3V7EA

Crystal structure of ybxf bound to the sam-i riboswitch aptamer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosomal protein/rna
molecule keywords Ribosome-associated protein L7Ae-like
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7eA00
3NK6A 3CMEF 1VQPF 1N8RH 1XBIA 1QVFF 3RA5A 3CXCF 1VQLF 3G4SF 3J81M 1VQ8F 3CCEF 3OBWA 3J80M 3CCUF 3CG6A 2I6DA 4C4WC 5GINC 2JNBA 5GAPK 2QA4F 2LBXA 1T0KB 1K73H 2VGNA 2OTLF 3N4YA 3CCSF 5G4VC 1CN7A 3O85A 3LWOC 3HJWC 3CCLF 1VQ6F 1Q7YH 3CCJF 1Q86H 3J7AR 1GO0A 3VI6A 2KG4A 3CCRF 1YJWF 1RLGA 3CD6F 3NVIB 2FC3A 3CCVF 5EWRA 5GIPC 3VMFB 3LWQC 3LWRC 1VQ4F 3V7QA 1VQ9F 1PXWA 5EO3A 5GANK 1VQ7F 3CCQF 1KQSF 3CC2F 3MCAB 1CK2A 2OTJF 4LCKA 2KTVA 1Q82H 2QEXF 2CZWA 1SDSA 3CPWF 1VQKF 3SIUA 1VQMF 1KC8H 5DCVA 3GYQA 1W40A 3AGKA 5G4UC 1W41A 1X7PA 3PLAC 3PAFA 3ON1A 2QI2A 1JJ2F 1YITF 1YIJF 3I55F 3CCMF 4BY9D 3NVKE 1GZ0A 3CC7F 2AIFA 2ALEA 3LWVC 3G71F 1NMUB 2VGMA 1K8AH 3JCMM 4X3LA 3V7EA 1VQOF 3NMUC 1X52A 2BO1A 2KTUA 3HAXD 2LBWA 3CMAF 5IT9M 3E20B 3LFOA 3SIVA 1YJNF 1KD1H 3G6EF 4NUTA 1K9MH 1RA4A 1YHQF 3IR9A 5FJ4C 1ZWZA 3CC4F 3CPQA 5FLXM 1VQNF 2OZBA 3OW2F 1IPAA 1DT9A 3LWPC 4BW0B 2HVYD 3JAMM 1NJIH 1Q81H 3NK7A 1QVGF 1M1KH 3N4ZA 3E1YA 1X7OA 4X3MA 1YI2F 1W3EX 3RA6A 2WALA 4TZZA 1H7MA 1S72F 3WXMB 5GIOC 1M90H 1VQ5F 1YJ9F 1E7KA 1W42A 3FFMA 3I56F 1GO1A 1W2BF 5A2QM 3OBYA 2OHWA
chains in the Genus database with same CATH superfamily
3CMEF 4RQOA 2Z1TA 3IMPA 3WJRA 1VQLF 5HP8A 3OBWA 3J80M 2HS0A 4ZOLA 3CCUF 4C4WC 5GONB 5GAPK 1T0KB 5EIBC 3OONA 3N2GA 3CCSF 2QTPA 3DC2A 3RYFA 1VQ6F 1Q7YH 4B62A 3MDOA 3I7TA 4O2AA 3CCJF 4X1YB 3CD6F 2Z01A 5GIPC 3VO8A 1Z5WA 4RHAA 2HP3A 5EZYA 4TV9B 5LA6B 3UT5A 2ZVZA 1FFXB 1CK2A 4IIJB 1SDSA 1RLUA 2RHLA 2UYPA 3CPWF 5CB4B 2Z1FA 5FNVB 3QHDA 5J2UB 5LOVA 1H48A 1RQ7A 1U3PA 2UYJA 4BVQA 5JCOC 4I55B 3AGKA 4DRXA 2LCAA 3HKBA 2LBTA 5G4UC 1W41A 3VOAA 5CA1B 1QAHA 3PAFA 3ON1A 2QI2A 2BTQB 2HRUA 3I55F 4BY9D 2UYKA 3ESJA 5CA0B 1IV3A 4F6RB 2AIFA 4NQ3A 2R6R1 2CVLA 3WGMA 4O4LB 2VXYA 1NMUB 3VTIC 4IHJB 4X20A 1X52A 5HWEA 1W59A 4X1IB 4WBNB 3HKDB 3U0OA 3KHNA 5IT9M 1VK3A 5LYJB 5LP6C 5GONA 3JATB 1YJNF 2RHOA 4R40B 3G6EF 4BT5A 3HWUA 2Z1UA 1SZQA 3S0YA 4X1YA 4B45A 3WJPA 1JN1A 3ELCA 3L7QA 4O4HB 4TV8B 3WGNA 4BT6A 2K1SA 3WJQA 1YI2F 1W3EX 5LA6A 3F0EA 4TV9A 2WALA 2DYYA 1OAPA 3I3FA 4G88A 3RYHB 1FFXA 1QD9A 3C9RA 1XHOA 4I4TB 4C8EA 1GO1A 4IIJA 3S0HA 4G4ZA 5HXUA 3M84A 3JARB 5CB4A 2IG8A 4I50B 5FNVA 5J2UA 3HKCB 3CB2A 1YITF 3NK6A 4I55A 3RA5A 2ZAUA 2Q1XA 3P10A 1VQ8F 3WGLA 4BVTA 3CCEF 5CA1A 1VHAA 2JNBA 2QA4F 2MQEA 1FSZA 5EAZA 2VGNA 1CN7A 5G4VC 3O85A 1W5AA 5CA0A 2CWJA 5C8YB 2V9YA 3JAKB 4F6RA 3CCLF 2H8CA 1GO0A 3VI6A 1TVKA 4O4LA 3D01A 1RLGA 3NVIB 5LP6B 3S03A 1OFUA 4IHJA 3LWQC 5HP7A 4X1IA 4WBNA 1UI9A 3WPWA 5MN6A 5EIBD 3HKDA 5LYJA 4KWEA 3CCQF 2RHJA 3CC2F 2BTUA 2OTJF 3JATA 1ODEA 2QEXF 3ZOPA 2CZWA 4B46A 5JH7B 3SIUA 5DCVA 3F0DA 4TUYB 2IAFA 3PLAC 2H6LA 4O4HA 4TV8A 5MN4A 5ITZB 4ZHYB 4G4VA 4YJ3B 3NVKE 3K14A 5AVMA 3RYHA 4ZHWA 1GZ0A 4EI8A 1IV4A 5JCOA 3ZO8A 4I4TA 4ZI7A 1J7HA 2GZLA 2KGWA 3JARA 4I50A 3G71F 4BT4A 2NMUA 1K8AH 3HKCA 3LDTA 2GVIA 4X3LA 3V7EA 4XCQA 1VQOF 3NMUC 5KMGB 2BO1A 3KJKA 2Z1EA 5EYPB 2LBWA 1Q8RA 3C8LA 3E22B 3E20B 3M4SA 2VAMA 4C8GA 1SA0B 4O4IB 5JVDB 4BVRA 4NUTA 5C8YA 1RA4A 3JAKA 2VAPA 2W8BC 5FJ4C 2HRYA 2HS4A 2ZODA 3OW2F 3R0PA 1UFYA 4BW0B 1X25A 5LP6A 2HVYD 3JAMM 1TVKB 1Q81H 1M1KH 1QVGF 1U3LA 4O2BB 3WGKA 3N4ZA 1VQVA 3CYPB 3E1YA 3VOBA 4X3MA 1IV1A 3JASB 4TZZA 1M90H 1YJ9F 1W55A 3S0WA 2G9IA 4C82A 5JH7A 3OBYA 2H8EA 5IJ9B 3K0TA 4BT3A 4C8IA 3CXCF 1QVFF 4TUYA 3G4SF 1ONIA 3RE3A 1CLIA 3MCQA 3J81M 3KIZA 1JD1A 3CG6A 5HY1A 1QU9A 2I6DA 3IKEA 5ITZA 3CYQA 4EB6B 5EB1B 1TUBB 2LBXA 1W57A 2P6YA 3JALB 1W5BA 2ZF8A 2OTLF 3VYUC 2YYEA 2GLZA 4YJ3A 3GTZA 1XV2A 3RYIB 3ZP7A 1Q86H 3BYQA 5LXTB 1RQ2A 1DBFA 3HKEB 4LNUB 3CCRF 4ZI7B 1W5EA 5EWRA 3T80A 2CSLA 3KE1A 3FPIA 2F9ZC 4O4JB 5KMGA 5EYPA 1R1MA 3DDNA 2RB9A 4ZHQB 2DT4A 3RYCB 3K12A 1PF5A 2HS3A 1VQ7F 3E22A 3M1XA 1SA0A 4O4IA 4LCKA 1Q82H 1U40A 5JVDA 3B6NA 1VQKF 1GX1A 5MN5A 2AMTA 2PMPA 1VQMF 1KC8H 1Z5VA 3V3TA 1FNJA 2HX0A 4O2BA 3FBAA 1JJ2F 2HP0B 3D00A 3JASA 3CC7F 1XRGA 3VYSC 3LWVC 2B33A 3D54A 4HNAB 2IQQA 3KJJA 1W5FA 2VGMA 1W581 5IYZB 2CW4A 3JCMM 3LMEA 1YQNA 5IJ9A 4M8IA 1VH8A 1NQ3A 3CMAF 5KX5B 4BVSA 3SIVA 4EB6A 1KNJA 1TUBA 3JALA 4NWOB 3MBMA 3C9UA 3IR9A 1ZWZA 3C9SA 5FLXM 3CC4F 3RYIA 5JQGB 2OZBA 1IPAA 4U3JB 3P0ZA 3V4DA 5LXTA 3HKEA 4LNUA 1KNKA 1NJIH 4O4JA 4ZHQA 5B8FA 1X7OA 3RYCA 1JFFB 4EI9A 1H7MA 3WXMB 3VIUA 1E7KA 3QTYA 3FFMA 3I56F 2UYNB 1W2BF 4G4WA 4DXDA 3VYTC 4FFBB 1YGYA 3GHZA 2OHWA 1KQSF 2ZVYA 3WPXA 1VQPF 1N8RH 1XBIA 5IJ0B 3HTNA 3JAWB 4B5CA 5GINC 4ERHA 3F0FA 4ZHVA 1K73H 4U39A 2HP0A 3N4YA 5HY2A 3S02A 1IV2A 3LWOC 3N2KB 3HJWC 5EB0A 3J7AR 2YXZA 4HNAA 2KG4A 1YJWF 5J2TB 4X1KB 5IYZA 3TD5A 2FC3A 3CCVF 3LWRC 3VMFB 1VQ4F 4YJ2B 3V7QA 3K2XA 4EI7A 1VQ9F 1PXWA 4BT7A 5EO3A 5GANK 5KX5A 3MCAB 5HY0A 3FD6A 2KTVA 2I6RA 5JQGA 3P4EA 5BMVB 4U3JA 3F6MA 3TD3A 3GYQA 2Q1YA 1W40A 4G4XA 5HXZA 1X7PA 4ZOLB 3C9TA 3FD5A 1YIJF 3CCMF 1JFFA 2OTMA 4C81A 3N2GB 2R751 3RYFB 1U43A 3S06A 2EWCA 2ALEA 2BTOA 2PHNA 4O2AB 3ZP4A 2UYNA 3IEWA 1FNKA 2N48A 4FFBA 2CHSA 3JVHA 2L26A 3F0GA 3LYBA 2RHHA 5IJ0A 2KTUA 4G4YA 3HAXD 3TD4A 5EZYB 3UT5B 3JAWA 1JY8A 1H47A 3LFOA 2FGYA 3MQWA 1KD1H 1K9MH 3WGJA 3N2KA 1YHQF 3CPQA 1VQNF 1DT9A 2HQSC 5LOVB 3LWPC 4DRXB 3HKBB 3IKFA 4X1KA 5J2TA 2UZHA 5HY4A 3NK7A 4YJ2A 2AIZP 3QUWA 3RA6A 3ERNA 3EORA 4PWTA 2VAWA 4E6EA 1S72F 1COMA 5GIOC 3VCZA 1T0AA 1VQ5F 1W42A 4BT2A 3IEQA 5A2QM 2ZOVA 2CHTA 3Q8HA 4ZK7A 5BMVA 4X20B
chains in the Genus database with same CATH topology
3NK6A 3CMEF 1VQPF 1N8RH 1XBIA 1QVFF 3RA5A 3CXCF 1VQLF 3G4SF 3J81M 1VQ8F 4BVTA 3CCEF 3OBWA 3J80M 3CCUF 3CG6A 5HY1A 2I6DA 4C4WC 5GINC 2JNBA 5GAPK 2QA4F 2LBXA 1T0KB 1K73H 2VGNA 2OTLF 3N4YA 5HY2A 2GLZA 5G4VC 3CCSF 3O85A 1CN7A 3LWOC 3HJWC 3CCLF 1VQ6F 1Q7YH 3CCJF 1Q86H 3J7AR 1GO0A 3VI6A 2KG4A 3CCRF 1YJWF 1RLGA 3CD6F 3NVIB 2FC3A 3CCVF 5EWRA 5GIPC 3VMFB 3LWQC 3LWRC 1VQ4F 3V7QA 2F9ZC 4EI7A 1VQ9F 1PXWA 5EO3A 5GANK 1VQ7F 3CCQF 1KQSF 3CC2F 3MCAB 1CK2A 5HY0A 2OTJF 4LCKA 2KTVA 1Q82H 2QEXF 2CZWA 1SDSA 3CPWF 1VQKF 3SIUA 1VQMF 1KC8H 5DCVA 3GYQA 4BVQA 1W40A 3AGKA 5HXZA 5G4UC 1W41A 1X7PA 3PLAC 3V3TA 3PAFA 3ON1A 2QI2A 1JJ2F 1YITF 1YIJF 3I55F 3CCMF 4BY9D 3D00A 3NVKE 1GZ0A 4EI8A 3CC7F 2AIFA 4NQ3A 2ALEA 3LWVC 3G71F 1NMUB 2VGMA 1K8AH 3JCMM 4X3LA 3V7EA 4XCQA 1VQOF 3NMUC 1X52A 2BO1A 2KTUA 5HWEA 3HAXD 2LBWA 3CMAF 5IT9M 3E20B 4BVSA 3LFOA 2FGYA 3SIVA 1YJNF 1KD1H 4BVRA 3G6EF 4NUTA 1K9MH 1RA4A 1YHQF 3IR9A 5FJ4C 1ZWZA 3CC4F 3CPQA 5FLXM 1VQNF 2OZBA 3OW2F 1IPAA 1DT9A 3LWPC 4BW0B 5HY4A 2HVYD 3JAMM 1NJIH 1Q81H 3NK7A 1QVGF 1M1KH 3N4ZA 3E1YA 1X7OA 4X3MA 1YI2F 1W3EX 3RA6A 2WALA 4EI9A 4TZZA 1H7MA 1S72F 3WXMB 5GIOC 1M90H 1VQ5F 1YJ9F 1E7KA 1W42A 3FFMA 3I56F 1GO1A 1W2BF 5HXUA 5A2QM 3OBYA 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK6 A;  3CME F;  1VQP F;  1N8R H;  1XBI A;  1QVF F;  3RA5 A;  3CXC F;  1VQL F;  3G4S F;  3J81 M;  1VQ8 F;  3CCE F;  3OBW A;  3J80 M;  3CCU F;  3CG6 A;  2I6D A;  4C4W C;  5GIN C;  2JNB A;  5GAP K;  2QA4 F;  2LBX A;  1T0K B;  1K73 H;  2VGN A;  2OTL F;  3N4Y A;  3CCS F;  5G4V C;  1CN7 A;  3O85 A;  3LWO C;  3HJW C;  3CCL F;  1VQ6 F;  1Q7Y H;  3CCJ F;  1Q86 H;  3J7A R;  1GO0 A;  3VI6 A;  2KG4 A;  3CCR F;  1YJW F;  1RLG A;  3CD6 F;  3NVI B;  2FC3 A;  3CCV F;  5EWR A;  5GIP C;  3VMF B;  3LWQ C;  3LWR C;  1VQ4 F;  3V7Q A;  1VQ9 F;  1PXW A;  5EO3 A;  5GAN K;  1VQ7 F;  3CCQ F;  1KQS F;  3CC2 F;  3MCA B;  1CK2 A;  2OTJ F;  4LCK A;  2KTV A;  1Q82 H;  2QEX F;  2CZW A;  1SDS A;  3CPW F;  1VQK F;  3SIU A;  1VQM F;  1KC8 H;  5DCV A;  3GYQ A;  1W40 A;  3AGK A;  5G4U C;  1W41 A;  1X7P A;  3PLA C;  3PAF A;  3ON1 A;  2QI2 A;  1JJ2 F;  1YIT F;  1YIJ F;  3I55 F;  3CCM F;  4BY9 D;  3NVK E;  1GZ0 A;  3CC7 F;  2AIF A;  2ALE A;  3LWV C;  3G71 F;  1NMU B;  2VGM A;  1K8A H;  3JCM M;  4X3L A;  3V7E A;  1VQO F;  3NMU C;  1X52 A;  2BO1 A;  2KTU A;  3HAX D;  2LBW A;  3CMA F;  5IT9 M;  3E20 B;  3LFO A;  3SIV A;  1YJN F;  1KD1 H;  3G6E F;  4NUT A;  1K9M H;  1RA4 A;  1YHQ F;  3IR9 A;  5FJ4 C;  1ZWZ A;  3CC4 F;  3CPQ A;  5FLX M;  1VQN F;  2OZB A;  3OW2 F;  1IPA A;  1DT9 A;  3LWP C;  4BW0 B;  2HVY D;  3JAM M;  1NJI H;  1Q81 H;  3NK7 A;  1QVG F;  1M1K H;  3N4Z A;  3E1Y A;  1X7O A;  4X3M A;  1YI2 F;  1W3E X;  3RA6 A;  2WAL A;  4TZZ A;  1H7M A;  1S72 F;  3WXM B;  5GIO C;  1M90 H;  1VQ5 F;  1YJ9 F;  1E7K A;  1W42 A;  3FFM A;  3I56 F;  1GO1 A;  1W2B F;  5A2Q M;  3OBY A;  2OHW A; 
#chains in the Genus database with same CATH topology
 3CME F;  4RQO A;  2Z1T A;  3IMP A;  3WJR A;  1VQL F;  5HP8 A;  3OBW A;  3J80 M;  2HS0 A;  4ZOL A;  3CCU F;  4C4W C;  5GON B;  5GAP K;  1T0K B;  5EIB C;  3OON A;  3N2G A;  3CCS F;  2QTP A;  3DC2 A;  3RYF A;  1VQ6 F;  1Q7Y H;  4B62 A;  3MDO A;  3I7T A;  4O2A A;  3CCJ F;  4X1Y B;  3CD6 F;  2Z01 A;  5GIP C;  3VO8 A;  1Z5W A;  4RHA A;  2HP3 A;  5EZY A;  4TV9 B;  5LA6 B;  3UT5 A;  2ZVZ A;  1FFX B;  1CK2 A;  4IIJ B;  1SDS A;  1RLU A;  2RHL A;  2UYP A;  3CPW F;  5CB4 B;  2Z1F A;  5FNV B;  3QHD A;  5J2U B;  5LOV A;  1H48 A;  1RQ7 A;  1U3P A;  2UYJ A;  4BVQ A;  5JCO C;  4I55 B;  3AGK A;  4DRX A;  2LCA A;  3HKB A;  2LBT A;  5G4U C;  1W41 A;  3VOA A;  5CA1 B;  1QAH A;  3PAF A;  3ON1 A;  2QI2 A;  2BTQ B;  2HRU A;  3I55 F;  4BY9 D;  2UYK A;  3ESJ A;  5CA0 B;  1IV3 A;  4F6R B;  2AIF A;  4NQ3 A;  2R6R 1;  2CVL A;  3WGM A;  4O4L B;  2VXY A;  1NMU B;  3VTI C;  4IHJ B;  4X20 A;  1X52 A;  5HWE A;  1W59 A;  4X1I B;  4WBN B;  3HKD B;  3U0O A;  3KHN A;  5IT9 M;  1VK3 A;  5LYJ B;  5LP6 C;  5GON A;  3JAT B;  1YJN F;  2RHO A;  4R40 B;  3G6E F;  4BT5 A;  3HWU A;  2Z1U A;  1SZQ A;  3S0Y A;  4X1Y A;  4B45 A;  3WJP A;  1JN1 A;  3ELC A;  3L7Q A;  4O4H B;  4TV8 B;  3WGN A;  4BT6 A;  2K1S A;  3WJQ A;  1YI2 F;  1W3E X;  5LA6 A;  3F0E A;  4TV9 A;  2WAL A;  2DYY A;  1OAP A;  3I3F A;  4G88 A;  3RYH B;  1FFX A;  1QD9 A;  3C9R A;  1XHO A;  4I4T B;  4C8E A;  1GO1 A;  4IIJ A;  3S0H A;  4G4Z A;  5HXU A;  3M84 A;  3JAR B;  5CB4 A;  2IG8 A;  4I50 B;  5FNV A;  5J2U A;  3HKC B;  3CB2 A;  1YIT F;  3NK6 A;  4I55 A;  3RA5 A;  2ZAU A;  2Q1X A;  3P10 A;  1VQ8 F;  3WGL A;  4BVT A;  3CCE F;  5CA1 A;  1VHA A;  2JNB A;  2QA4 F;  2MQE A;  1FSZ A;  5EAZ A;  2VGN A;  1CN7 A;  5G4V C;  3O85 A;  1W5A A;  5CA0 A;  2CWJ A;  5C8Y B;  2V9Y A;  3JAK B;  4F6R A;  3CCL F;  2H8C A;  1GO0 A;  3VI6 A;  1TVK A;  4O4L A;  3D01 A;  1RLG A;  3NVI B;  5LP6 B;  3S03 A;  1OFU A;  4IHJ A;  3LWQ C;  5HP7 A;  4X1I A;  4WBN A;  1UI9 A;  3WPW A;  5MN6 A;  5EIB D;  3HKD A;  5LYJ A;  4KWE A;  3CCQ F;  2RHJ A;  3CC2 F;  2BTU A;  2OTJ F;  3JAT A;  1ODE A;  2QEX F;  3ZOP A;  2CZW A;  4B46 A;  5JH7 B;  3SIU A;  5DCV A;  3F0D A;  4TUY B;  2IAF A;  3PLA C;  2H6L A;  4O4H A;  4TV8 A;  5MN4 A;  5ITZ B;  4ZHY B;  4G4V A;  4YJ3 B;  3NVK E;  3K14 A;  5AVM A;  3RYH A;  4ZHW A;  1GZ0 A;  4EI8 A;  1IV4 A;  5JCO A;  3ZO8 A;  4I4T A;  4ZI7 A;  1J7H A;  2GZL A;  2KGW A;  3JAR A;  4I50 A;  3G71 F;  4BT4 A;  2NMU A;  1K8A H;  3HKC A;  3LDT A;  2GVI A;  4X3L A;  3V7E A;  4XCQ A;  1VQO F;  3NMU C;  5KMG B;  2BO1 A;  3KJK A;  2Z1E A;  5EYP B;  2LBW A;  1Q8R A;  3C8L A;  3E22 B;  3E20 B;  3M4S A;  2VAM A;  4C8G A;  1SA0 B;  4O4I B;  5JVD B;  4BVR A;  4NUT A;  5C8Y A;  1RA4 A;  3JAK A;  2VAP A;  2W8B C;  5FJ4 C;  2HRY A;  2HS4 A;  2ZOD A;  3OW2 F;  3R0P A;  1UFY A;  4BW0 B;  1X25 A;  5LP6 A;  2HVY D;  3JAM M;  1TVK B;  1Q81 H;  1M1K H;  1QVG F;  1U3L A;  4O2B B;  3WGK A;  3N4Z A;  1VQV A;  3CYP B;  3E1Y A;  3VOB A;  4X3M A;  1IV1 A;  3JAS B;  4TZZ A;  1M90 H;  1YJ9 F;  1W55 A;  3S0W A;  2G9I A;  4C82 A;  5JH7 A;  3OBY A;  2H8E A;  5IJ9 B;  3K0T A;  4BT3 A;  4C8I A;  3CXC F;  1QVF F;  4TUY A;  3G4S F;  1ONI A;  3RE3 A;  1CLI A;  3MCQ A;  3J81 M;  3KIZ A;  1JD1 A;  3CG6 A;  5HY1 A;  1QU9 A;  2I6D A;  3IKE A;  5ITZ A;  3CYQ A;  4EB6 B;  5EB1 B;  1TUB B;  2LBX A;  1W57 A;  2P6Y A;  3JAL B;  1W5B A;  2ZF8 A;  2OTL F;  3VYU C;  2YYE A;  2GLZ A;  4YJ3 A;  3GTZ A;  1XV2 A;  3RYI B;  3ZP7 A;  1Q86 H;  3BYQ A;  5LXT B;  1RQ2 A;  1DBF A;  3HKE B;  4LNU B;  3CCR F;  4ZI7 B;  1W5E A;  5EWR A;  3T80 A;  2CSL A;  3KE1 A;  3FPI A;  2F9Z C;  4O4J B;  5KMG A;  5EYP A;  1R1M A;  3DDN A;  2RB9 A;  4ZHQ B;  2DT4 A;  3RYC B;  3K12 A;  1PF5 A;  2HS3 A;  1VQ7 F;  3E22 A;  3M1X A;  1SA0 A;  4O4I A;  4LCK A;  1Q82 H;  1U40 A;  5JVD A;  3B6N A;  1VQK F;  1GX1 A;  5MN5 A;  2AMT A;  2PMP A;  1VQM F;  1KC8 H;  1Z5V A;  3V3T A;  1FNJ A;  2HX0 A;  4O2B A;  3FBA A;  1JJ2 F;  2HP0 B;  3D00 A;  3JAS A;  3CC7 F;  1XRG A;  3VYS C;  3LWV C;  2B33 A;  3D54 A;  4HNA B;  2IQQ A;  3KJJ A;  1W5F A;  2VGM A;  1W58 1;  5IYZ B;  2CW4 A;  3JCM M;  3LME A;  1YQN A;  5IJ9 A;  4M8I A;  1VH8 A;  1NQ3 A;  3CMA F;  5KX5 B;  4BVS A;  3SIV A;  4EB6 A;  1KNJ A;  1TUB A;  3JAL A;  4NWO B;  3MBM A;  3C9U A;  3IR9 A;  1ZWZ A;  3C9S A;  5FLX M;  3CC4 F;  3RYI A;  5JQG B;  2OZB A;  1IPA A;  4U3J B;  3P0Z A;  3V4D A;  5LXT A;  3HKE A;  4LNU A;  1KNK A;  1NJI H;  4O4J A;  4ZHQ A;  5B8F A;  1X7O A;  3RYC A;  1JFF B;  4EI9 A;  1H7M A;  3WXM B;  3VIU A;  1E7K A;  3QTY A;  3FFM A;  3I56 F;  2UYN B;  1W2B F;  4G4W A;  4DXD A;  3VYT C;  4FFB B;  1YGY A;  3GHZ A;  2OHW A;  1KQS F;  2ZVY A;  3WPX A;  1VQP F;  1N8R H;  1XBI A;  5IJ0 B;  3HTN A;  3JAW B;  4B5C A;  5GIN C;  4ERH A;  3F0F A;  4ZHV A;  1K73 H;  4U39 A;  2HP0 A;  3N4Y A;  5HY2 A;  3S02 A;  1IV2 A;  3LWO C;  3N2K B;  3HJW C;  5EB0 A;  3J7A R;  2YXZ A;  4HNA A;  2KG4 A;  1YJW F;  5J2T B;  4X1K B;  5IYZ A;  3TD5 A;  2FC3 A;  3CCV F;  3LWR C;  3VMF B;  1VQ4 F;  4YJ2 B;  3V7Q A;  3K2X A;  4EI7 A;  1VQ9 F;  1PXW A;  4BT7 A;  5EO3 A;  5GAN K;  5KX5 A;  3MCA B;  5HY0 A;  3FD6 A;  2KTV A;  2I6R A;  5JQG A;  3P4E A;  5BMV B;  4U3J A;  3F6M A;  3TD3 A;  3GYQ A;  2Q1Y A;  1W40 A;  4G4X A;  5HXZ A;  1X7P A;  4ZOL B;  3C9T A;  3FD5 A;  1YIJ F;  3CCM F;  1JFF A;  2OTM A;  4C81 A;  3N2G B;  2R75 1;  3RYF B;  1U43 A;  3S06 A;  2EWC A;  2ALE A;  2BTO A;  2PHN A;  4O2A B;  3ZP4 A;  2UYN A;  3IEW A;  1FNK A;  2N48 A;  4FFB A;  2CHS A;  3JVH A;  2L26 A;  3F0G A;  3LYB A;  2RHH A;  5IJ0 A;  2KTU A;  4G4Y A;  3HAX D;  3TD4 A;  5EZY B;  3UT5 B;  3JAW A;  1JY8 A;  1H47 A;  3LFO A;  2FGY A;  3MQW A;  1KD1 H;  1K9M H;  3WGJ A;  3N2K A;  1YHQ F;  3CPQ A;  1VQN F;  1DT9 A;  2HQS C;  5LOV B;  3LWP C;  4DRX B;  3HKB B;  3IKF A;  4X1K A;  5J2T A;  2UZH A;  5HY4 A;  3NK7 A;  4YJ2 A;  2AIZ P;  3QUW A;  3RA6 A;  3ERN A;  3EOR A;  4PWT A;  2VAW A;  4E6E A;  1S72 F;  1COM A;  5GIO C;  3VCZ A;  1T0A A;  1VQ5 F;  1W42 A;  4BT2 A;  3IEQ A;  5A2Q M;  2ZOV A;  2CHT A;  3Q8H A;  4ZK7 A;  5BMV A;  4X20 B; 
#chains in the Genus database with same CATH homology
 3NK6 A;  3CME F;  1VQP F;  1N8R H;  1XBI A;  1QVF F;  3RA5 A;  3CXC F;  1VQL F;  3G4S F;  3J81 M;  1VQ8 F;  4BVT A;  3CCE F;  3OBW A;  3J80 M;  3CCU F;  3CG6 A;  5HY1 A;  2I6D A;  4C4W C;  5GIN C;  2JNB A;  5GAP K;  2QA4 F;  2LBX A;  1T0K B;  1K73 H;  2VGN A;  2OTL F;  3N4Y A;  5HY2 A;  2GLZ A;  5G4V C;  3CCS F;  3O85 A;  1CN7 A;  3LWO C;  3HJW C;  3CCL F;  1VQ6 F;  1Q7Y H;  3CCJ F;  1Q86 H;  3J7A R;  1GO0 A;  3VI6 A;  2KG4 A;  3CCR F;  1YJW F;  1RLG A;  3CD6 F;  3NVI B;  2FC3 A;  3CCV F;  5EWR A;  5GIP C;  3VMF B;  3LWQ C;  3LWR C;  1VQ4 F;  3V7Q A;  2F9Z C;  4EI7 A;  1VQ9 F;  1PXW A;  5EO3 A;  5GAN K;  1VQ7 F;  3CCQ F;  1KQS F;  3CC2 F;  3MCA B;  1CK2 A;  5HY0 A;  2OTJ F;  4LCK A;  2KTV A;  1Q82 H;  2QEX F;  2CZW A;  1SDS A;  3CPW F;  1VQK F;  3SIU A;  1VQM F;  1KC8 H;  5DCV A;  3GYQ A;  4BVQ A;  1W40 A;  3AGK A;  5HXZ A;  5G4U C;  1W41 A;  1X7P A;  3PLA C;  3V3T A;  3PAF A;  3ON1 A;  2QI2 A;  1JJ2 F;  1YIT F;  1YIJ F;  3I55 F;  3CCM F;  4BY9 D;  3D00 A;  3NVK E;  1GZ0 A;  4EI8 A;  3CC7 F;  2AIF A;  4NQ3 A;  2ALE A;  3LWV C;  3G71 F;  1NMU B;  2VGM A;  1K8A H;  3JCM M;  4X3L A;  3V7E A;  4XCQ A;  1VQO F;  3NMU C;  1X52 A;  2BO1 A;  2KTU A;  5HWE A;  3HAX D;  2LBW A;  3CMA F;  5IT9 M;  3E20 B;  4BVS A;  3LFO A;  2FGY A;  3SIV A;  1YJN F;  1KD1 H;  4BVR A;  3G6E F;  4NUT A;  1K9M H;  1RA4 A;  1YHQ F;  3IR9 A;  5FJ4 C;  1ZWZ A;  3CC4 F;  3CPQ A;  5FLX M;  1VQN F;  2OZB A;  3OW2 F;  1IPA A;  1DT9 A;  3LWP C;  4BW0 B;  5HY4 A;  2HVY D;  3JAM M;  1NJI H;  1Q81 H;  3NK7 A;  1QVG F;  1M1K H;  3N4Z A;  3E1Y A;  1X7O A;  4X3M A;  1YI2 F;  1W3E X;  3RA6 A;  2WAL A;  4EI9 A;  4TZZ A;  1H7M A;  1S72 F;  3WXM B;  5GIO C;  1M90 H;  1VQ5 F;  1YJ9 F;  1E7K A;  1W42 A;  3FFM A;  3I56 F;  1GO1 A;  1W2B F;  5HXU A;  5A2Q M;  3OBY A;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...