3V7EA

Crystal structure of ybxf bound to the sam-i riboswitch aptamer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosome-associated protein L7Ae-like
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ribosomal protein/rna
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7eA00
4X3LA 1VQKF 1X7OA 3I55F 5A2QM 3LWPC 3RA6A 3CMEF 1N8RH 3SIVA 3CPQA 3NMUC 4X3MA 1VQOF 1RLGA 1YITF 5EWRA 3I56F 1KQSF 3V7EA 1GO1A 3CG6A 3LFOA 3AGKA 5GIOC 3G4SF 3NK6A 3CCUF 5EO3A 1M1KH 4C4WC 2HVYD 1VQ9F 3J81M 1GO0A 2OTLF 1T0KB 1Q86H 3CPWF 4BW0B 1KC8H 1RA4A 3J80M 3ON1A 1K73H 2OZBA 1W41A 3G71F 2LBWA 5DCVA 3PAFA 2VGNA 1VQ5F 3V7QA 2VGMA 3JAMM 3IR9A 2I6DA 3CD6F 2WALA 1SDSA 2KG4A 1YJWF 3NK7A 1NMUB 3JCMM 5GANK 2OTJF 3CCEF 1CK2A 3VI6A 2AIFA 1XBIA 1QVGF 3CCMF 1PXWA 2KTUA 1QVFF 5FLXM 1W40A 1VQMF 5FJ4C 3CCQF 1K8AH 1Q81H 1GZ0A 2ALEA 3FFMA 1W2BF 1M90H 3OBWA 1H7MA 3CC2F 3LWVC 1VQNF 1NJIH 3CCRF 1S72F 1VQ6F 3LWQC 3WXMB 1K9MH 3LWRC 1YIJF 3SIUA 2QA4F 3RA5A 1DT9A 1VQ4F 4NUTA 3CCLF 1YHQF 3GYQA 3O85A 4LCKA 3J7AR 3NVKE 3E1YA 3HJWC 5IT9M 3N4YA 5GINC 3CCSF 1YJNF 3NVIB 1KD1H 1W3EX 4TZZA 3G6EF 5GIPC 3VMFB 1VQPF 3CCJF 1ZWZA 2OHWA 1W42A 1IPAA 1CN7A 3OW2F 1VQ8F 3CC7F 1YI2F 1YJ9F 2QEXF 1VQ7F 3CC4F 1JJ2F 3MCAB 2KTVA 5GAPK 3CXCF 3OBYA 5G4VC 2JNBA 3CCVF 3HAXD 3N4ZA 2BO1A 3PLAC 1X7PA 1Q82H 5G4UC 3LWOC 4BY9D 3E20B 3CMAF 1E7KA 1X52A 2LBXA 1VQLF 2QI2A 2CZWA 2FC3A 1Q7YH
chains in the Genus database with same CATH superfamily
5LYJB 4X3LA 5BMVA 5C8YA 5A2QM 3QHDA 3LWPC 5JQGB 3CMEF 1IV1A 3VYTC 3SIVA 3VYSC 4O4JB 1U43A 1H47A 4PWTA 3WPWA 3BYQA 2ZOVA 2ZF8A 4F6RA 3CG6A 5GIOC 2MQEA 2Z01A 5IJ9A 2NMUA 4G4XA 1M1KH 4X1YA 2H8CA 1GO0A 2OTLF 1Q86H 2Q1XA 4BW0B 1RA4A 4EB6A 3ON1A 4TUYB 1W41A 1VH8A 1QU9A 3IEQA 3G71F 4C8IA 4O4LB 4ZHVA 2CHSA 2UYPA 3JALA 5DCVA 2H8EA 4TV9A 1VQ5F 2VGMA 3LMEA 1OAPA 2AMTA 2GZLA 2L26A 5IYZA 2I6DA 1RLUA 1VHAA 4LNUB 3NK7A 1NMUB 2IG8A 5B8FA 1CK2A 5JVDA 3E22A 3S0YA 1XBIA 1QVGF 3D01A 2P6YA 4IHJB 1JFFA 2R751 3F0FA 1Q81H 5J2TB 3CB2A 5LXTB 4BT2A 5HY2A 5EZYA 2CW4A 3OBWA 3TD3A 1QD9A 3EORA 2I6RA 3SIUA 2CHTA 4O4IB 4BT3A 5J2UB 3C9UA 3GYQA 3S06A 3J7AR 3RYFA 3N4YA 5GINC 1OFUA 1YGYA 1KD1H 4ZHWA 3WJRA 1VQPF 3CCJF 1ZWZA 2KGWA 1PF5A 2OHWA 3MBMA 4I4TA 3HKCA 4U3JB 1IPAA 3OONA 4B45A 1CN7A 3VOAA 4C8EA 5CA0B 1VQ8F 1YI2F 3CC7F 5ITZB 5HXZA 3VYUC 4WBNB 5MN6A 1FNKA 1TVKB 4FFBB 5GAPK 4C81A 3CXCF 3N4ZA 2Q1YA 3WJQA 3KJJA 1Q82H 5FNVA 4ZHYB 1IV4A 3F0DA 4ZK7A 3CMAF 1W5FA 1U3LA 1YQNA 1E7KA 1VK3A 3V3TA 4BVRA 5BMVB 3KE1A 5C8YB 3LDTA 2QI2A 5MN4A 3Q8HA 3ZO8A 3S03A 2OTMA 3ZP4A 3RA6A 4HNAA 4F6RB 1W57A 3LYBA 3I56F 2RHOA 1GO1A 4X1YB 3LFOA 5LOVA 3AGKA 3D00A 5JH7A 3CCUF 2AIZP 5GONA 3C9SA 3F0GA 2HVYD 2UZHA 3F0EA 4EB6B 2HS4A 1KC8H 3J80M 1VQVA 3FD6A 3JASA 3IKFA 4B62A 3D54A 4TV9B 2Z1EA 1JY8A 3HKBB 1Z5WA 5IYZB 3WGJA 1W5BA 4YJ3A 2BTQB 1JN1A 2UYJA 2BTOA 2KG4A 5JVDB 3E22B 3ERNA 4X1KA 3JCMM 2OTJF 1XHOA 1COMA 3I3FA 3MCQA 5HP7A 3RYHB 1SA0A 5EYPA 1Q8RA 3CCMF 2VAPA 4I55A 4G4ZA 5FJ4C 1W40A 3RYCB 3CCQF 5HY0A 2F9ZC 3HKDB 5LP6B 2BTUA 5EZYB 2YYEA 1GZ0A 2UYNA 2Z1FA 3HKEB 5EB0A 1UFYA 3N2GA 3RYIA 1SZQA 1ODEA 1VQNF 2IQQA 2CSLA 4G4YA 3LWRC 1YIJF 2PMPA 5KMGA 4E6EA 3K2XA 4DRXA 4TV8A 4KWEA 3RA5A 2QA4F 3RYFB 4NUTA 2HP0A 3FBAA 4YJ2B 3C9TA 2W8BC 2VXYA 4I50B 4O2BB 3HJWC 5IT9M 3F6MA 3S0WA 1R1MA 3CCSF 1YJNF 2HX0A 1W3EX 2DYYA 3JAWA 4TZZA 3G6EF 3VOBA 5GIPC 1FNJA 2ZODA 4X20A 3IMPA 2FGYA 1TUBA 3OW2F 4X1IB 3ZP7A 5KX5A 1NQ3A 1VQ7F 3MCAB 2HRUA 1FFXA 5FNVB 4C8GA 2KTVA 3UT5A 3GHZA 3DDNA 5CB4A 3CCVF 4G4VA 3PLAC 1X7PA 3P0ZA 1XRGA 5G4UC 4BVQA 3LWOC 3P10A 4BY9D 3JAKA 5LA6A 4BT5A 2LBXA 5IJ0A 5CA1A 4O2AA 1VQKF 1X7OA 4B46A 4EI9A 3IKEA 2G9IA 2RHHA 4C82A 1W5AA 3N2KB 5LOVB 1IV3A 3MQWA 5JH7B 5GONB 3WGKA 4R40B 1YITF 1KQSF 3DC2A 1FSZA 3JVHA 5EO3A 1KNJA 2K1SA 3ESJA 2HP3A 1VQ9F 4EI8A 3WGMA 3J81M 3GTZA 1T0KB 3JARA 3CPWF 3JATA 4ZOLA 3FD5A 2VAMA 2LBTA 2HRYA 2DT4A 2LBWA 5MN5A 2HQSC 4YJ3B 3PAFA 2B33A 3ELCA 2RHJA 3KIZA 3MDOA 3JAMM 3WPXA 4X1KB 3IEWA 3CD6F 5HXUA 1XV2A 5IJ9B 1YJWF 3WJPA 3U0OA 5GANK 3CCEF 3C9RA 2AIFA 4I55B 5EIBD 1JD1A 1QVFF 5FLXM 5HWEA 2R6R1 1VQMF 4G4WA 3JALB 1W59A 2LCAA 3N2GB 2PHNA 3RYIB 2ALEA 3S0HA 3FFMA 1W2BF 2ZVYA 3HWUA 3CCRF 1S72F 3WXMB 4TV8B 3FPIA 4DRXB 1RQ7A 1Z5VA 3M4SA 1VQ4F 1J7HA 5JCOC 3CCLF 3O85A 1JFFB 3K0TA 4LCKA 4XCQA 1KNKA 4X20B 2YXZA 2Z1UA 4IIJA 3VMFB 5EIBC 1TUBB 1W42A 5KX5B 3C8LA 4ZI7A 1FFXB 5CB4B 3UT5B 1YJ9F 4NWOB 2QEXF 1UI9A 5HY1A 5EB1B 4O4HA 3S02A 3OBYA 5G4VC 2JNBA 1W55A 3VTIC 4BVSA 3JAKB 5LA6B 4BT6A 3CYPB 3RE3A 5IJ0B 5JCOA 5CA1B 4O2AB 4ZHQA 3VCZA 2GLZA 1X52A 3TD5A 5LP6C 4I4TB 3HKCB 1Q7YH 3T80A 3I55F 2RB9A 3M1XA 3KJKA 3TD4A 1N8RH 3HKBA 5LYJA 3CPQA 3NMUC 4X3MA 2Z1TA 1VQOF 1RLGA 5JQGA 4RHAA 5EWRA 4O4JA 3V7EA 3G4SF 1RQ2A 3NK6A 4RQOA 2ZVZA 3JARB 3JATB 4DXDA 4C4WC 4ZOLB 3RYHA 2EWCA 3K12A 1W5EA 1K73H 2OZBA 3M84A 3QTYA 3B6NA 1CLIA 2VAWA 4TUYA 3RYCA 3HKDA 4HNAB 5LP6A 2GVIA 2VGNA 4O4LA 3V7QA 3R0PA 3HKEA 3IR9A 4ERHA 2WALA 3P4EA 1SDSA 5HP8A 4BT7A 1X25A 2ZAUA 4LNUA 3K14A 3VI6A 3I7TA 3VO8A 3WGLA 3HTNA 3JASB 4YJ2A 3KHNA 4O2BA 4I50A 1PXWA 2KTUA 4B5CA 4IHJA 3WGNA 1K8AH 2QTPA 4BVTA 2H6LA 1M90H 2CWJA 2HS0A 5J2TA 1H7MA 4U39A 2CVLA 5AVMA 5LXTA 3CC2F 2V9YA 3LWVC 1NJIH 1VQ6F 3LWQC 1U3PA 4X1IA 1K9MH 3V4DA 1QAHA 4G88A 3VIUA 1W581 4M8IA 1DT9A 1ONIA 1SA0B 3CYQA 1YHQF 5EYPB 4O4IA 5J2UA 3NVKE 1IV2A 3E1YA 4IIJB 1DBFA 1T0AA 3NVIB 5HY4A 2UYNB 3ZOPA 4ZI7B 2RHLA 3QUWA 4U3JA 5EAZA 4O4HB 1H48A 3N2KA 4NQ3A 3CC4F 5KMGB 1JJ2F 5CA0A 4BT4A 4EI7A 2IAFA 3HAXD 5ITZA 4WBNA 2HP0B 2BO1A 1GX1A 2HS3A 2UYKA 1TVKA 4FFBA 4ZHQB 3E20B 3JAWB 2N48A 3L7QA 1U40A 1VQLF 2CZWA 2FC3A
chains in the Genus database with same CATH topology
4X3LA 1VQKF 1X7OA 3I55F 4EI9A 5A2QM 3LWPC 3RA6A 3CMEF 1N8RH 3SIVA 3CPQA 3NMUC 4X3MA 1VQOF 1RLGA 1YITF 5EWRA 3I56F 1KQSF 3V7EA 1GO1A 3CG6A 3LFOA 3AGKA 5GIOC 3D00A 3G4SF 3NK6A 3CCUF 5EO3A 1M1KH 4C4WC 2HVYD 1VQ9F 4EI8A 3J81M 1GO0A 2OTLF 1T0KB 1Q86H 3CPWF 4BW0B 1KC8H 1RA4A 3J80M 3ON1A 1K73H 2OZBA 1W41A 3G71F 2LBWA 5DCVA 3PAFA 2VGNA 1VQ5F 3V7QA 2VGMA 3JAMM 3IR9A 2I6DA 3CD6F 2WALA 5HXUA 1SDSA 2KG4A 1YJWF 3NK7A 1NMUB 3JCMM 5GANK 2OTJF 3CCEF 1CK2A 3VI6A 2AIFA 1XBIA 1QVGF 3CCMF 1PXWA 2KTUA 1QVFF 5FLXM 1W40A 5HWEA 1VQMF 5FJ4C 3CCQF 5HY0A 1K8AH 2F9ZC 4BVTA 1Q81H 1GZ0A 2ALEA 3FFMA 5HY2A 1W2BF 1M90H 3OBWA 1H7MA 3CC2F 3LWVC 1VQNF 1NJIH 3CCRF 1S72F 1VQ6F 3LWQC 3WXMB 1K9MH 3LWRC 1YIJF 3SIUA 2QA4F 3RA5A 1DT9A 1VQ4F 4NUTA 3CCLF 1YHQF 3GYQA 3O85A 4LCKA 3J7AR 3NVKE 4XCQA 3E1YA 3HJWC 5IT9M 3N4YA 5GINC 3CCSF 1YJNF 3NVIB 5HY4A 1KD1H 1W3EX 4TZZA 3G6EF 5GIPC 3VMFB 1VQPF 3CCJF 1ZWZA 2OHWA 1W42A 1IPAA 1CN7A 2FGYA 3OW2F 1VQ8F 3CC7F 1YI2F 1YJ9F 2QEXF 5HXZA 1VQ7F 4NQ3A 3CC4F 1JJ2F 3MCAB 5HY1A 2KTVA 4EI7A 5GAPK 3OBYA 5G4VC 2JNBA 3CXCF 3CCVF 3N4ZA 3HAXD 2BO1A 4BVSA 3PLAC 1X7PA 1Q82H 5G4UC 4BVQA 3LWOC 4BY9D 3E20B 3CMAF 1E7KA 2GLZA 3V3TA 4BVRA 1X52A 2LBXA 1VQLF 2QI2A 2CZWA 2FC3A 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3L A;  1VQK F;  1X7O A;  3I55 F;  5A2Q M;  3LWP C;  3RA6 A;  3CME F;  1N8R H;  3SIV A;  3CPQ A;  3NMU C;  4X3M A;  1VQO F;  1RLG A;  1YIT F;  5EWR A;  3I56 F;  1KQS F;  3V7E A;  1GO1 A;  3CG6 A;  3LFO A;  3AGK A;  5GIO C;  3G4S F;  3NK6 A;  3CCU F;  5EO3 A;  1M1K H;  4C4W C;  2HVY D;  1VQ9 F;  3J81 M;  1GO0 A;  2OTL F;  1T0K B;  1Q86 H;  3CPW F;  4BW0 B;  1KC8 H;  1RA4 A;  3J80 M;  3ON1 A;  1K73 H;  2OZB A;  1W41 A;  3G71 F;  2LBW A;  5DCV A;  3PAF A;  2VGN A;  1VQ5 F;  3V7Q A;  2VGM A;  3JAM M;  3IR9 A;  2I6D A;  3CD6 F;  2WAL A;  1SDS A;  2KG4 A;  1YJW F;  3NK7 A;  1NMU B;  3JCM M;  5GAN K;  2OTJ F;  3CCE F;  1CK2 A;  3VI6 A;  2AIF A;  1XBI A;  1QVG F;  3CCM F;  1PXW A;  2KTU A;  1QVF F;  5FLX M;  1W40 A;  1VQM F;  5FJ4 C;  3CCQ F;  1K8A H;  1Q81 H;  1GZ0 A;  2ALE A;  3FFM A;  1W2B F;  1M90 H;  3OBW A;  1H7M A;  3CC2 F;  3LWV C;  1VQN F;  1NJI H;  3CCR F;  1S72 F;  1VQ6 F;  3LWQ C;  3WXM B;  1K9M H;  3LWR C;  1YIJ F;  3SIU A;  2QA4 F;  3RA5 A;  1DT9 A;  1VQ4 F;  4NUT A;  3CCL F;  1YHQ F;  3GYQ A;  3O85 A;  4LCK A;  3J7A R;  3NVK E;  3E1Y A;  3HJW C;  5IT9 M;  3N4Y A;  5GIN C;  3CCS F;  1YJN F;  3NVI B;  1KD1 H;  1W3E X;  4TZZ A;  3G6E F;  5GIP C;  3VMF B;  1VQP F;  3CCJ F;  1ZWZ A;  2OHW A;  1W42 A;  1IPA A;  1CN7 A;  3OW2 F;  1VQ8 F;  3CC7 F;  1YI2 F;  1YJ9 F;  2QEX F;  1VQ7 F;  3CC4 F;  1JJ2 F;  3MCA B;  2KTV A;  5GAP K;  3CXC F;  3OBY A;  5G4V C;  2JNB A;  3CCV F;  3HAX D;  3N4Z A;  2BO1 A;  3PLA C;  1X7P A;  1Q82 H;  5G4U C;  3LWO C;  4BY9 D;  3E20 B;  3CMA F;  1E7K A;  1X52 A;  2LBX A;  1VQL F;  2QI2 A;  2CZW A;  2FC3 A;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 5LYJ B;  4X3L A;  5BMV A;  5C8Y A;  5A2Q M;  3QHD A;  3LWP C;  5JQG B;  3CME F;  1IV1 A;  3VYT C;  3SIV A;  3VYS C;  4O4J B;  1U43 A;  1H47 A;  4PWT A;  3WPW A;  3BYQ A;  2ZOV A;  2ZF8 A;  4F6R A;  3CG6 A;  5GIO C;  2MQE A;  2Z01 A;  5IJ9 A;  2NMU A;  4G4X A;  1M1K H;  4X1Y A;  2H8C A;  1GO0 A;  2OTL F;  1Q86 H;  2Q1X A;  4BW0 B;  1RA4 A;  4EB6 A;  3ON1 A;  4TUY B;  1W41 A;  1VH8 A;  1QU9 A;  3IEQ A;  3G71 F;  4C8I A;  4O4L B;  4ZHV A;  2CHS A;  2UYP A;  3JAL A;  5DCV A;  2H8E A;  4TV9 A;  1VQ5 F;  2VGM A;  3LME A;  1OAP A;  2AMT A;  2GZL A;  2L26 A;  5IYZ A;  2I6D A;  1RLU A;  1VHA A;  4LNU B;  3NK7 A;  1NMU B;  2IG8 A;  5B8F A;  1CK2 A;  5JVD A;  3E22 A;  3S0Y A;  1XBI A;  1QVG F;  3D01 A;  2P6Y A;  4IHJ B;  1JFF A;  2R75 1;  3F0F A;  1Q81 H;  5J2T B;  3CB2 A;  5LXT B;  4BT2 A;  5HY2 A;  5EZY A;  2CW4 A;  3OBW A;  3TD3 A;  1QD9 A;  3EOR A;  2I6R A;  3SIU A;  2CHT A;  4O4I B;  4BT3 A;  5J2U B;  3C9U A;  3GYQ A;  3S06 A;  3J7A R;  3RYF A;  3N4Y A;  5GIN C;  1OFU A;  1YGY A;  1KD1 H;  4ZHW A;  3WJR A;  1VQP F;  3CCJ F;  1ZWZ A;  2KGW A;  1PF5 A;  2OHW A;  3MBM A;  4I4T A;  3HKC A;  4U3J B;  1IPA A;  3OON A;  4B45 A;  1CN7 A;  3VOA A;  4C8E A;  5CA0 B;  1VQ8 F;  1YI2 F;  3CC7 F;  5ITZ B;  5HXZ A;  3VYU C;  4WBN B;  5MN6 A;  1FNK A;  1TVK B;  4FFB B;  5GAP K;  4C81 A;  3CXC F;  3N4Z A;  2Q1Y A;  3WJQ A;  3KJJ A;  1Q82 H;  5FNV A;  4ZHY B;  1IV4 A;  3F0D A;  4ZK7 A;  3CMA F;  1W5F A;  1U3L A;  1YQN A;  1E7K A;  1VK3 A;  3V3T A;  4BVR A;  5BMV B;  3KE1 A;  5C8Y B;  3LDT A;  2QI2 A;  5MN4 A;  3Q8H A;  3ZO8 A;  3S03 A;  2OTM A;  3ZP4 A;  3RA6 A;  4HNA A;  4F6R B;  1W57 A;  3LYB A;  3I56 F;  2RHO A;  1GO1 A;  4X1Y B;  3LFO A;  5LOV A;  3AGK A;  3D00 A;  5JH7 A;  3CCU F;  2AIZ P;  5GON A;  3C9S A;  3F0G A;  2HVY D;  2UZH A;  3F0E A;  4EB6 B;  2HS4 A;  1KC8 H;  3J80 M;  1VQV A;  3FD6 A;  3JAS A;  3IKF A;  4B62 A;  3D54 A;  4TV9 B;  2Z1E A;  1JY8 A;  3HKB B;  1Z5W A;  5IYZ B;  3WGJ A;  1W5B A;  4YJ3 A;  2BTQ B;  1JN1 A;  2UYJ A;  2BTO A;  2KG4 A;  5JVD B;  3E22 B;  3ERN A;  4X1K A;  3JCM M;  2OTJ F;  1XHO A;  1COM A;  3I3F A;  3MCQ A;  5HP7 A;  3RYH B;  1SA0 A;  5EYP A;  1Q8R A;  3CCM F;  2VAP A;  4I55 A;  4G4Z A;  5FJ4 C;  1W40 A;  3RYC B;  3CCQ F;  5HY0 A;  2F9Z C;  3HKD B;  5LP6 B;  2BTU A;  5EZY B;  2YYE A;  1GZ0 A;  2UYN A;  2Z1F A;  3HKE B;  5EB0 A;  1UFY A;  3N2G A;  3RYI A;  1SZQ A;  1ODE A;  1VQN F;  2IQQ A;  2CSL A;  4G4Y A;  3LWR C;  1YIJ F;  2PMP A;  5KMG A;  4E6E A;  3K2X A;  4DRX A;  4TV8 A;  4KWE A;  3RA5 A;  2QA4 F;  3RYF B;  4NUT A;  2HP0 A;  3FBA A;  4YJ2 B;  3C9T A;  2W8B C;  2VXY A;  4I50 B;  4O2B B;  3HJW C;  5IT9 M;  3F6M A;  3S0W A;  1R1M A;  3CCS F;  1YJN F;  2HX0 A;  1W3E X;  2DYY A;  3JAW A;  4TZZ A;  3G6E F;  3VOB A;  5GIP C;  1FNJ A;  2ZOD A;  4X20 A;  3IMP A;  2FGY A;  1TUB A;  3OW2 F;  4X1I B;  3ZP7 A;  5KX5 A;  1NQ3 A;  1VQ7 F;  3MCA B;  2HRU A;  1FFX A;  5FNV B;  4C8G A;  2KTV A;  3UT5 A;  3GHZ A;  3DDN A;  5CB4 A;  3CCV F;  4G4V A;  3PLA C;  1X7P A;  3P0Z A;  1XRG A;  5G4U C;  4BVQ A;  3LWO C;  3P10 A;  4BY9 D;  3JAK A;  5LA6 A;  4BT5 A;  2LBX A;  5IJ0 A;  5CA1 A;  4O2A A;  1VQK F;  1X7O A;  4B46 A;  4EI9 A;  3IKE A;  2G9I A;  2RHH A;  4C82 A;  1W5A A;  3N2K B;  5LOV B;  1IV3 A;  3MQW A;  5JH7 B;  5GON B;  3WGK A;  4R40 B;  1YIT F;  1KQS F;  3DC2 A;  1FSZ A;  3JVH A;  5EO3 A;  1KNJ A;  2K1S A;  3ESJ A;  2HP3 A;  1VQ9 F;  4EI8 A;  3WGM A;  3J81 M;  3GTZ A;  1T0K B;  3JAR A;  3CPW F;  3JAT A;  4ZOL A;  3FD5 A;  2VAM A;  2LBT A;  2HRY A;  2DT4 A;  2LBW A;  5MN5 A;  2HQS C;  4YJ3 B;  3PAF A;  2B33 A;  3ELC A;  2RHJ A;  3KIZ A;  3MDO A;  3JAM M;  3WPX A;  4X1K B;  3IEW A;  3CD6 F;  5HXU A;  1XV2 A;  5IJ9 B;  1YJW F;  3WJP A;  3U0O A;  5GAN K;  3CCE F;  3C9R A;  2AIF A;  4I55 B;  5EIB D;  1JD1 A;  1QVF F;  5FLX M;  5HWE A;  2R6R 1;  1VQM F;  4G4W A;  3JAL B;  1W59 A;  2LCA A;  3N2G B;  2PHN A;  3RYI B;  2ALE A;  3S0H A;  3FFM A;  1W2B F;  2ZVY A;  3HWU A;  3CCR F;  1S72 F;  3WXM B;  4TV8 B;  3FPI A;  4DRX B;  1RQ7 A;  1Z5V A;  3M4S A;  1VQ4 F;  1J7H A;  5JCO C;  3CCL F;  3O85 A;  1JFF B;  3K0T A;  4LCK A;  4XCQ A;  1KNK A;  4X20 B;  2YXZ A;  2Z1U A;  4IIJ A;  3VMF B;  5EIB C;  1TUB B;  1W42 A;  5KX5 B;  3C8L A;  4ZI7 A;  1FFX B;  5CB4 B;  3UT5 B;  1YJ9 F;  4NWO B;  2QEX F;  1UI9 A;  5HY1 A;  5EB1 B;  4O4H A;  3S02 A;  3OBY A;  5G4V C;  2JNB A;  1W55 A;  3VTI C;  4BVS A;  3JAK B;  5LA6 B;  4BT6 A;  3CYP B;  3RE3 A;  5IJ0 B;  5JCO A;  5CA1 B;  4O2A B;  4ZHQ A;  3VCZ A;  2GLZ A;  1X52 A;  3TD5 A;  5LP6 C;  4I4T B;  3HKC B;  1Q7Y H;  3T80 A;  3I55 F;  2RB9 A;  3M1X A;  3KJK A;  3TD4 A;  1N8R H;  3HKB A;  5LYJ A;  3CPQ A;  3NMU C;  4X3M A;  2Z1T A;  1VQO F;  1RLG A;  5JQG A;  4RHA A;  5EWR A;  4O4J A;  3V7E A;  3G4S F;  1RQ2 A;  3NK6 A;  4RQO A;  2ZVZ A;  3JAR B;  3JAT B;  4DXD A;  4C4W C;  4ZOL B;  3RYH A;  2EWC A;  3K12 A;  1W5E A;  1K73 H;  2OZB A;  3M84 A;  3QTY A;  3B6N A;  1CLI A;  2VAW A;  4TUY A;  3RYC A;  3HKD A;  4HNA B;  5LP6 A;  2GVI A;  2VGN A;  4O4L A;  3V7Q A;  3R0P A;  3HKE A;  3IR9 A;  4ERH A;  2WAL A;  3P4E A;  1SDS A;  5HP8 A;  4BT7 A;  1X25 A;  2ZAU A;  4LNU A;  3K14 A;  3VI6 A;  3I7T A;  3VO8 A;  3WGL A;  3HTN A;  3JAS B;  4YJ2 A;  3KHN A;  4O2B A;  4I50 A;  1PXW A;  2KTU A;  4B5C A;  4IHJ A;  3WGN A;  1K8A H;  2QTP A;  4BVT A;  2H6L A;  1M90 H;  2CWJ A;  2HS0 A;  5J2T A;  1H7M A;  4U39 A;  2CVL A;  5AVM A;  5LXT A;  3CC2 F;  2V9Y A;  3LWV C;  1NJI H;  1VQ6 F;  3LWQ C;  1U3P A;  4X1I A;  1K9M H;  3V4D A;  1QAH A;  4G88 A;  3VIU A;  1W58 1;  4M8I A;  1DT9 A;  1ONI A;  1SA0 B;  3CYQ A;  1YHQ F;  5EYP B;  4O4I A;  5J2U A;  3NVK E;  1IV2 A;  3E1Y A;  4IIJ B;  1DBF A;  1T0A A;  3NVI B;  5HY4 A;  2UYN B;  3ZOP A;  4ZI7 B;  2RHL A;  3QUW A;  4U3J A;  5EAZ A;  4O4H B;  1H48 A;  3N2K A;  4NQ3 A;  3CC4 F;  5KMG B;  1JJ2 F;  5CA0 A;  4BT4 A;  4EI7 A;  2IAF A;  3HAX D;  5ITZ A;  4WBN A;  2HP0 B;  2BO1 A;  1GX1 A;  2HS3 A;  2UYK A;  1TVK A;  4FFB A;  4ZHQ B;  3E20 B;  3JAW B;  2N48 A;  3L7Q A;  1U40 A;  1VQL F;  2CZW A;  2FC3 A; 
#chains in the Genus database with same CATH homology
 4X3L A;  1VQK F;  1X7O A;  3I55 F;  4EI9 A;  5A2Q M;  3LWP C;  3RA6 A;  3CME F;  1N8R H;  3SIV A;  3CPQ A;  3NMU C;  4X3M A;  1VQO F;  1RLG A;  1YIT F;  5EWR A;  3I56 F;  1KQS F;  3V7E A;  1GO1 A;  3CG6 A;  3LFO A;  3AGK A;  5GIO C;  3D00 A;  3G4S F;  3NK6 A;  3CCU F;  5EO3 A;  1M1K H;  4C4W C;  2HVY D;  1VQ9 F;  4EI8 A;  3J81 M;  1GO0 A;  2OTL F;  1T0K B;  1Q86 H;  3CPW F;  4BW0 B;  1KC8 H;  1RA4 A;  3J80 M;  3ON1 A;  1K73 H;  2OZB A;  1W41 A;  3G71 F;  2LBW A;  5DCV A;  3PAF A;  2VGN A;  1VQ5 F;  3V7Q A;  2VGM A;  3JAM M;  3IR9 A;  2I6D A;  3CD6 F;  2WAL A;  5HXU A;  1SDS A;  2KG4 A;  1YJW F;  3NK7 A;  1NMU B;  3JCM M;  5GAN K;  2OTJ F;  3CCE F;  1CK2 A;  3VI6 A;  2AIF A;  1XBI A;  1QVG F;  3CCM F;  1PXW A;  2KTU A;  1QVF F;  5FLX M;  1W40 A;  5HWE A;  1VQM F;  5FJ4 C;  3CCQ F;  5HY0 A;  1K8A H;  2F9Z C;  4BVT A;  1Q81 H;  1GZ0 A;  2ALE A;  3FFM A;  5HY2 A;  1W2B F;  1M90 H;  3OBW A;  1H7M A;  3CC2 F;  3LWV C;  1VQN F;  1NJI H;  3CCR F;  1S72 F;  1VQ6 F;  3LWQ C;  3WXM B;  1K9M H;  3LWR C;  1YIJ F;  3SIU A;  2QA4 F;  3RA5 A;  1DT9 A;  1VQ4 F;  4NUT A;  3CCL F;  1YHQ F;  3GYQ A;  3O85 A;  4LCK A;  3J7A R;  3NVK E;  4XCQ A;  3E1Y A;  3HJW C;  5IT9 M;  3N4Y A;  5GIN C;  3CCS F;  1YJN F;  3NVI B;  5HY4 A;  1KD1 H;  1W3E X;  4TZZ A;  3G6E F;  5GIP C;  3VMF B;  1VQP F;  3CCJ F;  1ZWZ A;  2OHW A;  1W42 A;  1IPA A;  1CN7 A;  2FGY A;  3OW2 F;  1VQ8 F;  3CC7 F;  1YI2 F;  1YJ9 F;  2QEX F;  5HXZ A;  1VQ7 F;  4NQ3 A;  3CC4 F;  1JJ2 F;  3MCA B;  5HY1 A;  2KTV A;  4EI7 A;  5GAP K;  3OBY A;  5G4V C;  2JNB A;  3CXC F;  3CCV F;  3N4Z A;  3HAX D;  2BO1 A;  4BVS A;  3PLA C;  1X7P A;  1Q82 H;  5G4U C;  4BVQ A;  3LWO C;  4BY9 D;  3E20 B;  3CMA F;  1E7K A;  2GLZ A;  3V3T A;  4BVR A;  1X52 A;  2LBX A;  1VQL F;  2QI2 A;  2CZW A;  2FC3 A;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...