2NZYA 4ALKA 2PKWA 2VHWA 2WJVA 2P7IA 3UAOA 2FW0A 1NI3A 3V2UA 3LPDA 4MDHA 2GBGA 3D2AA 3GGCA 1UAYA 3KCNA 2EKLA 1KYQA 4I66A 3C8LA 5LNK1 3CVVA 1Q0SA 3KXIA 1LVUA 2GM5A 1H65A 3KTDA 4KQGA 4ENSA 2R5WA 3Q72A 2WTAA 3CX7A 4UNNA 3STHA 3FJ1A 2YNMD 4ENVA 4CLXA 2X58A 3GCGA 4FDUA 3DWGA 3N2GB 4OB7A 1F5SA 3TEMA 4OK6A 3NOXA 3TYXA 4X20B 4CMJA 1P2VA 1TFRA 2XRZA 1F2TB 4CUKA 3VR5D 1N8RH 5T57A 4RH1A 1K3FA 2QE7D 2WKWA 3PDCA 2QT0A 3CCJF 4MI9A 4P7JA 1U3LA 2AE2A 2HF2A 4J6EA 4M60A 4Z49A 4G8CA 4KXXA 3UK2A 3VAAA 3LY7A 5CB4F 3T5AA 1DEKA 3RFCA 2WI8A 3I04A 2NXEA 4X1OA 5HEKA 2CZWA 1T3GA 4CE6A 3FKJA 2Q5OA 4AP5A 3U4GA 4NFYA 4ZK6A 5IWCA 5A2QM 3C5HA 4ZC1A 2WTEA 1N4AA 1XCLA 2Y27A 2UZ0A 1CS4C 3VISA 1SD1A 2GSDA 2VH2A 2NTNA 2Z6UA 4C7JA 1NN3A 1P62B 2HUNA 2J3EA 3OQIA 1BXGA 3F6MA 3P9QA 3QEKA 4O2AF 3VU3A 2VA8A 2BCJQ 1JJAA 3WR5A 2VJAA 1DIGA 4M7PA 2G8NA 2GEVA 1O96A 4I4TB 4TV9F 1RJFA 2PXCA 1SN7A 3ZDCA 5J4KA 4C8GA 3LW7A 3WSVA 1L9XA 2HMSA 3C9RA 5JNVA 2WF8A 3CF2A 5FOVA 5KYYB 7ADHA 4O8ZA 1D0IA 1T1EA 3H9QA 5L3ZA 2JGRA 1A5TA 2UXCB 3IQWA 4KI0A 3GARA 3NV9A 3EW7A 1K9VF 1NAHA 1VIMA 4BC1A 5JPDA 3LBYA 1LC0A 1XUOA 4NRDA 2XWSA 5DTJA 4R0VA 2NU6A 4C6TB 4ZWNA 3ZHVA 2AKEA 3ZBUA 4B17A 4IGAA 2DBQA 1IVYA 3DR5A 1PJQA 3KJNA 2FPWA 3T7DA 5EUMA 3CF6R 3S7ZA 4X3MA 5K0JA 3BWBA 5AI6A 3N2KB 2DEUA 1IY2A 1GARA 1KNQA 2W6IA 3D6TB 2VBGA 3ZDYB 3LSYA 4PYKA 3DL7A 2J9FB 3ILXA 3GBPA 3F0EA 3KQOA 3MDOA 4M76B 1VQNF 3LF2A 1Y7TA 1GNTA 3N07A 4MVXA 3BBLA 1JYFA 2AQIA 1R9GA 1OWNA 1KORA 1RJEA 3SM9A 1HEYA 3PFWO 4FCTA 2BRUA 1ESDA 1F2TA 2P0AA 2L18A 3PICA 3O0DA 2VT6A 2H57A 5GVSA 4DA0A 1N2CA 2BIFA 4GI5A 5TRTA 5IZ4A 1JFSA 1L4LA 4RKEA 5CP8A 4XWKA 3MD9A 5JFGA 3K32A 2WU1A 4LVUA 4OBXA 1GGEA 4BGIA 4IQ0A 1JDBC 4V3CA 3UAYA 3S2GA 4ZHSA 2WIKA 4FFBB 4H0FA 3OCJA 1P7YA 5CUQA 5JISA 4MV5A 1NBOA 3UMGA 8OHMA 2YWEA 3KXDA 2CNOA 3F7NA 1UR5A 2J6HA 3VVCA 1U28C 2C2XA 2I3AA 3S27A 3P97A 2Z83A 3TQSA 4F2WA 4J0FA 4ZCRA 1WZNA 1P9WA 1QONA 1RI2A 4DC0A 3IXLA 3ML1A 4IXTA 4DTIA 2PV7A 1YZVA 4MINA 3ZWMA 1KNJA 2HBZA 1JB1A 1AU9A 4LX0A 2JHFA 5TT1A 3SC2A 2FW7A 2BJVA 1BMDA 4O4LA 4C76A 2C9OA 5EEGA 3DMNA 3PNPA 1T43A 1KYWA 3KYBA 4BCDA 1KEKA 2XYHA 1YR2A 4C1BA 4ZK7A 5AVOA 3BXEA 2JEYA 3OE5A 2N3ZA 5FCDA 3Q9SA 3HCOA 1QX4A 4KO8A 5CRIA 3WWZA 3IH5A 4TRMA 5A2GA 5FJ4C 3EBPA 3TX6A 3EGXB 1ODIA 2GAJA 3A9WA 3MQ4A 3DZBA 2FZKA 1YQ9A 1CQIB 1VYUA 1T0IA 1XOIA 4G5QA 13PKA 1PFQA 3DT9A 2QTWB 1PCXA 2WQZA 1CHNA 3X0DA 5FTJA 4BBZA 3S5UA 2AB0A 5AXDA 5AUNB 4E5DA 1EVYA 1RCUA 1OTYA 3H86A 3M6LA 1Z88A 3P96A 5T4EA 3ESXA 3HV0A 3LD9A 5IT4A 5A5GA 2QG6A 5A7FA 4DVJA 3WNZA 1CVRA 5JYDA 3K1TA 4R7ZA 4NIMA 4HWTA 4FQ5A 2NT3A 3L0DA 4HNQA 2WHPB 3FPKA 4LZOA 4F91B 1WBDA 1V9SA 3ROPA 2FG5A 3F0FA 1D2HA 5FBVB 2RHRA 4O1HA 4GVLA 3NGLA 4D02A 1XCGB 4J16A 3GUZA 1PNTA 1W2HA 4JJAA 4PLZA 3WWCA 2IWRA 1W41A 1LNZA 2P5TB 4LF9B 1U7HA 4X6UA 5DH9A 2CHVA 4ZOAA 1UWVA 4I19A 3BWVA 3E48A 2H0AA 4ZT4A 2P3QA 2AUMA 1L3BA 5ARBA 4CM4A 3TTUA 1W9HA 2QL9A 3WKDA 1Z35A 6ADHA 3A9VA 4G5HA 3RRYA 2Q07A 3LO8A 4G01B 4LJ8A 1N0IA 3HFGA 4P9NA 2GARA 3AZQA 2W6OA 3PCXA 4LHSA 5EZ5A 3VPAA 2ZTUA 2P2YA 3LF1A 4GXQA 4RV5A 1GEGA 3CVUA 3PX3A 1SZPA 4B45A 1L7QA 1GVNB 2WNHA 3LYHA 1NVVQ 2BFEA 4ZQEA 1DWPA 1XTTA 4E3WA 3WGIA 3G0GA 1YQEA 4CEHB 3WGLA 1C8BA 2PK3A 4ZQHA 8ATCA 2HA2A 4POOA 1CTQA 2ZI7A 4MPRA 2G67A 4NBWA 3RTDA 2DR0A 3GXBA 1FFXB 4CCAA 5A4KA 4QDTA 5JBNA 2VSXA 5LDHA 3TAXA 3SQXA 1YNOA 1OROA 2D00A 2HRUA 2PKEA 2PRYA 4TUYA 2P40A 2QN9A 2EBUA 4B62A 2FPMA 2VPIA 2Z8YM 1M90H 2ZBDA 2PMFA 3MSXA 4RENA 3H04A 4WL0A 1MDFA 3WLEA 4ZYYA 4UQLA 3BTOA 3AIIA 1U28A 4ZI7A 3V46A 3VC2A 1YSCA 1L4YA 3KOWA 1PZHA 2G36A 1JJFA 2UVPB 4LE2A 4QXPA 2IYLD 3Q9UA 3E3MA 4B3CA 4N54A 1BIFA 5CEJA 5CGZA 3E27A 4PANA 1D4AA 1UBLS 3BWXA 4QPCA 2KTUA 4N82A 2WVAA 5GGYA 2WE8A 5T8KC 3ZIUA 3IR9A 3AESA 1DC6A 1Z34A 4NWIA 3SC3A 4CV2A 4K8OA 4YK7A 4MAFA 3KQHA 1KQPA 2CK3D 3DP7A 1ARZA 2OVBA 3Q9NA 3PDHA 3CWCA 4F4DA 5K9ZA 1P0QA 1YE3A 3M4XA 5C1OA 2IYPA 1LK0A 4II2A 3F0DA 4FSXA 4M8KA 1BA3A 4WLFA 4YWHA 4EGCB 1FP6A 2D0IA 2AUNA 2C2ZA 1KMMA 1J0XO 3KKZA 3LCJA 4M46A 1E96A 4OLFA 4YJFA 3WGUA 3KCQA 1CHDA 4QGAA 4Y9RA 5FD8A 2XQGA 4QUDA 4B40A 4Y2TA 3IHKA 4JI4B 1NXOA 4R1MA 1KI9A 1JQLB 4XVUA 4M9CA 1AHPA 4P4LA 4OU5A 1WMDA 3GLHA 3QH4A 2DHDA 4WCFA 5DX1A 3WGTA 4L6IA 2OVFA 1W5SA 3WLTA 2FZLA 3MWYW 3QFHA 1PFGA 1YHQF 2QJWA 4GI2A 1PKEA 1NXSA 4QQNA 3WADA 1EXMA 3UV3A 4Q4CA 2IELA 1DAOA 2IV2X 4LSMA 4X20A 1MRZA 4J29A 3BIWA 2GM4A 3HKCB 2CLSA 2BGUA 3AF5A 3E15A 2I8AA 3CCVF 1YE5A 3BIXA 2J08A 3HCPA 3W2FA 5FI3A 1QHXA 3HY4A 1W25A 4F5WA 4PGAA 3W5DA 3GK3A 3KAKA 1G6KA 2H5IA 2FSHA 5BWBA 1SOWA 5A6SA 2X41A 4L8LA 3Q40A 1C9YA 4ZAFA 5F12A 3EZYA 4YP6A 4GNRA 5FXMA 5SYAA 3V7NA 4DQDA 4F38A 4WK0B 5DP2A 3T54A 2EJTA 4IV5A 2O7NA 5HY4A 4OX9Y 4J4HA 4EHKA 3AF0A 2BFAA 4IW3B 4PBSA 1J7HA 2JANA 2YV3A 4MKHA 4UTNA 1SXHA 1Y6ZA 2B34A 1Z4JA 2JIRA 2UUPA 2BFCB 2ZSHA 3RT7A 4OATA 1LPAB 1X1EA 2GDJA 2P2LA 1NZFA 1WHTA 2W6JA 5AKYA 4AUMA 3V4OA 5LQJA 3VR2D 1T1JA 2IYNA 3WYBA 1JEQA 3CUUA 4BZPA 2FEPA 5JLAA 3E0XA 2E37A 4JLUA 3UF0A 2R6ZA 1OV4A 2DWQA 3ET4A 3KBOA 3I5MA 2K2QB 4DOMA 2BGGA 2QRVA 3NM5A 3GEDA 1PVOA 1SEPA 4DCMA 1Z37A 4OHFA 3KG2A 3GEPA 3BRQA 5JJ5A 1F6WA 4EYOA 2OYSA 3HUEA 1WF3A 1VXRA 4OHBA 5JZBA 2YOGA 2ZRIA 4MLCA 5DLPA 3DBHB 3QFCA 1ONNA 3TZEA 5KQRA 1WOYA 1B73A 5JD3A 4RJTA 1NQTA 1T0HB 3DLHA 1A2QA 1GITA 3JZIA 1QK3A 2XCTB 2XNCA 3CUKA 4QOIA 4IGFA 1XZNA 2IV3A 2BJWA 2O2GA 2JAQA 3BGIA 4KP7A 3FOCA 1D2CA 2Z5GA 4QLOA 2W7TA 3A58B 1XEWX 2F90A 3D4BA 4QNMA 3UMBA 4H27A 3WWDA 1KRWA 1YXMA 4XH9B 1M34B 4TVBA 4BAGA 5KVSA 2FFJA 3AFHA 1SOUA 2HJHA 1MC4A 4HKTA 4DEYA 1AY0A 3U9LA 1EHIA 1YR9A 3TZCA 4ZIRA 4CKWA 4L0DA 3WMRA 4EG4A 3UTCA 1KQGA 1GPDG 2LCFA 4WPGA 2WJAA 1ID8A 3OY2A 1J2TA 1WVGA 3NUZA 4MUFA 4EL5A 5HPYB 3K1JA 1PO7A 3OPYI 5CITA 1DJNA 5FBKA 1C3XA 3WNCA 3OM9A 1M2WA 2BR4A 3D8UA 3LL4A 1ZK1A 4XQCA 4H1UA 3AIMA 4L7VA 5DHAA 4I4TF 1PIWA 2FN4A 2V7EA 4IV8A 2I67A 3SEFA 1BTOA 2XW6A 5FEMA 2PQ0A 2Q9BA 4LDQA 1A8IA 1KFBB 3ESZA 3WO1A 3RIEA 1TYZA 3D3WA 3THYA 5H7XA 4AWBA 1VLZA 2CNKA 3RADC 3JQ8A 1NVTA 1YS1X 1WA5A 1G3IA 3KR9A 4AZTA 5EPOA 4BP3A 2QMZA 1PT6A 1KP9A 2NOAA 4ND4A 4ZARA 3A2NA 5I7HA 5BURA 6LDHA 2OBFA 3O8BA 3W3AA 2CZQA 4TYYA 1SRRA 4IOLA 3IQDB 4C04A 2BSQA 1V5WA 2IZ6A 3OPVA 6PFKA 4RTJA 5NULA 4AS1A 4XPIB 4D97A 3B6JA 2SECE 2HS4A 3C7KA 3VUFA 3Q7PA 1IRXA 3VR0A 1KMHA 1NPYA 2PL5A 3CZAA 4FGUA 4FEEA 1MC8A 1Z5OA 1EJ6A 4HRVA 4QPJC 2TS1A 3DCIA 5IXSA 5A02A 3HLYA 2YWRA 4L7QA 4NU6A 1PUJA 3VYSB 1I5RA 4AKIA 1YS6A 1XMIA 2Z9DA 5HP7A 3D00A 5J1SB 2H54A 3KHUA 1ZI9A 5KNCD 2EQ5A 2FFRA 5FUYA 1H4VB 2HRZA 3X3HA 3VJRA 1T3ZA 4HAXA 1Z6GA 2PR7A 5E6RA 3RVKA 4AY5A 2XE8A 3OSZA 4FQ7A 4O1MA 3C74A 2PL1A 3MGKA 4IMRA 2XBUA 4JVOA 4TMXA 1T9BA 4JFAA 5JAMA 3PB3A 1KXJA 1IMOA 2CE7A 1V8BA 2F3UA 4QT4A 3VTIC 4U6NA 1F2UA 4JUFA 3JYLA 4AJPA 1OIXA 3FFXA 3SS8A 4E5NA 1UBEA 3G68A 3IEKA 3PJEA 1LRJA 5EIEA 3AJDA 2EARA 4HUTA 3OQMA 1OHHD 2I6QA 5CVCA 4FB4A 2GB4A 1OXUA 1Z07A 4GX0A 2OCBA 2OFWA 4J9UE 2BLLA 1PAUA 3KB6A 4RS4A 2D8MA 2EHJA 2VEDA 2X2FA 1BOOA 1JSLA 1JEEA 3P2YA 4JYBA 2QLMA 2XZTA 4O3FA 4WN3A 2OG1A 4RV9A 1U7DA 4RVUA 3DWIA 3O8CA 4YCLA 3TCKA 1CZOA 1YJXA 3HJBA 4DDKA 1QIKA 1TMYA 3B9PA 2W2PA 4MHSA 3VR6H 2BJHA 1SG6A 3F5DA 1TK2A 3OO0A 2NTVA 5FOWA 1C7FA 3O3NB 3EWAA 1YFZA 4X91A 1HT3A 4TTSA 3PYLA 2N75A 1BH2A 4AYWA 5KZMB 1M0EA 4IIFA 3EVBA 3LGAA 2WOOA 2ZUTA 5ALKA 3P32A 4KNWA 4MO2A 4MUYA 1UADA 4OHPA 4BFZA 1OTXA 1EBFA 3FPIA 1PYDA 1SKBA 2FWBA 2NT4A 4U5QA 3T9AA 3RHZA 4BJ1A 2ZAGA 4XX1A 4M9QA 1EDDA 5DWVA 1FC0A 4YO7A 3CNQS 1MO4A 1S96A 4GEGA 4C7XA 1OC4A 2YFKA 1W55A 5K3BA 1E5QA 3GJZA 3IP3A 5KDLA 2JH3A 4NABA 4CODB 2J5RA 4P93A 5CG1A 3KVVA 4P84A 1QU2A 3IMEA 2HF9A 1EJ0A 2KMLA 4KE6A 4JLOA 5AM2A 1D0VA 4OPMA 2OKCA 4YRDA 1DO8A 3NBFA 1W52X 2MOKA 2ZDGA 3ERNA 2YRWA 2Z8XA 3GCWA 3OQJA 3ANXA 3OVMA 3OZTA 3L3BA 1KDTA 4K9KA 4RHFA 1Q1NA 4ZVNA 2C7OA 4CM3A 1TUIA 4L78A 2JDIA 4TV8B 1A4UA 1BAPA 1B42A 3CF4A 2A9VA 2VP3A 4L2IA 3F47A 1UH5A 1SC4A 1EIWA 3ME5A 1HZJA 2AT1A 2FZWA 4IEFB 2O0MA 4TL7A 5SV2A 1Q17A 4RW0A 1DFIA 4CEIA 2QJTA 1VKOA 5JJIA 1NN1A 2O2ZA 3FNEA 4S1TA 3SR3A 4B48A 2IU4A 5JADA 2VYNA 1WSBA 1GU7A 4P54A 3SYMA 2QUHA 2WM3A 3ESAA 5GOTA 3VPFA 4BWGA 5JTTA 3MJSA 4ZANA 4B0PA 4P4TA 1NW6A 3CTMA 3WYCA 3RIGA 3HWWA 2ZKLA 3UT0A 3A7EA 4HDSA 5KNLA 1J7KA 4QIHA 2ZW9A 2YWDA 1P7ZA 4BVSA 1C9KA 4KBYA 4EH1A 2BEUB 5LP6B 1OU0A 5G0WA 2B1IA 3BPSA 5TQJA 3EWNA 4JY7A 1GG5A 4R2IA 1LY1A 1R66A 4LF7B 2Z2JA 1Z29A 2AWOA 2NSYA 3LW8A 4K46A 5DMXA 3V2IA 4B46A 1DJOA 4HLUC 5PNTA 3UK0A 1VGVA 2JGEA 4HCJA 1P5ZB 1G5TA 3BWEA 4K81B 4KVFA 4IHAA 4IUCS 3TOXA 2AQKA 1ZJYA 3V4SA 1AUPA 2BISA 2QX7A 2RC5A 1U3CA 3GFOA 3ZBPA 1G8SA 4B6GA 4YCJA 4KDRA 2RGWA 2CBGA 3KD2A 3LBFA 5KS2A 3O75A 4C4SA 1JNYA 4PLGA 1UKVY 4Q4HA 1H4QA 3QNMA 4EY7A 4QYIA 3RRXA 1T0BA 1YB1A 3G7NA 1TDJA 1D2AA 3GVXA 3K94A 5DLEA 5HQJA 2JGAA 2CYAA 2F59A 5D7BA 5LJIA 1KJ8A 3DL2A 1O03A 4IRUB 4GS5A 4U2EA 4AY3A 3L7OA 4LYJA 3MXOA 2F7SA 1C7JA 4Y1GA 2APJA 3SX2A 1TEZA 3S02A 3EFHA 1NSTA 4J6FA 3LRXA 4D9JA 1ZYUA 2WZDA 4G5GA 4ZI3A 2DKOA 3RYIA 4YRPA 3EPRA 3QQPA 3VVBA 1GT91 2IP2A 3QFSA 1XKLA 3G0BA 1PD1A 3QPAA 1A98A 1SUCA 4ZYWA 4G4ZA 1QHHB 4C30A 3ZOPA 3PLNA 4CT0A 2H3HA 1U4OA 5AHRA 4EY5A 1I2MA 3ZHUA 4G5YA 2PFSA 3OQ6A 4TRRA 1NJ5A 1NIJA 3LX8A 1G6Q1 2UYOA 4P3PA 2V9YA 3G2LA 4U6SA 2L2QA 4FMDB 4C1NA 3D5EA 3L4KA 1PF5A 1EG2A 4DPMA 3VOSA 3OTWA 1ZVVA 3I92A 4RY9A 1QHEA 2FP4A 3HB7A 2P0YA 4NE9A 3C1OA 3RCBA 4EFDA 2V7XA 1RZRD 1LW6E 4GPD1 4Q1FA 5K8CA 4OV6B 1L7XA 1NG9A 3FKSD 2YWJA 3UMJA 1L7BA 1ZXXA 1SELA 3ELWA 3O2SB 1CG6A 1V11A 3Q8WA 4LBWA 5IYZF 5EWMA 3OMXA 3R9IA 3VVMA 5ES4B 3VU9B 1FRFS 1OWOA 3KUUA 3JYNA 3IAS6 2C2BA 1CB0A 1QIEA 3EVCA 1ADCA 1P4AA 3IR5A 3D54A 4R8LA 3L7JA 1CP2A 3CA8A 4C0HA 5TS3A 2C9YA 3RRFA 2CDCA 1ACJA 2F8SA 4DSTA 1TYEB 2H7YA 5CIQA 4QO8A 4FHEA 4O29A 4BN4A 3EAFA 3WJQA 1GV0A 2R4TA 5AI0A 5HQ3A 3MCTA 3W5HA 5J58A 1Z56C 4HFMA 5ISMA 3AP1A 2AC7A 2JARA 4KNVA 4UBMA 4ZCQA 721PA 3K05A 5JC1A 1SCUA 2QK4A 3EZ2A 1LBQA 3FD6A 3EC7A 3L06A 1XJ0A 1U8ZA 1UWLA 1VLQA 4PZYA 3U4AA 4KGZA 2WQ7A 1FDTA 3K5PA 3IIEA 1YDGA 5TGTA 4GWLA 3V2HA 4D9FA 2F9LA 3EC2A 1I6KA 1XQWA 1YS9A 1NI5A 1KY4A 4AN1A 2PU5A 3EVEA 1DQPA 1CQJB 3K30A 4XGQA 3S0WA 4D8YA 4IINA 2ODTX 2PSHA 3AESB 2PGNA 3ZLVA 4KQXA 2HCFA 1QQ7A 4XB1A 4GQBA 3IXQA 5T8KA 5HJ5A 5EC8A 5FR1A 2BAGA 1FY2A 2XUAA 3TS1A 5C5DA 2IIVA 3BULA 1FFEA 2Q3FA 5BXQC 4F2HA 1VDMA 2Z0MA 4XTCS 4YQEA 2R7LA 5C5CA 2Z5FA 1SCUB 4HEHA 4N9WA 5A3VA 2DQKA 3SG0A 4TKVB 1IBKB 3C14C 1B6TA 1TI7A 3OHMA 5B2EA 5JDCA 1N1GA 4WE3A 4W5QA 4RL6A 4Z9FA 3H87A 3TRDA 2F55A 1KDPA 5DPMA 1KO1A 2XV1A 4BP1A 1I7QB 3IPCA 1U04A 3L0ZA 4HNHA 2O52A 3NHPA 1E77A 3AQIA 1C9JA 4LTNA 4QFMA 3T7KA 5KIAA 3I6QA 3OLXA 2DPMA 2JBWA 2WOJA 1DV1A 3H5NA 3F9RA 4YRCA 2P5UA 4R54A 4R7GA 1AM4D 5AP9A 3RS9A 3KZKA 4B3DA 4GG1A 1KPHA 4MVJG 1U0JA 3MMSA 3SZGA 3CIFA 2CWWA 1FP7A 2OOSA 2W00A 3PX2A 3TSWA 4EY6A 2GPTA 1XGKA 3PQDA 3U17A 1YQGA 1ZH8A 3II6X 2CMKA 1UJ2A 3GLFA 4TZKA 4DDMA 4C0XA 1BWPA 2IFTA 3ZNNA 3EBOA 4LMAA 1Z0UA 2Q5IA 3K6KA 1SKYB 2B8NA 1WDWB 2AYZA 4Q7JB 1HFJA 3PQ5A 2ZB3A 4CF4A 1VPWA 1E5XA 1QZZA 4OYHA 3WFIA 2BFWA 1Q2XA 1IOWA 4H7PA 3Q2IA 4RDCA 3TR0A 5KQPA 2J7PA 4X94A 1ULTA 4ENWA 3NK7A 2WYHA 1E2FA 5FUMA 1ONBA 4DT1A 5KWIA 4J07A 2NNWB 3K9WA 3VJLA 2IP1A 5EJ8A 1GDHA 1G5PA 4Q3OA 5EIOA 1N9GB 5DNDA 4CQMB 3ZWXA 3KT0A 3WLHA 1WP9A 4I8IA 3S3TA 5CGQB 2GEFA 3WRYA 5KTRA 2HIGA 3CEJA 2VGNA 2E87A 4JOQA 4HNVA 2X7HA 4C4RA 2PA3A 4H1WA 2AR0A 2FWNA 5E1DA 4HTFB 4FE3A 1ST2A 2WTNA 1V7PC 1EP1B 2Z9BA 1KSHA 2QRVB 2CVFA 4IVQA 1JDZA 1YULA 4BNTA 4LY6A 5JXJA 5HR5A 4UUAA 3D7SA 4XFKA 3SPXA 1QVWA 1HLPA 1FMCA 1SZCA 1XZGA 3E8XA 3ETCA 3L93A 4P3OA 5B1HA 1YFJA 2RHDA 4HUQA 3NV7A 4OHZA 1ENYA 2ODNA 2Z2XA 2ATIA 3HDGA 1FXWA 2ZBRA 3I28A 4HMQA 1CF2O 1H1TA 2AE1A 3HUDA 4J1QA 2NP6A 3BMXA 4TT3D 1QSGA 3PLAE 5FBHA 2Q2NA 3QJGA 2ATCA 1W85B 2JEOA 3K2QA 4GPEA 5G40A 2D4HA 5JAHA 5I9SA 2DP4E 1T2UA 2YY5A 4CLEA 3K4PA 4K9PA 4XD7D 4KR2A 3WMEA 1PUIA 4JWTA 1JGTA 3EIFA 3QW2A 1NU8A 3JVIA 1DC4A 1E4EA 1AURA 1Y4SA 4JP8A 1LVGA 4UDOA 5EZQA 4Q4LA 4K8RB 1U0TA 2Z56A 1ZWKA 1SCIA 3IPRA 1J20A 3LC1O 2BO1A 3TNFA 3KVYA 4WZBA 4HMOA 1M2NA 2HYIC 4HGNA 2ZLBA 5HJ2A 1LWNA 1Q6YA 1U11A 3PFIA 2ZS7A 5I6DA 1WXXA 2W5UA 2VDRB 1QYRA 4C78A 4JCCA 4C14A 3M7IA 4X6XA 3DTVA 4WZZA 4NQ3A 3PQ8A 4Y7DA 4OOFA 2Y66A 2A5YB 2GTPA 2B4RO 2CF5A 5BSWA 4MUNA 4US1R 2FK8A 4R0MA 1HE4A 5D3ZA 1P75A 4FTWA 3HSKA 1PVDA 1X14A 5BQ3A 5L40A 5EXSA 3E7WA 1SG0A 4UZSA 1NW9B 5IT9A 2R8XA 2JL1A 3FNIA 2QX4A 2WT8A 1ZM3A 1T6XA 4XB2A 4IDQA 3EMVA 5JSZA 1XL0A 5JCZA 4LVNA 1LNQA 2X7JA 3ZY5A 5LQMA 3DOEA 3DAHA 3C8HA 5DT9A 2VPZA 3I76A 5MFZA 1ZUIA 3P2JA 3PXAA 2DVMA 3C6XA 4X6YA 1M6WA 4G4YA 3NP9A 3WE7A 4E14A 3D3JA 4GR9A 4BT2A 1AUVA 2EFGA 3B2QA 1RABA 2ZANA 3D01A 3A2LA 1NP7A 1PL7A 1X9HA 1ESCA 4Q9DA 5DNCA 4IKPA 3U2QA 4HRYA 4TYMA 3ACCA 4TT8A 3I6YA 1G2IA 1G8JA 5FBZA 3JALA 3RFTA 5AK0A 4HP8A 4KYTA 1ZW6A 3CR7A 2PHNA 1R0YA 1VJGA 3OSUA 5FLKA 1JB9A 2ZITA 2W2QA 4BQIA 3KZNA 1N32B 3RSOA 2R62A 1XV2A 1N6RA 2FSUA 3NHBA 1E1NA 4CL2A 1WKBA 5SYMA 5G0VA 3LLSA 5UKDA 3F4BA 4MV8A 1E2PA 1NQWA 2VUUA 1P5JA 3EOZA 1T1RA 2BKVA 1MQ9A 5A3QA 3FGOA 4C7VA 4E70A 2YX1A 1I3CA 2CJWB 2WKPA 4WZBB 5HQ3B 2WFLB 5CH3A 4WOKA 2NYUA 5CA1A 3EYWA 2ACVA 3GPLA 3RWBA 3WIDA 5K8LA 1OAKA 4BO0A 3HVUA 5K0SA 1GRRA 4U8GA 4ZDWA 1MGPA 2QPLA 1J5EB 3ZD9A 2D06A 5F9MA 3N6XA 5LC1A 4M7WA 1SQ6A 4YAIA 4HWKA 4BYGA 2CDRA 4BFWA 3IUYA 4FDAA 3A1CA 5TQ0A 1HMPA 1YQWA 3JWEA 4QM7A 3FDFA 3HMKA 4EB0A 3QEAZ 1Z39A 1YFLA 5ETJA 1HE5A 1FMTA 3D6UA 3I6BA 4XPIA 2SNIE 5H81A 3U26A 1E6EA 3HVHA 4BO3A 2ETXA 3O2QB 1D4FA 1KI1A 1WB9A 5HDBB 4YV0A 1TTTA 1J33A 2OV4A 1VE1A 3U4DA 1FSSA 4WY5A 2UZ4A 1ZRSA 3EGIA 4YMHA 2PYZA 1D2RA 4P08A 4Q5IA 1WXGA 3FTNA 4TTIA 2CSXA 1WL8A 1IBMB 1GNRA 2PWYA 1Y9ZA 3WLMA 3BEDA 3ZR4B 1V1MA 1N2GA 1I36A 5JV5A 1SQ0A 3OCYA 1E0AA 3O1LA 5JCJA 1GTL1 5BW4A 2RB5A 3C1TA 2GZ3A 4P83A 4IDBA 2OEPA 5E95A 3UZUA 4D45A 2P5YA 3FTFA 2HHHB 4MWDA 4LXYA 4D0LB 3H4TA 4AZVA 4WINA 2GKSA 2OAQ1 1JJIA 3HS3A 3L4SO 3ZEIA 4N41A 5JD6A 4TKLA 3MCVA 3CN7A 1XZQA 2IUSA 1BROA 3SXPA 4BZXA 4F2PA 1SZDA 1LV7A 5C2JB 3CPWF 2GVDC 3MNFA 4E30A 2BDUA 2VTEA 4F56A 4ZIRB 3TSYA 2NU9A 1JPJA 4B09A 4HXYA 1II0A 2VDPB 5FHQA 2XYPA 5BWOA 1PX2A 2VPWA 4BV2A 2CB0A 1KOFA 3O9ZA 4R3NA 1F4LA 4PFSA 1NFRA 2H6EA 3WQBA 1Y4ZA 3RT1A 4HFRA 5AK5A 3QF4A 1R2QA 2G4VA 3IBSA 2ON6A 1LBEA 3AERB 1O58A 3QSYA 2ZRGA 3B6ZA 1TYCA 4I9GA 4KWCA 3THYB 2VZLA 4G24A 3FCYA 1T2CA 3QWIA 4IVRA 4X66B 4RZIA 3P27A 1IHUA 2ZYAA 3S81A 3AR3A 2AA3A 2Z1DA 4LOAA 5TQ0B 4BMPB 1BG6A 1NI4A 1SC6A 3KTAB 3CC7F 4P32A 2V8OA 3V8VA 2DUUA 2GN1A 1QIJA 1CV2A 3UGKA 3L7KA 2RB4A 2DFKB 4ARCA 5BQPA 1R10A 4I9NA 2AI1A 4LYFA 1QTRA 2V8BA 4AY4A 3IEMA 3MRTA 1S2DA 4RK5A 5ED0A 4RNDB 3AY3A 3IJEB 3KQTA 4E88A 3IQHX 2Y92A 2BM9A 3KQSA 1CK2A 4G65A 2ZDQA 3I0MA 1CUGA 4A1OA 3G8CA 1PWEA 3V3TA 2BFCA 4M37A 1JFVA 2K87A 3MVEA 3UPDA 5EGSA 1OZ0A 5KTYA 4W8OA 3SMVA 5ENZA 1GZDA 1IQ0A 2IW1A 1M2HA 1IJFA 2QUZA 1MEJA 1ZEJA 2LPMA 4FZRA 5AKEA 2A0WA 4YRRA 2NSLA 1V47A 3GGGA 3AG6A 4BJ5A 4ROTA 4TXJA 2QB5A 1UBJS 1R5OA 4LJ5A 4PLCA 3RU3A 3DVAB 1E7YA 2LD4A 2WC1A 3UC5A 1CIJA 1G6HA 3QP9A 4RTQA 1ZL2A 3CURA 3FUTA 1P60A 3OU6A 3NXKA 4G0WA 4ZMSA 4KMRA 5B7QA 5IZCA 2Y93A 4L6CA 4J90A 1REQA 5ILQA 3RSZA 3UOWA 3GP5A 4O4LB 3WMXA 4B3HA 3AETA 4XOUA 3A27A 5SY9A 4D46A 3CLRD 4L1KA 1C0KA 3WZMA 4DKXA 3QMWA 1JMVA 5FPSA 1I2ZA 1KTIA 3IP1A 2EL9A 5G4VC 1RWPA 4UVIA 5EHIA 1P6XA 1YB7A 2JLWA 1R50A 3K70C 1XZ8A 1IB6A 1Z36A 5CHEA 4BNGA 1G7SA 1H9BA 1LF5A 1PGNA 1RAIA 2JASA 2WSYB 3IDFA 4GP7A 4P92A 5DJ5A 3O93A 2AI2A 3AKYA 3O94A 4KVAA 5CLJA 4UU7A 2O5VA 3QOFA 5CM8B 4ZC8A 5KOJB 5LQCA 2WFLA 1SKMA 3AVYA 3B1ZA 4DMRA 3BMOB 3WAGA 5EUCA 2BMEA 2MSWA 4NECA 3F7TA 5JQWA 3LFTA 1VJRA 1FE8A 4MW4A 3B5IA 2FR8C 2A94A 5GY7A 1ZD4A 3IE0A 2R1VA 3IA2A 1VP9A 1MRNA 2Z95A 4C0QC 1H69A 4MKZA 5AW0A 1U2EA 3ABRB 2P6MA 3GRVA 3RSHA 2QM3A 1CY0A 2WIFA 3GYBA 1IULA 3KOOA 3IT2A 4D4MA 1EE2A 2XT0A 1E2NA 3ZQ4A 2G1JA 1F48A 3FWPA 4FN4A 5LQRA 1EUQA 5KNDA 4L4RA 1DEAA 3E05A 4YLEA 2ZAMA 3GHZA 3OJ0A 4RXTA 2DT8A 3M1IA 3N2EA 1E4EB 1VIYA 5BWMA 3UW3A 4F4HA 2YJZA 2PLFA 4EJMA 3DEZA 1WUTA 1AKMA 3D7LA 2Q4EA 3Q9LA 4BB9A 2FG7C 4IMPA 3ZKAA 1A04A 3CKYA 3NVAA 5BSVA 5FLXA 3HHPA 4JYZA 4JMPA 1VH8A 4V03A 3F0GA 3I9V1 1A9RA 2C99A 3VHXA 1KMIY 1P18A 4AJIA 3L8GA 1WVMA 4AQYB 2AFVA 3F9CA 1BEZA 1U2ZA 1ZUNA 2ZQZA 3H9CA 4PYIA 1ML4A 4YRJA 1AGYA 1S1MA 3QLEA 4F8YA 2F43A 2G9NA 5A03A 5C37A 1AKNA 1P77A 1ZUWA 2I6SA 3ETJA 3ZHOA 3UJHA 3QUSA 2ZBPA 2VP0A 4U7HA 1DC8A 3RYCA 3VZDA 4N01A 4LOHA 5L7TA 1FRVA 1O97C 3MWKA 4AZWA 4CKEA 1A69A 4EYSA 3TOSA 3WKCA 4WBXC 4GI1A 4Y6SA 4XRGA 3FOFC 2WZBA 5BUSA 1JHRA 1P19A 4MICA 4QJIA 2OMKA 3CEAA 5AI9A 1Z4LA 1QS0B 5DCWA 4ZI7B 2NAPA 3AR5A 2MR6A 3HB4X 2ZS8A 3N5CA 4NLLA 4E13A 2OBLA 2G9VA 1KFEB 2D5AA 3GJ0A 3GIDA 3PR3A 3T5BA 3RJTA 1PDVA 2IU3A 3QKRA 4RTLA 3MUNA 1U1EA 1ZH4A 4HEJA 5ALTA 3EXIB 1O94A 5CYFA 4CGYA 3S68A 3C9SA 1YHYA 1W87A 2E55A 1U40A 3C1AA 4BO2A 1FDRA 3W5AA 1V5FA 4A8PA 2ALJA 4U0JA 1RR6A 3THOA 3U39A 1JA1A 2Q7XA 3CNOA 3ZBQA 2WNIA 4PTZA 5LIRA 3LSTA 2BEUA 2Q4OA 4RVCA 3IKJA 5JY1A 3KTAA 1RI1A 3E22B 1SWVA 1ZSYA 2QAGA 3KEOA 3VO8A 3VZSA 2FR0A 5EGNA 1RAAA 1T9HA 5A5VA 2A58A 1QFJA 5FBQB 4ZCPA 3BDAA 3BRSA 3LUHA 4P98A 5F7JA 1RRCA 5DFAA 4TQGA 4PYLA 2HJGA 3P1JA 4IIDA 1QVGF 4Q66C 3CCQF 2QNRA 3EZ7A 1VLLA 4ALLA 4EHIA 3R5XA 4URHA 5JRDS 4F5ZA 3MIZA 4F4IA 3KM0A 3OP1A 5KWSA 4URVR 3TLMA 3DDUA 3N0WA 4DABA 3AWDA 2IZ1A 1KRHA 2IQIA 3ANSA 4AD8A 5HM6A 1MJFA 4UPVA 4KIGA 2GILA 4QGFA 1O6GA 1W0KA 3D6FA 4Y67A 4WVLA 5HE8A 1GTVA 2QDKA 4BT3A 2CHUA 3U7JA 2FZEA 2IHKA 1K8YB 5T41A 1L8XA 1G9SA 4P8RA 2KB0A 2HYDA 3R20A 3Q0IA 1NXPA 3KZMA 1WCYA 1RE0A 3GQVA 3PS9A 1KEPA 4H7HA 4WZ6A 4B32A 1X15A 4FEGA 4P35A 5I7FA 1KK3A 4EJ2A 4Q18A 3BT7A 4MV6A 4YYZA 5BOSA 2QTVB 5KJEA 1OZFA 4RD2A 4KV9A 3V7WA 1EVEA 1JPVA 5GONF 2QJRA 3IBGA 3OCUA 1X8LA 2ZUCA 2D0DA 2D1FA 3NAGA 4K2AA 4WLEA 3ABSB 1E2GA 1YZTA 2C2KA 5FDFA 3HP7A 1M72A 5U4QA 3RO7A 3S2IA 5IS2A 2NQ8A 3FVWA 5FI0B 4F7DA 3B8HA 3SZMA 3VNQA 3RSLA 2ZFUA 3W4KA 1E20A 1GZ7A 1FP4A 2H59A 2XOXA 3ABQB 1G55A 4CI0B 4LZPA 4H1VA 3R7DA 2BRUC 1UBGA 3BE4A 3SHTA 1W8IA 5HVNA 2FRVA 4FHFA 4BS9A 4PZLA 2Y99A 1EVJA 3SKYA 3I2YX 3V8MA 1NMEA 1X74A 4A0QA 3P20A 5JH7F 1R16A 5DHPA 1MP0A 2AFIB 2VAPA 3GEIA 2HJRA 1U6IA 1PSZA 2ZPUA 4ZCSA 3R7BA 4L4XA 2G9ZA 4JI5B 5BSHA 3WK6A 3DFKA 4KQEA 2PJRA 1PJ3A 2WRZA 1Z7YA 4LZZA 4MWTA 5TARA 1F2UB 1BW9A 1MRSA 3RU7A 2X8JB 3GU3A 3C16C 3Q1KA 1OA0A 2W6MA 2JIZD 3FFAA 4H35A 1BX3A 1A2KC 2X0NA 3NDJA 3ZHYA 3HN2A 5G02A 3INYA 1ORHA 3FHJA 1B41A 3HA3A 2P9YA 2C2YA 3BXZA 1B7GO 2A9OA 2W48A 3CN9A 3DCNA 3L49A 3TEFA 5KPDA 3PYXA 5EKXA 1QPGA 2ZPAA 4QXAA 5DM60 1ISMA 3VI4B 2QY6A 3M6IA 4AB1A 5BWCA 5LZ2A 2FMUA 1RRGA 3RDPA 4I5FA 3ULKA 3C70A 4PFKA 4D3XA 1OI7A 1GFWA 1EESA 4IJKA 3D02A 3OFJA 3PPYA 5JTUA 3FA2A 3A1NA 1Z0IA 2PXAA 1IXKA 2G80A 1DAHA 3JD4A 3VQTA 4A0SA 5F3WB 1JG7A 2XECA 4NDNE 2NU7A 4LFCB 4BNJA 1R5JA 2FWAA 3FFWA 5KHLB 4ERHA 4I99A 1QK5A 1RI4A 2ZRLA 1H93A 5EXTA 1ZCFA 1JHPA 1FNMA 3OT1B 4DKJA 3N6RA 3BGVA 4MRSA 4ZAVA 1HYGA 1KOLA 5KOJA 4OAPA 1RWOA 1E2QA 2R7NA 1SXQA 1O97D 4US0R 5AO9A 2JLRA 4PZCA 3UICA 2TMYA 5CTAA 5FPHA 2GFQA 1KSJA 3OF2A 1XLWA 3JARA 3OOJA 4YQZA 2JFVA 3NOOA 2RB9A 3PT5A 4XQEA 4BDTA 2I3BA 4XFDA 1XVAA 2IHTA 3C6MA 4RLFA 1ENZA 3MUFA 5DGIA 4JOBA 2PPLA 1EFTA 1WCIA 3PQFA 1KVUA 4PICA 1PUXA 1V5EA 3QVMA 1PG5A 3I42A 5D3KA 4AS2A 1CRZA 4PAGA 2A0UA 4YAFA 5CDFE 2Q3EA 5HY0A 1GO0A 4BKMA 1M8KA 3A9CA 3DEIA 3DB2A 1BFUA 2YJ4A 3KZVA 3TBFA 3QU4A 3ESRA 1KYTA 4F4FA 1CC1S 3I61A 3EPKA 3AVTA 3DHYA 4A0GA 3U3XA 5JI2E 4BNMA 1RM3A 2ODWA 4YNBA 3SR4A 3GNQA 2IUEA 1TM7E 3AHJA 1S9DA 3HU3A 4AKTA 4ZOQI 2VP9A 4NCIA 2O8EB 3O8NA 4YEDA 1QHHA 2O8NA 5K0CA 3W0LB 4JT4A 3UHOA 1WULS 3BMNA 4O2BA 4W5OA 1TVMA 121PA 1R7RA 1SEVA 1LLCA 4QECA 2FW1A 1Z45A 1I0ZA 3IVRA 5EIXA 1BHJA 5ALEA 1L1FA 4BJ6A 4HZUA 1OE0A 2Q29A 3R76A 3LE8A 3MYRA 4F6CA 2YHAA 1Q86H 3I5UA 4EJSC 2HMWA 4JVMA 3D0RA 1NE2A 1Q0UA 3O3OB 1IN8A 1ZS9A 5HRAA 1G63A 5DMHA 5CB6A 4ZTZB 2EJVA 4HH1A 1HPLA 1NMSA 5DCVA 1DC7A 3IESA 4KQ6A 4H6VA 5C81A 3R5JA 4OFXA 4OHVA 3E0QA 4D3YA 3SJBA 3JQFC 1J1ZA 2IZ5A 3PBKA 2LVBA 2VCYA 4KE7A 4LG1A 4KIFA 4PIVA 1BYUA 1B93A 2CLOB 4RELA 5IFKA 1O7JA 3TQHA 1S4QA 3ZD7A 2CSUA 2H4JA 1CNFA 4EOGA 4ENUA 3GJXC 1T26A 3QNWA 5JMPA 1U8EA 3BF8A 4RSHA 3OQPA 3FD5A 3DF7A 1CS0B 3EGXA 2UZ1A 4J0CA 4BZWA 1ITZA 2HSGA 4A6EA 1GX1A 1HI9A 2DBRA 3GJSA 3C7AA 3W3AD 3L40A 1X25A 1XSEA 2OA0A 1E6MA 1XKQA 4R16A 3KBBA 4RIIA 2G88A 5IHXA 2AW5A 2BM8A 5ILOA 2BL4A 1CN7A 2QKYA 1IN4A 3U0OA 1COMA 5BV0A 1OFUX 1PR6A 5I9NA 3RIHA 3TRIA 4ARUA 1SCJA 2BMFA 2NPIA 3QUTA 4TN5A 5ESDA 5B3LA 3KOUA 3ZU3A 4Y2YA 3B70A 2XIJA 1Z2AA 4IJQA 3RJZA 1DAGA 4P3NA 3VR4H 4PNPA 4CXMA 4KKVA 3CCUF 2BGTA 1KI3A 4AFNA 1OFGA 3TOZA 5AM3A 5AVWA 2PX6A 4TV8A 1OY1A 3LBHA 5F1OA 4JL8A 2C84A 1UUFA 1DT3A 4RANA 5F7OA 1Y9AA 3I12A 4JI3B 4B47A 5KOHA 3S28A 3GO4A 3LVFO 3OURA 2QVBA 5GV7A 1EFRD 1Q7BA 4PG8A 2X5NA 4N9QA 5JWRA 1ZNXA 2FSFA 2EW8A 2I03A 4S1NA 1EUZA 2D13A 2ZRHA 4HY3A 3M5PA 4GZMA 2QRPA 1GP2A 3ZY4A 1CZRA 5HP8A 5C8YF 4UU1A 4V1CI 1BVUA 2Q1TA 3F6EX 3W3ZB 4DCPA 2GCEA 1TK9A 2H16A 3AILA 1C0LA 4YALA 3ZOKA 4AF6A 4B84A 3EORA 4LOLA 4PSKA 4EZIA 2VNJA 5ICEA 3U4MA 2IOQA 3RYFB 2BCEA 3SOZA 3VYTB 2VIIA 3B1VA 1M8JA 2PKYX 4JIGA 2Q2QA 5F78A 4MHTA 1GOTA 5TX7A 1W581 2CJFA 2YFQA 1MV5A 1N5KA 3FRHA 4X7RA 5EMJA 3BQNB 1VSVA 1ODSA 4FN5A 3OFKA 4HFNA 2EKBA 3ZUPA 1Q1AA 3G5LA 5FH9A 1LSJA 2PNFA 3L07A 3INNA 3HHEA 3PIDA 3Q8HA 1LI5A 2FEMA 2V98A 1UDRA 3NRCA 5AJYA 4YUYA 5JDIA 4HI0E 4NHEA 3KHNA 5DTQA 4XR4A 3K8YA 1FLDA 2Q3MA 1XQ1A 4UBKA 3THRA 1SGWA 2JLZA 4BLRA 3KQNA 3CH6A 3DAPA 1VPEA 3WY9A 3FMOB 2Q49A 3FR8A 3SE0A 1DOZA 1D4ZA 2BHTA 4MRRA 4E5VA 3CF4G 2VT3A 4MEBA 2N42A 5CT5A 3VHQA 2GCNA 2PNJA 4ICIA 2GFIA 3EIHA 4QAJA 1PWYE 3WOHA 4QUGA 4X8HA 2NZ8A 4R40B 3H8VA 2QSZA 2WFZA 4K28A 4N4AA 1GRQA 4HGQA 4U2FA 1XN1A 2MU1A 4DJDC 2H1RA 2WHRA 2ZB7A 5DCLA 5HK9A 3JSXA 2V9ZA 3ED5A 3NASA 1L6IA 1AC5A 4L5IA 4F21A 1K68A 4XR9A 1L0BA 5L7WA 2IUTA 4TLMB 5IU6A 4EBBA 1N6IA 1NUUA 1ZUHA 2GYVA 1WLYA 4FOSA 4GLFA 5D86A 4JVNA 2Z6AA 4IDHA 4J0GA 1ISJA 4C82A 3QVUA 1ZC4A 5K4AA 2L69A 2G1PA 5E7JA 3R6LA 5GVRA 3MTDA 5A9RA 4I81A 1WDKA 4QXRA 1QCZA 4CKWB 4GM0A 5A4IS 1JYEA 4PCAA 4UDXX 5K2OA 4NFLA 4TL8A 2XNDA 3GOHA 3O31A 1R0WA 5FLYA 3C3JA 5CB0A 4KRFA 3N2NA 1PR0A 2OCAA 2RAUA 2ZP1A 4CV1A 3LFUA 4BATA 1OFVA 3E1GA 3OTQA 3U48A 5A04A 5AESA 5ED4A 2HY7A 2A5DA 1U5CA 5TLSA 1LD3A 1X87A 2IZOA 2LCIA 2V55B 3NHZA 4HQRA 5JS6A 2FJPA 3GLUA 4Z3OA 3JQRA 3NTOA 1DWOA 3DBIA 1GGKA 1PGJA 3H6GA 1XTIA 4NBNA 5CVVA 3C7CB 3L18A 1BS9A 1OGYA 1SG9A 3TLEA 4C22A 4CNBA 3Q3CA 4G0XA 1ZNWA 2CCKA 2BFPA 2ECQA 2WAYA 3FKSA 4MQ6A 5AXBA 4OUKX 4D4JA 3N8IA 1TCAA 1N1EA 2JIZA 4IP0A 4EATA 2FQYA 1EQUA 1KRXA 2JNWA 3PEWA 3GCZA 3RARA 1RYZA 3EBLA 1K88A 1QKIA 2EWWA 4PFQA 4WAUA 3LVBA 3OA2A 2B35A 1MAVA 4AU1A 2H7VA 3IYLW 4IOJA 1FDSA 4EA7A 4C9BA 2DHRA 2OHHA 4EY4A 1WDTA 1SBYA 1NVUQ 2A57A 3WGYA 4KMSA 4ITUA 4O8CA 3HWUA 3SI7A 1IHOA 5G4KB 1ZD8A 1WUYA 1NPDA 7AT1A 1V8FA 2XKBA 1JQJC 3DXYA 4LV6A 5IT9M 3C3BA 4YRLA 4JI0B 4YCMA 2C8LA 3I0NA 3FWZA 2QBYB 4PXYA 1CUUA 1P17A 3SKXA 3MTJA 3TTSA 2GYYA 4HLNA 2O50A 1GR1A 2Y1OA 2DMRA 2GYUA 1R00A 4WESA 1M76A 1KYXA 3AHGA 4KR7A 4H4CA 4R31A 1NW7A 3U1VA 4LAFA 4PZUA 2V45A 4OTZA 3TB6A 4KN5A 5DNVA 1UANA 4IAOA 2JZOA 3R8XA 2P41A 1EBBA 4MYSA 2VDWA 5EPEA 3DV2A 1SM4A 4Y7CA 1SXIA 4YASA 4IIGA 2HGSA 4MQBA 5CFNA 1SVOA 1B15A 1TA4A 2VF5X 3U61B 1VRVA 1J97A 3M1LA 2WDPA 1C9EA 1U7XA 1JNXX 2X3UA 4OGWA 3GOQA 2J3LA 4DM3A 2JAXA 3W5BA 4KE9A 1JWLA 1IJEA 2RAFA 1JIVA 4TL9A 4FOOA 4LV5B 2P78A 3GZTB 3OX1A 4N8DA 4WCFC 5ALLA 1S8AA 1YNSA 2WG1A 1RWNA 3RB8A 1YJAA 1PG2A 1QF7A 1G1AA 5TR9A 4KW7A 4KYVA 4LY3A 3DR3A 2A1IA 2J6BA 4QAQA 3M34A 1XPJA 3CR8A 1FX0B 3LJKA 5C34B 1IVNA 3P7MA 1LPOA 1QTQA 3ZHCA 3LUDA 4XKJA 1GFSA 2AF3C 3IQGX 3VOAA 2B1QA 2H0QA 1NSFA 4MYTA 4XGRA 5DN6A 4CMBA 5DM1A 5LB2A 4ZJYA 1OGIA 1C0PA 4G2NA 4RPLA 2P4UA 2JCYA 1SRQA 4OXKA 1LTQA 2VDOB 5AXAA 1PT8A 1DG9A 1WQ4A 1WCIB 4CF5A 3BMQB 3IEWA 3CRQA 3M4SA 2I87A 1QDEA 1N25A 4NBUA 1O0BA 1PEKE 4L6AA 4BMVA 3OW2F 2FYTA 1OFUA 1JDVA 3UV6A 1TT7A 4IDFA 1G8HA 4QU8A 5TY0A 1FMFA 3ILVA 2NZ2A 4YCSA 5HXUA 1KAHA 3DL4A 1MJ5A 2IDMA 3ETGA