3V7EA

Crystal structure of ybxf bound to the sam-i riboswitch aptamer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosome-associated protein L7Ae-like
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ribosomal protein/rna
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7eA00
1N8RH 3CCQF 1M90H 1KC8H 1RA4A 1E7KA 3NK7A 1VQ9F 3J80M 2KTVA 3G71F 3V7EA 3HJWC 3SIVA 1IPAA 1YI2F 1GZ0A 1Q7YH 3I56F 3E20B 1QVFF 3G6EF 1VQ8F 1X52A 2QA4F 2OTJF 3NMUC 3VI6A 3LWRC 3CCRF 1QVGF 3HAXD 3G4SF 3CC4F 4NUTA 3CPWF 1W2BF 2AIFA 3OW2F 1YJNF 4X3LA 5GIOC 3E1YA 1VQLF 3CXCF 5FLXM 2HVYD 1GO1A 2QI2A 3NVIB 3VMFB 1CN7A 2QEXF 1RLGA 3OBWA 2VGNA 1W40A 3RA6A 1VQPF 3V7QA 5DCVA 2WALA 4X3MA 3PLAC 3CC7F 1K73H 3SIUA 4BY9D 3CD6F 3CCSF 3JCMM 3CCJF 3AGKA 3PAFA 5A2QM 4LCKA 3CMEF 5EWRA 2ALEA 1T0KB 3LWPC 1S72F 3O85A 3N4ZA 1YJWF 3CPQA 1Q82H 3N4YA 1KD1H 2OHWA 3CCEF 3WXMB 1VQ7F 1NJIH 1YIJF 1K8AH 1PXWA 1W42A 3I55F 2FC3A 5GINC 3IR9A 1VQOF 5GANK 1VQMF 3MCAB 1DT9A 1H7MA 1X7PA 1ZWZA 2CZWA 1YHQF 5FJ4C 3J7AR 3CCVF 3CCMF 1W41A 1XBIA 2LBXA 3OBYA 3FFMA 1GO0A 5IT9M 2KTUA 1VQNF 1YITF 5GIPC 3NK6A 3LWOC 1K9MH 1JJ2F 2I6DA 5GAPK 1Q81H 1M1KH 3LFOA 3CMAF 1VQKF 3CCUF 2OTLF 1YJ9F 5EO3A 3RA5A 1CK2A 3LWQC 4TZZA 3J81M 4BW0B 3CCLF 3NVKE 5G4UC 3JAMM 2VGMA 2BO1A 1VQ4F 3ON1A 1W3EX 3CC2F 1SDSA 3LWVC 1NMUB 4C4WC 2JNBA 1X7OA 2OZBA 1KQSF 1Q86H 2LBWA 1VQ5F 3GYQA 1VQ6F 3CG6A 5G4VC 2KG4A
chains in the Genus database with same CATH superfamily
3BYQA 1M90H 3M4SA 1JFFA 1W55A 3HKDB 4BT4A 3V7EA 3SIVA 2HRYA 4HNAA 1YI2F 3N2GB 4O2AA 3E20B 1XHOA 2QA4F 2OTJF 1TVKB 3NMUC 3M84A 4IHJA 4TV9A 4EB6A 3IEQA 3G4SF 1IV1A 1ONIA 4X1YB 3C9RA 4X3LA 3V4DA 4ZK7A 5GIOC 5FLXM 1GO1A 4BVRA 3TD3A 1XRGA 4ZI7B 1CN7A 2Z1FA 1W40A 4B62A 1X25A 1YGYA 3HKDA 2R6R1 4G4WA 2I6RA 2QTPA 1ODEA 3RYCB 3CCSF 2RHOA 5EWRA 5C8YB 1OAPA 3ERNA 3JARB 3LWPC 4ERHA 2HP0B 1IV3A 3VYSC 3WGLA 5J2UB 5MN6A 1QD9A 1FSZA 1COMA 1U43A 3U0OA 3CCEF 4O4HB 1VQ7F 1Z5VA 1NJIH 4O2BB 2EWCA 2G9IA 2IQQA 1PXWA 4ZHVA 4I50A 5GINC 2BTQB 3IR9A 2HS4A 3L7QA 3VYTC 1FNKA 3WGMA 1VQMF 4B46A 1H7MA 3S0YA 1ZWZA 1VH8A 2FGYA 3EORA 3IKEA 3J7AR 2Q1XA 4FFBB 3ZP4A 1W41A 3OBYA 4BVTA 5MN5A 3CCMF 4EI9A 3MDOA 5LP6B 1VQNF 2LBTA 1IV4A 1RQ7A 4F6RA 1VQKF 3CMAF 3JARA 2UYKA 1SA0A 2HP0A 5EO3A 1GX1A 1CK2A 2CSLA 5J2UA 1Z5WA 4O4HA 4BT6A 4LNUB 5ITZB 1J7HA 3F0GA 3LMEA 2VGMA 3JAMM 5IYZB 3ON1A 1W3EX 3JALA 3CYQA 4WBNB 1NMUB 3E22A 4NWOB 1X7OA 1NQ3A 3HKEB 4U39A 4FFBA 1KNJA 3P0ZA 1KQSF 3GYQA 3CG6A 5LP6C 1VQ4F 3QHDA 5LP6A 1U3PA 1N8RH 5CA1B 1W581 2GLZA 4G4ZA 4C81A 3CCQF 2GZLA 1PF5A 3MBMA 1CLIA 1E7KA 3NK7A 4DRXB 1VQ9F 3WJPA 3G71F 2HQSC 5HP8A 4G4VA 4TUYB 1Q7YH 3I56F 5HY1A 3RE3A 3G6EF 1X52A 4LNUA 5ITZA 5BMVB 4C8EA 3CYPB 3S02A 2F9ZC 3LWRC 5EB0A 5IYZA 3C9SA 3FD6A 3S06A 1JY8A 3JVHA 4NUTA 1Q8RA 2AIFA 3C8LA 2VAPA 5AVMA 3N2KA 3CXCF 3RYHB 3NVIB 3D00A 3VMFB 3CB2A 2HS3A 2UZHA 2K1SA 3TD4A 5CA1A 1RLGA 2VGNA 2H8CA 4I4TB 3V7QA 2WALA 3PLAC 3CC7F 3VCZA 2RHHA 4O4IB 3CD6F 1W5FA 3P4EA 3DC2A 3AGKA 3RYIB 3PAFA 5A2QM 2BTUA 2ZAUA 2B33A 4B45A 5BMVA 3DDNA 2CWJA 2VAMA 2CHSA 1T0KB 5HWEA 5IJ0A 5EAZA 3N4ZA 5KX5B 4YJ3B 3IEWA 4BT3A 2UYJA 5HY4A 5EYPB 3RYHA 4E6EA 1W42A 3I55F 4BT2A 2Z1TA 5GANK 3MCAB 2UYPA 2N48A 5LXTB 3N2GA 3F6MA 5J2TB 4O4IA 1T0AA 1UFYA 3KE1A 3FFMA 4I55B 1TVKA 3RYIA 1R1MA 1U40A 5JQGB 5GIPC 3JATB 2RB9A 2IG8A 1K9MH 3RYFB 4X1YA 4DXDA 5KX5A 4YJ3A 4TZZA 1VQVA 2GVIA 3J81M 3C9TA 5EZYB 5IJ9B 3WJQA 2UYNB 4ZI7A 3MCQA 5EYPA 3NVKE 3D01A 2DT4A 2BO1A 1OFUA 1SDSA 3B6NA 1SZQA 3LWVC 3RYCA 1RQ2A 3JASB 5EB1B 5FNVB 5J2TA 3IMPA 1Q86H 4TV8B 3CC2F 4BVSA 1VQLF 2DYYA 3Q8HA 5JQGA 3QUWA 5C8YA 3VO8A 3JATA 3HTNA 3RYFA 2KTVA 5LA6B 3F0FA 5CA0B 3HJWC 1FFXB 3T80A 2Z1EA 4M8IA 4O2BA 5IJ9A 2W8BC 1VQ8F 1QVFF 4KWEA 3OONA 4R40B 2HX0A 3CCRF 1QVGF 3HKBB 4ZOLB 4C82A 4ZHQB 3CPWF 5MN4A 1W2BF 3OW2F 2PMPA 3JASA 5FNVA 2OTMA 2AMTA 2ZVYA 3E1YA 4U3JB 2VAWA 3UT5B 3KIZA 1FNJA 4O4JB 2IAFA 3RA6A 2HS0A 4IIJB 5EIBD 5LA6A 5CA0A 1K73H 3SIUA 4C8IA 1FFXA 4PWTA 5HP7A 3JCMM 3CCJF 2P6YA 3I3FA 4ZHWA 3CMEF 2ALEA 2NMUA 3WPXA 3HKBA 4WBNA 4ZHQA 1S72F 3O85A 1JFFB 1W5EA 2CHTA 2LCAA 3CPQA 3HKEA 3K2XA 4HNAB 1JD1A 2OHWA 3WJRA 4O2AB 1VHAA 3K12A 2H6LA 3JAKB 1VK3A 4U3JA 3FBAA 3UT5A 2FC3A 4DRXA 4EB6B 3HKCB 3FD5A 1DT9A 1X7PA 4X1IB 3WPWA 5FJ4C 1H48A 4IIJA 3VOBA 4EI8A 3CCVF 3K14A 4G4YA 4TUYA 4ZHYB 2LBXA 1DBFA 5HXUA 3R0PA 5IT9M 4X20B 1YITF 3KJJA 3M1XA 2I6DA 1Q81H 1M1KH 2RHLA 3KHNA 2KGWA 1U3LA 3ZP7A 1YJ9F 2YYEA 5HXZA 3LWQC 1UI9A 4BW0B 3GTZA 3VYUC 3CCLF 4YJ2B 4B5CA 2ZODA 3JAKA 4O4LB 3S0WA 2Z1UA 4XCQA 5HY0A 4I4TA 4NQ3A 3HKCA 2JNBA 4X1IA 2Q1YA 2ZF8A 3S0HA 2OZBA 5KMGB 2R751 2LBWA 3ELCA 1VQ6F 5G4VC 3HWUA 4X20A 1KC8H 4I50B 1RA4A 3KJKA 5HY2A 3J80M 5LYJB 3LDTA 1IPAA 4X1KB 3TD5A 5JH7B 2ZOVA 1GZ0A 2H8EA 4BT5A 1JN1A 4YJ2A 5CB4B 4O4LA 3VI6A 3JAWB 3HAXD 4F6RB 3CC4F 5LXTA 2PHNA 4G88A 1YJNF 1SA0B 3F0EA 4I55A 5KMGA 2HVYD 1TUBB 2QI2A 5JVDB 2QEXF 3OBWA 3WGNA 3F0DA 2Z01A 1VQPF 2BTOA 1W59A 5DCVA 2MQEA 3JALB 4X3MA 5GONB 5LYJA 4X1KA 5EZYA 1W57A 3E22B 4BY9D 5JH7A 3IKFA 3K0TA 3ESJA 3D54A 2UYNA 3I7TA 4LCKA 3FPIA 5CB4A 4BT7A 2RHJA 2HP3A 3JAWA 1W5BA 3P10A 1QU9A 5B8FA 1H47A 4RHAA 1YJWF 5EIBC 1Q82H 3S03A 3N4YA 2CVLA 4TV8A 1KD1H 3QTYA 3WXMB 1XV2A 3VIUA 1YIJF 1K8AH 1TUBA 5LOVB 5JVDA 2CW4A 4RQOA 2L26A 4C8GA 1VQOF 4BVQA 5JCOC 2CZWA 2YXZA 5GONA 5JCOA 1YHQF 1XBIA 1GO0A 3LYBA 4EI7A 2KTUA 3N2KB 4G4XA 3V3TA 3NK6A 3LWOC 4ZOLA 1JJ2F 5GAPK 3MQWA 3VTIC 3LFOA 3WGJA 2ZVZA 3CCUF 2OTLF 1RLUA 3RA5A 3VOAA 1YQNA 1W5AA 3C9UA 1QAHA 4IHJB 4O4JA 5G4UC 4TV9B 1KNKA 2VXYA 1IV2A 3GHZA 5LOVA 3ZOPA 5IJ0B 3ZO8A 2AIZP 2HRUA 4C4WC 2V9YA 3WGKA 1VQ5F 2KG4A
chains in the Genus database with same CATH topology
1N8RH 2GLZA 3CCQF 1M90H 1KC8H 1RA4A 1E7KA 3NK7A 1VQ9F 5HY2A 3J80M 2KTVA 3G71F 3V7EA 3HJWC 3SIVA 1IPAA 1YI2F 1GZ0A 1Q7YH 3I56F 3E20B 5HY1A 1QVFF 3G6EF 1VQ8F 1X52A 2QA4F 2OTJF 3NMUC 2F9ZC 3VI6A 3LWRC 3CCRF 1QVGF 3HAXD 3G4SF 3CC4F 4NUTA 3CPWF 1W2BF 2AIFA 3OW2F 1YJNF 4X3LA 5GIOC 3E1YA 1VQLF 3CXCF 5FLXM 2HVYD 1GO1A 4BVRA 2QI2A 3NVIB 3D00A 3VMFB 1CN7A 2QEXF 1RLGA 3OBWA 2VGNA 1W40A 3RA6A 1VQPF 3V7QA 5DCVA 2WALA 4X3MA 3PLAC 3CC7F 1K73H 3SIUA 4BY9D 3CD6F 3CCSF 3JCMM 3CCJF 3AGKA 3PAFA 5A2QM 4LCKA 3CMEF 5EWRA 2ALEA 1T0KB 5HWEA 3LWPC 1S72F 3O85A 3N4ZA 1YJWF 3CPQA 1Q82H 3N4YA 1KD1H 2OHWA 3CCEF 3WXMB 5HY4A 1VQ7F 1NJIH 1YIJF 1K8AH 1PXWA 1W42A 3I55F 2FC3A 5GINC 3IR9A 1VQOF 5GANK 1VQMF 3MCAB 4BVQA 1DT9A 1H7MA 1X7PA 1ZWZA 2CZWA 2FGYA 1YHQF 5FJ4C 3J7AR 4EI8A 3CCVF 3CCMF 1W41A 1XBIA 2LBXA 3OBYA 3FFMA 4BVTA 5HXUA 1GO0A 4EI9A 5IT9M 4EI7A 2KTUA 1VQNF 3V3TA 1YITF 5GIPC 3NK6A 3LWOC 1K9MH 1JJ2F 2I6DA 5GAPK 1Q81H 1M1KH 3LFOA 3CMAF 1VQKF 3CCUF 2OTLF 1YJ9F 5EO3A 5HXZA 3RA5A 1CK2A 3LWQC 4TZZA 3J81M 4BW0B 3CCLF 3NVKE 5G4UC 3JAMM 2VGMA 2BO1A 4XCQA 5HY0A 1VQ4F 4NQ3A 3ON1A 1W3EX 3CC2F 1SDSA 3LWVC 1NMUB 4C4WC 2JNBA 1X7OA 2OZBA 1KQSF 1Q86H 2LBWA 1VQ5F 3GYQA 1VQ6F 3CG6A 5G4VC 4BVSA 2KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R H;  3CCQ F;  1M90 H;  1KC8 H;  1RA4 A;  1E7K A;  3NK7 A;  1VQ9 F;  3J80 M;  2KTV A;  3G71 F;  3V7E A;  3HJW C;  3SIV A;  1IPA A;  1YI2 F;  1GZ0 A;  1Q7Y H;  3I56 F;  3E20 B;  1QVF F;  3G6E F;  1VQ8 F;  1X52 A;  2QA4 F;  2OTJ F;  3NMU C;  3VI6 A;  3LWR C;  3CCR F;  1QVG F;  3HAX D;  3G4S F;  3CC4 F;  4NUT A;  3CPW F;  1W2B F;  2AIF A;  3OW2 F;  1YJN F;  4X3L A;  5GIO C;  3E1Y A;  1VQL F;  3CXC F;  5FLX M;  2HVY D;  1GO1 A;  2QI2 A;  3NVI B;  3VMF B;  1CN7 A;  2QEX F;  1RLG A;  3OBW A;  2VGN A;  1W40 A;  3RA6 A;  1VQP F;  3V7Q A;  5DCV A;  2WAL A;  4X3M A;  3PLA C;  3CC7 F;  1K73 H;  3SIU A;  4BY9 D;  3CD6 F;  3CCS F;  3JCM M;  3CCJ F;  3AGK A;  3PAF A;  5A2Q M;  4LCK A;  3CME F;  5EWR A;  2ALE A;  1T0K B;  3LWP C;  1S72 F;  3O85 A;  3N4Z A;  1YJW F;  3CPQ A;  1Q82 H;  3N4Y A;  1KD1 H;  2OHW A;  3CCE F;  3WXM B;  1VQ7 F;  1NJI H;  1YIJ F;  1K8A H;  1PXW A;  1W42 A;  3I55 F;  2FC3 A;  5GIN C;  3IR9 A;  1VQO F;  5GAN K;  1VQM F;  3MCA B;  1DT9 A;  1H7M A;  1X7P A;  1ZWZ A;  2CZW A;  1YHQ F;  5FJ4 C;  3J7A R;  3CCV F;  3CCM F;  1W41 A;  1XBI A;  2LBX A;  3OBY A;  3FFM A;  1GO0 A;  5IT9 M;  2KTU A;  1VQN F;  1YIT F;  5GIP C;  3NK6 A;  3LWO C;  1K9M H;  1JJ2 F;  2I6D A;  5GAP K;  1Q81 H;  1M1K H;  3LFO A;  3CMA F;  1VQK F;  3CCU F;  2OTL F;  1YJ9 F;  5EO3 A;  3RA5 A;  1CK2 A;  3LWQ C;  4TZZ A;  3J81 M;  4BW0 B;  3CCL F;  3NVK E;  5G4U C;  3JAM M;  2VGM A;  2BO1 A;  1VQ4 F;  3ON1 A;  1W3E X;  3CC2 F;  1SDS A;  3LWV C;  1NMU B;  4C4W C;  2JNB A;  1X7O A;  2OZB A;  1KQS F;  1Q86 H;  2LBW A;  1VQ5 F;  3GYQ A;  1VQ6 F;  3CG6 A;  5G4V C;  2KG4 A; 
#chains in the Genus database with same CATH topology
 3BYQ A;  1M90 H;  3M4S A;  1JFF A;  1W55 A;  3HKD B;  4BT4 A;  3V7E A;  3SIV A;  2HRY A;  4HNA A;  1YI2 F;  3N2G B;  4O2A A;  3E20 B;  1XHO A;  2QA4 F;  2OTJ F;  1TVK B;  3NMU C;  3M84 A;  4IHJ A;  4TV9 A;  4EB6 A;  3IEQ A;  3G4S F;  1IV1 A;  1ONI A;  4X1Y B;  3C9R A;  4X3L A;  3V4D A;  4ZK7 A;  5GIO C;  5FLX M;  1GO1 A;  4BVR A;  3TD3 A;  1XRG A;  4ZI7 B;  1CN7 A;  2Z1F A;  1W40 A;  4B62 A;  1X25 A;  1YGY A;  3HKD A;  2R6R 1;  4G4W A;  2I6R A;  2QTP A;  1ODE A;  3RYC B;  3CCS F;  2RHO A;  5EWR A;  5C8Y B;  1OAP A;  3ERN A;  3JAR B;  3LWP C;  4ERH A;  2HP0 B;  1IV3 A;  3VYS C;  3WGL A;  5J2U B;  5MN6 A;  1QD9 A;  1FSZ A;  1COM A;  1U43 A;  3U0O A;  3CCE F;  4O4H B;  1VQ7 F;  1Z5V A;  1NJI H;  4O2B B;  2EWC A;  2G9I A;  2IQQ A;  1PXW A;  4ZHV A;  4I50 A;  5GIN C;  2BTQ B;  3IR9 A;  2HS4 A;  3L7Q A;  3VYT C;  1FNK A;  3WGM A;  1VQM F;  4B46 A;  1H7M A;  3S0Y A;  1ZWZ A;  1VH8 A;  2FGY A;  3EOR A;  3IKE A;  3J7A R;  2Q1X A;  4FFB B;  3ZP4 A;  1W41 A;  3OBY A;  4BVT A;  5MN5 A;  3CCM F;  4EI9 A;  3MDO A;  5LP6 B;  1VQN F;  2LBT A;  1IV4 A;  1RQ7 A;  4F6R A;  1VQK F;  3CMA F;  3JAR A;  2UYK A;  1SA0 A;  2HP0 A;  5EO3 A;  1GX1 A;  1CK2 A;  2CSL A;  5J2U A;  1Z5W A;  4O4H A;  4BT6 A;  4LNU B;  5ITZ B;  1J7H A;  3F0G A;  3LME A;  2VGM A;  3JAM M;  5IYZ B;  3ON1 A;  1W3E X;  3JAL A;  3CYQ A;  4WBN B;  1NMU B;  3E22 A;  4NWO B;  1X7O A;  1NQ3 A;  3HKE B;  4U39 A;  4FFB A;  1KNJ A;  3P0Z A;  1KQS F;  3GYQ A;  3CG6 A;  5LP6 C;  1VQ4 F;  3QHD A;  5LP6 A;  1U3P A;  1N8R H;  5CA1 B;  1W58 1;  2GLZ A;  4G4Z A;  4C81 A;  3CCQ F;  2GZL A;  1PF5 A;  3MBM A;  1CLI A;  1E7K A;  3NK7 A;  4DRX B;  1VQ9 F;  3WJP A;  3G71 F;  2HQS C;  5HP8 A;  4G4V A;  4TUY B;  1Q7Y H;  3I56 F;  5HY1 A;  3RE3 A;  3G6E F;  1X52 A;  4LNU A;  5ITZ A;  5BMV B;  4C8E A;  3CYP B;  3S02 A;  2F9Z C;  3LWR C;  5EB0 A;  5IYZ A;  3C9S A;  3FD6 A;  3S06 A;  1JY8 A;  3JVH A;  4NUT A;  1Q8R A;  2AIF A;  3C8L A;  2VAP A;  5AVM A;  3N2K A;  3CXC F;  3RYH B;  3NVI B;  3D00 A;  3VMF B;  3CB2 A;  2HS3 A;  2UZH A;  2K1S A;  3TD4 A;  5CA1 A;  1RLG A;  2VGN A;  2H8C A;  4I4T B;  3V7Q A;  2WAL A;  3PLA C;  3CC7 F;  3VCZ A;  2RHH A;  4O4I B;  3CD6 F;  1W5F A;  3P4E A;  3DC2 A;  3AGK A;  3RYI B;  3PAF A;  5A2Q M;  2BTU A;  2ZAU A;  2B33 A;  4B45 A;  5BMV A;  3DDN A;  2CWJ A;  2VAM A;  2CHS A;  1T0K B;  5HWE A;  5IJ0 A;  5EAZ A;  3N4Z A;  5KX5 B;  4YJ3 B;  3IEW A;  4BT3 A;  2UYJ A;  5HY4 A;  5EYP B;  3RYH A;  4E6E A;  1W42 A;  3I55 F;  4BT2 A;  2Z1T A;  5GAN K;  3MCA B;  2UYP A;  2N48 A;  5LXT B;  3N2G A;  3F6M A;  5J2T B;  4O4I A;  1T0A A;  1UFY A;  3KE1 A;  3FFM A;  4I55 B;  1TVK A;  3RYI A;  1R1M A;  1U40 A;  5JQG B;  5GIP C;  3JAT B;  2RB9 A;  2IG8 A;  1K9M H;  3RYF B;  4X1Y A;  4DXD A;  5KX5 A;  4YJ3 A;  4TZZ A;  1VQV A;  2GVI A;  3J81 M;  3C9T A;  5EZY B;  5IJ9 B;  3WJQ A;  2UYN B;  4ZI7 A;  3MCQ A;  5EYP A;  3NVK E;  3D01 A;  2DT4 A;  2BO1 A;  1OFU A;  1SDS A;  3B6N A;  1SZQ A;  3LWV C;  3RYC A;  1RQ2 A;  3JAS B;  5EB1 B;  5FNV B;  5J2T A;  3IMP A;  1Q86 H;  4TV8 B;  3CC2 F;  4BVS A;  1VQL F;  2DYY A;  3Q8H A;  5JQG A;  3QUW A;  5C8Y A;  3VO8 A;  3JAT A;  3HTN A;  3RYF A;  2KTV A;  5LA6 B;  3F0F A;  5CA0 B;  3HJW C;  1FFX B;  3T80 A;  2Z1E A;  4M8I A;  4O2B A;  5IJ9 A;  2W8B C;  1VQ8 F;  1QVF F;  4KWE A;  3OON A;  4R40 B;  2HX0 A;  3CCR F;  1QVG F;  3HKB B;  4ZOL B;  4C82 A;  4ZHQ B;  3CPW F;  5MN4 A;  1W2B F;  3OW2 F;  2PMP A;  3JAS A;  5FNV A;  2OTM A;  2AMT A;  2ZVY A;  3E1Y A;  4U3J B;  2VAW A;  3UT5 B;  3KIZ A;  1FNJ A;  4O4J B;  2IAF A;  3RA6 A;  2HS0 A;  4IIJ B;  5EIB D;  5LA6 A;  5CA0 A;  1K73 H;  3SIU A;  4C8I A;  1FFX A;  4PWT A;  5HP7 A;  3JCM M;  3CCJ F;  2P6Y A;  3I3F A;  4ZHW A;  3CME F;  2ALE A;  2NMU A;  3WPX A;  3HKB A;  4WBN A;  4ZHQ A;  1S72 F;  3O85 A;  1JFF B;  1W5E A;  2CHT A;  2LCA A;  3CPQ A;  3HKE A;  3K2X A;  4HNA B;  1JD1 A;  2OHW A;  3WJR A;  4O2A B;  1VHA A;  3K12 A;  2H6L A;  3JAK B;  1VK3 A;  4U3J A;  3FBA A;  3UT5 A;  2FC3 A;  4DRX A;  4EB6 B;  3HKC B;  3FD5 A;  1DT9 A;  1X7P A;  4X1I B;  3WPW A;  5FJ4 C;  1H48 A;  4IIJ A;  3VOB A;  4EI8 A;  3CCV F;  3K14 A;  4G4Y A;  4TUY A;  4ZHY B;  2LBX A;  1DBF A;  5HXU A;  3R0P A;  5IT9 M;  4X20 B;  1YIT F;  3KJJ A;  3M1X A;  2I6D A;  1Q81 H;  1M1K H;  2RHL A;  3KHN A;  2KGW A;  1U3L A;  3ZP7 A;  1YJ9 F;  2YYE A;  5HXZ A;  3LWQ C;  1UI9 A;  4BW0 B;  3GTZ A;  3VYU C;  3CCL F;  4YJ2 B;  4B5C A;  2ZOD A;  3JAK A;  4O4L B;  3S0W A;  2Z1U A;  4XCQ A;  5HY0 A;  4I4T A;  4NQ3 A;  3HKC A;  2JNB A;  4X1I A;  2Q1Y A;  2ZF8 A;  3S0H A;  2OZB A;  5KMG B;  2R75 1;  2LBW A;  3ELC A;  1VQ6 F;  5G4V C;  3HWU A;  4X20 A;  1KC8 H;  4I50 B;  1RA4 A;  3KJK A;  5HY2 A;  3J80 M;  5LYJ B;  3LDT A;  1IPA A;  4X1K B;  3TD5 A;  5JH7 B;  2ZOV A;  1GZ0 A;  2H8E A;  4BT5 A;  1JN1 A;  4YJ2 A;  5CB4 B;  4O4L A;  3VI6 A;  3JAW B;  3HAX D;  4F6R B;  3CC4 F;  5LXT A;  2PHN A;  4G88 A;  1YJN F;  1SA0 B;  3F0E A;  4I55 A;  5KMG A;  2HVY D;  1TUB B;  2QI2 A;  5JVD B;  2QEX F;  3OBW A;  3WGN A;  3F0D A;  2Z01 A;  1VQP F;  2BTO A;  1W59 A;  5DCV A;  2MQE A;  3JAL B;  4X3M A;  5GON B;  5LYJ A;  4X1K A;  5EZY A;  1W57 A;  3E22 B;  4BY9 D;  5JH7 A;  3IKF A;  3K0T A;  3ESJ A;  3D54 A;  2UYN A;  3I7T A;  4LCK A;  3FPI A;  5CB4 A;  4BT7 A;  2RHJ A;  2HP3 A;  3JAW A;  1W5B A;  3P10 A;  1QU9 A;  5B8F A;  1H47 A;  4RHA A;  1YJW F;  5EIB C;  1Q82 H;  3S03 A;  3N4Y A;  2CVL A;  4TV8 A;  1KD1 H;  3QTY A;  3WXM B;  1XV2 A;  3VIU A;  1YIJ F;  1K8A H;  1TUB A;  5LOV B;  5JVD A;  2CW4 A;  4RQO A;  2L26 A;  4C8G A;  1VQO F;  4BVQ A;  5JCO C;  2CZW A;  2YXZ A;  5GON A;  5JCO A;  1YHQ F;  1XBI A;  1GO0 A;  3LYB A;  4EI7 A;  2KTU A;  3N2K B;  4G4X A;  3V3T A;  3NK6 A;  3LWO C;  4ZOL A;  1JJ2 F;  5GAP K;  3MQW A;  3VTI C;  3LFO A;  3WGJ A;  2ZVZ A;  3CCU F;  2OTL F;  1RLU A;  3RA5 A;  3VOA A;  1YQN A;  1W5A A;  3C9U A;  1QAH A;  4IHJ B;  4O4J A;  5G4U C;  4TV9 B;  1KNK A;  2VXY A;  1IV2 A;  3GHZ A;  5LOV A;  3ZOP A;  5IJ0 B;  3ZO8 A;  2AIZ P;  2HRU A;  4C4W C;  2V9Y A;  3WGK A;  1VQ5 F;  2KG4 A; 
#chains in the Genus database with same CATH homology
 1N8R H;  2GLZ A;  3CCQ F;  1M90 H;  1KC8 H;  1RA4 A;  1E7K A;  3NK7 A;  1VQ9 F;  5HY2 A;  3J80 M;  2KTV A;  3G71 F;  3V7E A;  3HJW C;  3SIV A;  1IPA A;  1YI2 F;  1GZ0 A;  1Q7Y H;  3I56 F;  3E20 B;  5HY1 A;  1QVF F;  3G6E F;  1VQ8 F;  1X52 A;  2QA4 F;  2OTJ F;  3NMU C;  2F9Z C;  3VI6 A;  3LWR C;  3CCR F;  1QVG F;  3HAX D;  3G4S F;  3CC4 F;  4NUT A;  3CPW F;  1W2B F;  2AIF A;  3OW2 F;  1YJN F;  4X3L A;  5GIO C;  3E1Y A;  1VQL F;  3CXC F;  5FLX M;  2HVY D;  1GO1 A;  4BVR A;  2QI2 A;  3NVI B;  3D00 A;  3VMF B;  1CN7 A;  2QEX F;  1RLG A;  3OBW A;  2VGN A;  1W40 A;  3RA6 A;  1VQP F;  3V7Q A;  5DCV A;  2WAL A;  4X3M A;  3PLA C;  3CC7 F;  1K73 H;  3SIU A;  4BY9 D;  3CD6 F;  3CCS F;  3JCM M;  3CCJ F;  3AGK A;  3PAF A;  5A2Q M;  4LCK A;  3CME F;  5EWR A;  2ALE A;  1T0K B;  5HWE A;  3LWP C;  1S72 F;  3O85 A;  3N4Z A;  1YJW F;  3CPQ A;  1Q82 H;  3N4Y A;  1KD1 H;  2OHW A;  3CCE F;  3WXM B;  5HY4 A;  1VQ7 F;  1NJI H;  1YIJ F;  1K8A H;  1PXW A;  1W42 A;  3I55 F;  2FC3 A;  5GIN C;  3IR9 A;  1VQO F;  5GAN K;  1VQM F;  3MCA B;  4BVQ A;  1DT9 A;  1H7M A;  1X7P A;  1ZWZ A;  2CZW A;  2FGY A;  1YHQ F;  5FJ4 C;  3J7A R;  4EI8 A;  3CCV F;  3CCM F;  1W41 A;  1XBI A;  2LBX A;  3OBY A;  3FFM A;  4BVT A;  5HXU A;  1GO0 A;  4EI9 A;  5IT9 M;  4EI7 A;  2KTU A;  1VQN F;  3V3T A;  1YIT F;  5GIP C;  3NK6 A;  3LWO C;  1K9M H;  1JJ2 F;  2I6D A;  5GAP K;  1Q81 H;  1M1K H;  3LFO A;  3CMA F;  1VQK F;  3CCU F;  2OTL F;  1YJ9 F;  5EO3 A;  5HXZ A;  3RA5 A;  1CK2 A;  3LWQ C;  4TZZ A;  3J81 M;  4BW0 B;  3CCL F;  3NVK E;  5G4U C;  3JAM M;  2VGM A;  2BO1 A;  4XCQ A;  5HY0 A;  1VQ4 F;  4NQ3 A;  3ON1 A;  1W3E X;  3CC2 F;  1SDS A;  3LWV C;  1NMU B;  4C4W C;  2JNB A;  1X7O A;  2OZB A;  1KQS F;  1Q86 H;  2LBW A;  1VQ5 F;  3GYQ A;  1VQ6 F;  3CG6 A;  5G4V C;  4BVS A;  2KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...