3V7EA

Crystal structure of ybxf bound to the sam-i riboswitch aptamer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribosome-associated protein L7Ae-like
molecule tags Ribosomal protein/rna
source organism Bacillus subtilis
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7eA00
4X3MA 3FFMA 4BW0B 1Q7YH 3LWVC 4BY9D 1XBIA 1YI2F 1VQ5F 5GAPK 1VQNF 3CCLF 3O85A 3OW2F 1M90H 2OHWA 2QA4F 2KTVA 3V7EA 2LBWA 3CCRF 5GANK 3LWQC 3CMEF 1X7OA 3WXMB 3CG6A 3G6EF 1KC8H 1NMUB 1VQLF 1IPAA 5FJ4C 5G4UC 1VQ4F 1YJWF 3CC7F 1RA4A 1W2BF 1KD1H 3CCJF 3CD6F 1Q81H 1VQPF 3LWPC 3J81M 5GIPC 3CCMF 3NVIB 3JAMM 5A2QM 1VQ6F 5EWRA 2VGNA 2CZWA 3CCEF 3V7QA 2QI2A 2KG4A 3LWRC 3ON1A 3HAXD 1YJNF 2OZBA 2OTLF 1DT9A 1W41A 3IR9A 3LFOA 1SDSA 1K73H 1H7MA 1GO0A 1W3EX 3CCSF 3CCUF 3LWOC 3I55F 1Q86H 1QVFF 3HJWC 3JCMM 3J7AR 1K9MH 2BO1A 3J80M 3MCAB 1NJIH 5GINC 2AIFA 5IT9M 3RA6A 3I56F 3N4ZA 3RA5A 1X7PA 1S72F 1M1KH 3CC2F 3NVKE 2I6DA 1W40A 4TZZA 2WALA 3CXCF 3E20B 3PLAC 5G4VC 4LCKA 1YITF 4C4WC 1VQ8F 3CCVF 5GIOC 1GO1A 1ZWZA 2KTUA 1YJ9F 3CMAF 1Q82H 4NUTA 3VI6A 1YHQF 3NK7A 3NMUC 1T0KB 3CCQF 1YIJF 1N8RH 3E1YA 1QVGF 3AGKA 2OTJF 1JJ2F 3VMFB 2QEXF 1VQOF 2FC3A 1GZ0A 1X52A 3CPWF 3G4SF 3N4YA 5FLXM 1E7KA 3G71F 3SIUA 1K8AH 1RLGA 3CPQA 3SIVA 1CK2A 4X3LA 2JNBA 1PXWA 1CN7A 3OBYA 5EO3A 1W42A 1VQ7F 2HVYD 1KQSF 3PAFA 5DCVA 1VQKF 1VQ9F 2LBXA 3GYQA 3OBWA 2VGMA 1VQMF 3CC4F 3NK6A 2ALEA
chains in the Genus database with same CATH superfamily
3RYCA 4X3MA 3FFMA 4BT6A 4BW0B 2BTUA 1ODEA 4TV9B 5LP6A 1Q8RA 1VQNF 1W5BA 1YQNA 2OHWA 2Z01A 2KTVA 5GANK 3D00A 3CMEF 3D01A 3TD5A 2UYNA 5LXTB 3G6EF 3HTNA 1IPAA 5MN5A 5G4UC 2CVLA 3F0EA 2ZF8A 3MBMA 1W2BF 3CD6F 3KJKA 4LNUA 3ZP7A 2RB9A 3CCMF 3RYHA 5A2QM 3CYPB 3FD5A 2KGWA 1U43A 1JFFA 4G4VA 4O2BB 2CZWA 1JN1A 1OAPA 1QD9A 3JATB 3CCEF 3V7QA 2G9IA 1FNKA 2KG4A 1UFYA 4KWEA 4TUYB 3HAXD 3JASB 4I55B 1ONIA 1TUBA 4BT4A 5IJ9B 3HKDB 4O2AA 5C8YA 4BT3A 2OZBA 2Z1FA 4TV8A 1SA0A 2Q1YA 5JH7B 1K73H 1H7MA 1Z5WA 1W5FA 3I55F 1Q86H 1QVFF 1VK3A 5ITZA 3HJWC 1JFFB 3J80M 1TVKA 3TD4A 2EWCA 3JAKA 5GINC 3HKBA 2IG8A 1RLUA 3WGLA 3ZOPA 5IT9M 3RA6A 3F6MA 2I6RA 1X7PA 3RYIA 4I4TB 3WJPA 3MQWA 2WALA 4BT7A 5CB4B 1RQ7A 5HY2A 5KMGA 5MN4A 5J2UB 1VQ8F 5GIOC 1YJ9F 4I55A 3UT5B 3WJQA 2AMTA 2HRUA 3LDTA 1N8RH 2HP3A 3AGKA 3JASA 2OTJF 1JJ2F 3VMFB 1VQOF 3CPWF 1GZ0A 1X52A 4O4IA 4B46A 3G4SF 5HWEA 5FLXM 4U39A 3SIUA 3DC2A 3RYHB 3JARB 5J2TB 2HS0A 1GX1A 1DBFA 1PXWA 1CN7A 1KNKA 4G88A 1W42A 1VQ7F 3HKCB 3WGNA 3VO8A 4O4LB 5IJ9A 1JD1A 5DCVA 4IHJA 1VQ9F 4O4JB 4ERHA 5JH7A 3CC4F 3VOAA 3QTYA 4IHJB 3P4EA 4PWTA 1Q7YH 3LWVC 3WGMA 1XBIA 3K2XA 4G4ZA 1JY8A 3CCLF 4ZHQB 5CA0B 5JQGA 2P6YA 3LWQC 2L26A 1U3LA 3VYTC 4BT5A 2UZHA 1FFXB 3CG6A 2FGYA 3DDNA 1VQ4F 3ZO8A 2PMPA 3M4SA 1CLIA 1RA4A 2H8EA 3CCJF 1VQPF 4X1YB 5EYPA 3RYCB 3JAWA 3J81M 3JAMM 4BVRA 1VQ6F 5EWRA 3KJJA 1X25A 4TUYA 2CSLA 5HY4A 5HP8A 4O2AB 3N2KA 3M84A 3ON1A 5KX5B 1T0AA 3VYUC 3N2GA 4B5CA 1YJNF 1OFUA 5B8FA 5LA6A 1DT9A 4G4XA 3LFOA 4ZI7B 1IV1A 5HXZA 4X1IA 4F6RB 5EB0A 5JQGB 2Z1EA 3CCSF 5AVMA 3CCUF 3LWOC 5JCOC 3D54A 3JARA 3QUWA 1FFXA 1UI9A 2UYNB 5LXTA 5FNVB 3CYQA 2RHHA 3I56F 2HS3A 3N4ZA 3N2KB 2GZLA 3EORA 3IKEA 1S72F 3CC2F 5C8YB 4X20B 1W5AA 2Z1UA 4HNAB 5CA1B 5G4VC 1YGYA 3MDOA 4X1YA 5IYZA 1ZWZA 4O2BA 2KTUA 2YXZA 1Q82H 3Q8HA 3RYFA 3B6NA 4NUTA 1YHQF 1YIJF 1W5EA 3RYFB 1H48A 1U40A 1XRGA 2NMUA 4U3JA 5LOVA 3G71F 1TVKB 1K8AH 5JCOA 3C9RA 4B62A 2PHNA 3S0WA 1CK2A 4EB6A 2JNBA 3K14A 2RHLA 2LCAA 1COMA 5HP7A 4X20A 3S0HA 1VH8A 4EB6B 3IEQA 3JVHA 3HKDA 4EI8A 4BVSA 5KMGB 3RE3A 2LBXA 3E22A 3MCQA 3C9TA 3ELCA 2HX0A 4YJ3B 3GHZA 1KD1H 2ALEA 3V4DA 4B45A 2DYYA 4C82A 1QAHA 4BY9D 5EAZA 1YI2F 5GAPK 4BVQA 3O85A 3OW2F 1M90H 2QA4F 3ERNA 2W8BC 5LYJA 2R751 4ZK7A 1X7OA 5EIBC 3LMEA 3P10A 4FFBB 3HKEA 3N2GB 2QTPA 1NMUB 3WPWA 5FJ4C 3FD6A 4X1KA 1YJWF 1U3PA 2ZODA 4NWOB 3C9UA 2N48A 5HY1A 2VGNA 3HKCA 3VYSC 5IJ0B 5LYJB 4ZHVA 4C81A 3LWRC 4C8IA 4NQ3A 2ZVYA 5JVDA 2RHOA 4I4TA 2GVIA 1VHAA 2BTOA 2OTLF 1W41A 3IR9A 3ZP4A 2VAMA 2OTMA 1GO0A 3HWUA 4BVTA 1W3EX 3FBAA 1K9MH 2BO1A 3QHDA 3MCAB 4ZOLA 5EIBD 5GONA 5HY0A 2AIFA 2HRYA 4I50B 3S02A 3VCZA 5GONB 4O4LA 2YYEA 4I50A 3V3TA 2I6DA 3IMPA 4E6EA 3JAWB 3NVKE 2B33A 5J2UA 3E20B 3PLAC 3I7TA 3U0OA 1YITF 3I3FA 2V9YA 4LNUB 2BTQB 5BMVA 4C4WC 3JALA 3CCVF 3ESJA 2VAWA 5ITZB 1W57A 1SZQA 1R1MA 5HXUA 3M1XA 2UYPA 3KHNA 5JVDB 5FNVA 3T80A 3VI6A 3WJRA 3NK7A 3NMUC 4XCQA 5CA0A 3E1YA 4DXDA 4ZHYB 4O4HA 4X1IB 4F6RA 2QEXF 2HS4A 3S0YA 2Q1XA 2FC3A 2RHJA 2IQQA 4HNAA 3N4YA 5CA1A 1E7KA 5CB4A 1RLGA 3CPQA 3SIVA 4X3LA 3RYIB 2CHTA 2VAPA 2HP0B 2HVYD 1KQSF 4M8IA 1H47A 4DRXA 1NQ3A 1VQKF 3GYQA 2VGMA 1FNJA 1XV2A 3L7QA 3NK6A 1IV4A 3KIZA 3TD3A 5LP6C 2CW4A 4TV8B 1VQ5F 2F9ZC 2UYJA 3V7EA 2LBWA 3CCRF 3FPIA 3WGJA 5MN6A 3C9SA 2HQSC 3WXMB 3OONA 4ZOLB 1KC8H 1VQLF 2R6R1 4G4YA 5EYPB 3CC7F 4O4JA 3LYBA 1Q81H 4IIJB 4YJ2A 3VTIC 3LWPC 4X1KB 3NVIB 4RQOA 3VIUA 5GIPC 3WPXA 3KE1A 3F0DA 2CHSA 3BYQA 4ZHQA 3WGKA 2QI2A 2ZVZA 5IJ0A 5LA6B 1VQVA 3K0TA 2GLZA 2Z1TA 2AIZP 4DRXB 2DT4A 5KX5A 4O4IB 4TV9A 4R40B 1TUBB 3P0ZA 1SDSA 4EI7A 1IV3A 3J7AR 3JCMM 5J2TA 3JATA 4FFBA 1PF5A 1W55A 1NJIH 4WBNB 2ZOVA 3IKFA 3RA5A 3JAKB 1RQ2A 4O4HB 1M1KH 2MQEA 1W40A 4TZZA 5BMVB 3CXCF 2HP0A 4BT2A 4LCKA 1IV2A 2ZAUA 2CWJA 4IIJA 4YJ2B 3E22B 4RHAA 5EB1B 1QU9A 3UT5A 2VXYA 4G4WA 1GO1A 1XHOA 4YJ3A 1FSZA 5IYZB 3JALB 3F0FA 3S03A 3CMAF 1KNJA 3F0GA 5LP6B 2IAFA 4WBNA 1W581 2LBTA 1W59A 1SA0B 1T0KB 3CCQF 1QVGF 4ZHWA 2K1SA 3C8LA 3S06A 3HKEB 2H6LA 4U3JB 5LOVB 3K12A 1Z5VA 5EZYB 3IEWA 3GTZA 4C8GA 3CB2A 3HKBB 3VOBA 3OBYA 2UYKA 5EO3A 5EZYA 3PAFA 4EI9A 3OBWA 4C8EA 1VQMF 4ZI7A 2H8CA 1J7HA 3R0PA
chains in the Genus database with same CATH topology
4X3MA 3FFMA 4BW0B 1Q7YH 3LWVC 4BY9D 1XBIA 1YI2F 1VQ5F 5GAPK 1VQNF 3CCLF 4BVQA 3O85A 3OW2F 2F9ZC 1M90H 2OHWA 2QA4F 2KTVA 3V7EA 2LBWA 3CCRF 5GANK 3LWQC 3D00A 3CMEF 1X7OA 3WXMB 3CG6A 3G6EF 2FGYA 1KC8H 1NMUB 1VQLF 1IPAA 5FJ4C 5G4UC 1VQ4F 1YJWF 3CC7F 1RA4A 1W2BF 1KD1H 3CCJF 3CD6F 1Q81H 1VQPF 3LWPC 3J81M 5GIPC 3CCMF 3NVIB 3JAMM 5A2QM 4BVRA 5HY1A 1VQ6F 5EWRA 2VGNA 2CZWA 3CCEF 3V7QA 2QI2A 5HY4A 2KG4A 3LWRC 4NQ3A 3ON1A 3HAXD 2GLZA 1YJNF 2OZBA 2OTLF 1DT9A 1W41A 3IR9A 3LFOA 1SDSA 5HXZA 4EI7A 1K73H 1H7MA 1GO0A 4BVTA 1W3EX 3CCSF 3CCUF 3LWOC 3I55F 1Q86H 1QVFF 3HJWC 3JCMM 3J7AR 1K9MH 2BO1A 3J80M 3MCAB 1NJIH 5GINC 5HY0A 2AIFA 5IT9M 3RA6A 3I56F 3N4ZA 3RA5A 1X7PA 1S72F 1M1KH 3CC2F 3V3TA 2I6DA 3NVKE 1W40A 4TZZA 2WALA 3CXCF 3E20B 3PLAC 5G4VC 4LCKA 1YITF 5HY2A 4C4WC 1VQ8F 3CCVF 5GIOC 1GO1A 1ZWZA 5HXUA 2KTUA 1YJ9F 3CMAF 1Q82H 4NUTA 3VI6A 1YHQF 3NK7A 3NMUC 4XCQA 1T0KB 3CCQF 1YIJF 1N8RH 3E1YA 1QVGF 3AGKA 2OTJF 1JJ2F 3VMFB 2QEXF 1VQOF 2FC3A 1GZ0A 1X52A 3CPWF 3G4SF 3N4YA 5HWEA 5FLXM 1E7KA 3G71F 3SIUA 1K8AH 1RLGA 3CPQA 3SIVA 1CK2A 4X3LA 2JNBA 1PXWA 1CN7A 3OBYA 5EO3A 1W42A 1VQ7F 2HVYD 1KQSF 3PAFA 4EI8A 5DCVA 4BVSA 1VQKF 4EI9A 2LBXA 1VQ9F 3GYQA 3OBWA 2VGMA 1VQMF 3CC4F 3NK6A 2ALEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  3FFM A;  4BW0 B;  1Q7Y H;  3LWV C;  4BY9 D;  1XBI A;  1YI2 F;  1VQ5 F;  5GAP K;  1VQN F;  3CCL F;  3O85 A;  3OW2 F;  1M90 H;  2OHW A;  2QA4 F;  2KTV A;  3V7E A;  2LBW A;  3CCR F;  5GAN K;  3LWQ C;  3CME F;  1X7O A;  3WXM B;  3CG6 A;  3G6E F;  1KC8 H;  1NMU B;  1VQL F;  1IPA A;  5FJ4 C;  5G4U C;  1VQ4 F;  1YJW F;  3CC7 F;  1RA4 A;  1W2B F;  1KD1 H;  3CCJ F;  3CD6 F;  1Q81 H;  1VQP F;  3LWP C;  3J81 M;  5GIP C;  3CCM F;  3NVI B;  3JAM M;  5A2Q M;  1VQ6 F;  5EWR A;  2VGN A;  2CZW A;  3CCE F;  3V7Q A;  2QI2 A;  2KG4 A;  3LWR C;  3ON1 A;  3HAX D;  1YJN F;  2OZB A;  2OTL F;  1DT9 A;  1W41 A;  3IR9 A;  3LFO A;  1SDS A;  1K73 H;  1H7M A;  1GO0 A;  1W3E X;  3CCS F;  3CCU F;  3LWO C;  3I55 F;  1Q86 H;  1QVF F;  3HJW C;  3JCM M;  3J7A R;  1K9M H;  2BO1 A;  3J80 M;  3MCA B;  1NJI H;  5GIN C;  2AIF A;  5IT9 M;  3RA6 A;  3I56 F;  3N4Z A;  3RA5 A;  1X7P A;  1S72 F;  1M1K H;  3CC2 F;  3NVK E;  2I6D A;  1W40 A;  4TZZ A;  2WAL A;  3CXC F;  3E20 B;  3PLA C;  5G4V C;  4LCK A;  1YIT F;  4C4W C;  1VQ8 F;  3CCV F;  5GIO C;  1GO1 A;  1ZWZ A;  2KTU A;  1YJ9 F;  3CMA F;  1Q82 H;  4NUT A;  3VI6 A;  1YHQ F;  3NK7 A;  3NMU C;  1T0K B;  3CCQ F;  1YIJ F;  1N8R H;  3E1Y A;  1QVG F;  3AGK A;  2OTJ F;  1JJ2 F;  3VMF B;  2QEX F;  1VQO F;  2FC3 A;  1GZ0 A;  1X52 A;  3CPW F;  3G4S F;  3N4Y A;  5FLX M;  1E7K A;  3G71 F;  3SIU A;  1K8A H;  1RLG A;  3CPQ A;  3SIV A;  1CK2 A;  4X3L A;  2JNB A;  1PXW A;  1CN7 A;  3OBY A;  5EO3 A;  1W42 A;  1VQ7 F;  2HVY D;  1KQS F;  3PAF A;  5DCV A;  1VQK F;  1VQ9 F;  2LBX A;  3GYQ A;  3OBW A;  2VGM A;  1VQM F;  3CC4 F;  3NK6 A;  2ALE A; 
#chains in the Genus database with same CATH topology
 3RYC A;  4X3M A;  3FFM A;  4BT6 A;  4BW0 B;  2BTU A;  1ODE A;  4TV9 B;  5LP6 A;  1Q8R A;  1VQN F;  1W5B A;  1YQN A;  2OHW A;  2Z01 A;  2KTV A;  5GAN K;  3D00 A;  3CME F;  3D01 A;  3TD5 A;  2UYN A;  5LXT B;  3G6E F;  3HTN A;  1IPA A;  5MN5 A;  5G4U C;  2CVL A;  3F0E A;  2ZF8 A;  3MBM A;  1W2B F;  3CD6 F;  3KJK A;  4LNU A;  3ZP7 A;  2RB9 A;  3CCM F;  3RYH A;  5A2Q M;  3CYP B;  3FD5 A;  2KGW A;  1U43 A;  1JFF A;  4G4V A;  4O2B B;  2CZW A;  1JN1 A;  1OAP A;  1QD9 A;  3JAT B;  3CCE F;  3V7Q A;  2G9I A;  1FNK A;  2KG4 A;  1UFY A;  4KWE A;  4TUY B;  3HAX D;  3JAS B;  4I55 B;  1ONI A;  1TUB A;  4BT4 A;  5IJ9 B;  3HKD B;  4O2A A;  5C8Y A;  4BT3 A;  2OZB A;  2Z1F A;  4TV8 A;  1SA0 A;  2Q1Y A;  5JH7 B;  1K73 H;  1H7M A;  1Z5W A;  1W5F A;  3I55 F;  1Q86 H;  1QVF F;  1VK3 A;  5ITZ A;  3HJW C;  1JFF B;  3J80 M;  1TVK A;  3TD4 A;  2EWC A;  3JAK A;  5GIN C;  3HKB A;  2IG8 A;  1RLU A;  3WGL A;  3ZOP A;  5IT9 M;  3RA6 A;  3F6M A;  2I6R A;  1X7P A;  3RYI A;  4I4T B;  3WJP A;  3MQW A;  2WAL A;  4BT7 A;  5CB4 B;  1RQ7 A;  5HY2 A;  5KMG A;  5MN4 A;  5J2U B;  1VQ8 F;  5GIO C;  1YJ9 F;  4I55 A;  3UT5 B;  3WJQ A;  2AMT A;  2HRU A;  3LDT A;  1N8R H;  2HP3 A;  3AGK A;  3JAS A;  2OTJ F;  1JJ2 F;  3VMF B;  1VQO F;  3CPW F;  1GZ0 A;  1X52 A;  4O4I A;  4B46 A;  3G4S F;  5HWE A;  5FLX M;  4U39 A;  3SIU A;  3DC2 A;  3RYH B;  3JAR B;  5J2T B;  2HS0 A;  1GX1 A;  1DBF A;  1PXW A;  1CN7 A;  1KNK A;  4G88 A;  1W42 A;  1VQ7 F;  3HKC B;  3WGN A;  3VO8 A;  4O4L B;  5IJ9 A;  1JD1 A;  5DCV A;  4IHJ A;  1VQ9 F;  4O4J B;  4ERH A;  5JH7 A;  3CC4 F;  3VOA A;  3QTY A;  4IHJ B;  3P4E A;  4PWT A;  1Q7Y H;  3LWV C;  3WGM A;  1XBI A;  3K2X A;  4G4Z A;  1JY8 A;  3CCL F;  4ZHQ B;  5CA0 B;  5JQG A;  2P6Y A;  3LWQ C;  2L26 A;  1U3L A;  3VYT C;  4BT5 A;  2UZH A;  1FFX B;  3CG6 A;  2FGY A;  3DDN A;  1VQ4 F;  3ZO8 A;  2PMP A;  3M4S A;  1CLI A;  1RA4 A;  2H8E A;  3CCJ F;  1VQP F;  4X1Y B;  5EYP A;  3RYC B;  3JAW A;  3J81 M;  3JAM M;  4BVR A;  1VQ6 F;  5EWR A;  3KJJ A;  1X25 A;  4TUY A;  2CSL A;  5HY4 A;  5HP8 A;  4O2A B;  3N2K A;  3M84 A;  3ON1 A;  5KX5 B;  1T0A A;  3VYU C;  3N2G A;  4B5C A;  1YJN F;  1OFU A;  5B8F A;  5LA6 A;  1DT9 A;  4G4X A;  3LFO A;  4ZI7 B;  1IV1 A;  5HXZ A;  4X1I A;  4F6R B;  5EB0 A;  5JQG B;  2Z1E A;  3CCS F;  5AVM A;  3CCU F;  3LWO C;  5JCO C;  3D54 A;  3JAR A;  3QUW A;  1FFX A;  1UI9 A;  2UYN B;  5LXT A;  5FNV B;  3CYQ A;  2RHH A;  3I56 F;  2HS3 A;  3N4Z A;  3N2K B;  2GZL A;  3EOR A;  3IKE A;  1S72 F;  3CC2 F;  5C8Y B;  4X20 B;  1W5A A;  2Z1U A;  4HNA B;  5CA1 B;  5G4V C;  1YGY A;  3MDO A;  4X1Y A;  5IYZ A;  1ZWZ A;  4O2B A;  2KTU A;  2YXZ A;  1Q82 H;  3Q8H A;  3RYF A;  3B6N A;  4NUT A;  1YHQ F;  1YIJ F;  1W5E A;  3RYF B;  1H48 A;  1U40 A;  1XRG A;  2NMU A;  4U3J A;  5LOV A;  3G71 F;  1TVK B;  1K8A H;  5JCO A;  3C9R A;  4B62 A;  2PHN A;  3S0W A;  1CK2 A;  4EB6 A;  2JNB A;  3K14 A;  2RHL A;  2LCA A;  1COM A;  5HP7 A;  4X20 A;  3S0H A;  1VH8 A;  4EB6 B;  3IEQ A;  3JVH A;  3HKD A;  4EI8 A;  4BVS A;  5KMG B;  3RE3 A;  2LBX A;  3E22 A;  3MCQ A;  3C9T A;  3ELC A;  2HX0 A;  4YJ3 B;  3GHZ A;  1KD1 H;  2ALE A;  3V4D A;  4B45 A;  2DYY A;  4C82 A;  1QAH A;  4BY9 D;  5EAZ A;  1YI2 F;  5GAP K;  4BVQ A;  3O85 A;  3OW2 F;  1M90 H;  2QA4 F;  3ERN A;  2W8B C;  5LYJ A;  2R75 1;  4ZK7 A;  1X7O A;  5EIB C;  3LME A;  3P10 A;  4FFB B;  3HKE A;  3N2G B;  2QTP A;  1NMU B;  3WPW A;  5FJ4 C;  3FD6 A;  4X1K A;  1YJW F;  1U3P A;  2ZOD A;  4NWO B;  3C9U A;  2N48 A;  5HY1 A;  2VGN A;  3HKC A;  3VYS C;  5IJ0 B;  5LYJ B;  4ZHV A;  4C81 A;  3LWR C;  4C8I A;  4NQ3 A;  2ZVY A;  5JVD A;  2RHO A;  4I4T A;  2GVI A;  1VHA A;  2BTO A;  2OTL F;  1W41 A;  3IR9 A;  3ZP4 A;  2VAM A;  2OTM A;  1GO0 A;  3HWU A;  4BVT A;  1W3E X;  3FBA A;  1K9M H;  2BO1 A;  3QHD A;  3MCA B;  4ZOL A;  5EIB D;  5GON A;  5HY0 A;  2AIF A;  2HRY A;  4I50 B;  3S02 A;  3VCZ A;  5GON B;  4O4L A;  2YYE A;  4I50 A;  3V3T A;  2I6D A;  3IMP A;  4E6E A;  3JAW B;  3NVK E;  2B33 A;  5J2U A;  3E20 B;  3PLA C;  3I7T A;  3U0O A;  1YIT F;  3I3F A;  2V9Y A;  4LNU B;  2BTQ B;  5BMV A;  4C4W C;  3JAL A;  3CCV F;  3ESJ A;  2VAW A;  5ITZ B;  1W57 A;  1SZQ A;  1R1M A;  5HXU A;  3M1X A;  2UYP A;  3KHN A;  5JVD B;  5FNV A;  3T80 A;  3VI6 A;  3WJR A;  3NK7 A;  3NMU C;  4XCQ A;  5CA0 A;  3E1Y A;  4DXD A;  4ZHY B;  4O4H A;  4X1I B;  4F6R A;  2QEX F;  2HS4 A;  3S0Y A;  2Q1X A;  2FC3 A;  2RHJ A;  2IQQ A;  4HNA A;  3N4Y A;  5CA1 A;  1E7K A;  5CB4 A;  1RLG A;  3CPQ A;  3SIV A;  4X3L A;  3RYI B;  2CHT A;  2VAP A;  2HP0 B;  2HVY D;  1KQS F;  4M8I A;  1H47 A;  4DRX A;  1NQ3 A;  1VQK F;  3GYQ A;  2VGM A;  1FNJ A;  1XV2 A;  3L7Q A;  3NK6 A;  1IV4 A;  3KIZ A;  3TD3 A;  5LP6 C;  2CW4 A;  4TV8 B;  1VQ5 F;  2F9Z C;  2UYJ A;  3V7E A;  2LBW A;  3CCR F;  3FPI A;  3WGJ A;  5MN6 A;  3C9S A;  2HQS C;  3WXM B;  3OON A;  4ZOL B;  1KC8 H;  1VQL F;  2R6R 1;  4G4Y A;  5EYP B;  3CC7 F;  4O4J A;  3LYB A;  1Q81 H;  4IIJ B;  4YJ2 A;  3VTI C;  3LWP C;  4X1K B;  3NVI B;  4RQO A;  3VIU A;  5GIP C;  3WPX A;  3KE1 A;  3F0D A;  2CHS A;  3BYQ A;  4ZHQ A;  3WGK A;  2QI2 A;  2ZVZ A;  5IJ0 A;  5LA6 B;  1VQV A;  3K0T A;  2GLZ A;  2Z1T A;  2AIZ P;  4DRX B;  2DT4 A;  5KX5 A;  4O4I B;  4TV9 A;  4R40 B;  1TUB B;  3P0Z A;  1SDS A;  4EI7 A;  1IV3 A;  3J7A R;  3JCM M;  5J2T A;  3JAT A;  4FFB A;  1PF5 A;  1W55 A;  1NJI H;  4WBN B;  2ZOV A;  3IKF A;  3RA5 A;  3JAK B;  1RQ2 A;  4O4H B;  1M1K H;  2MQE A;  1W40 A;  4TZZ A;  5BMV B;  3CXC F;  2HP0 A;  4BT2 A;  4LCK A;  1IV2 A;  2ZAU A;  2CWJ A;  4IIJ A;  4YJ2 B;  3E22 B;  4RHA A;  5EB1 B;  1QU9 A;  3UT5 A;  2VXY A;  4G4W A;  1GO1 A;  1XHO A;  4YJ3 A;  1FSZ A;  5IYZ B;  3JAL B;  3F0F A;  3S03 A;  3CMA F;  1KNJ A;  3F0G A;  5LP6 B;  2IAF A;  4WBN A;  1W58 1;  2LBT A;  1W59 A;  1SA0 B;  1T0K B;  3CCQ F;  1QVG F;  4ZHW A;  2K1S A;  3C8L A;  3S06 A;  3HKE B;  2H6L A;  4U3J B;  5LOV B;  3K12 A;  1Z5V A;  5EZY B;  3IEW A;  3GTZ A;  4C8G A;  3CB2 A;  3HKB B;  3VOB A;  3OBY A;  2UYK A;  5EO3 A;  5EZY A;  3PAF A;  4EI9 A;  3OBW A;  4C8E A;  1VQM F;  4ZI7 A;  2H8C A;  1J7H A;  3R0P A; 
#chains in the Genus database with same CATH homology
 4X3M A;  3FFM A;  4BW0 B;  1Q7Y H;  3LWV C;  4BY9 D;  1XBI A;  1YI2 F;  1VQ5 F;  5GAP K;  1VQN F;  3CCL F;  4BVQ A;  3O85 A;  3OW2 F;  2F9Z C;  1M90 H;  2OHW A;  2QA4 F;  2KTV A;  3V7E A;  2LBW A;  3CCR F;  5GAN K;  3LWQ C;  3D00 A;  3CME F;  1X7O A;  3WXM B;  3CG6 A;  3G6E F;  2FGY A;  1KC8 H;  1NMU B;  1VQL F;  1IPA A;  5FJ4 C;  5G4U C;  1VQ4 F;  1YJW F;  3CC7 F;  1RA4 A;  1W2B F;  1KD1 H;  3CCJ F;  3CD6 F;  1Q81 H;  1VQP F;  3LWP C;  3J81 M;  5GIP C;  3CCM F;  3NVI B;  3JAM M;  5A2Q M;  4BVR A;  5HY1 A;  1VQ6 F;  5EWR A;  2VGN A;  2CZW A;  3CCE F;  3V7Q A;  2QI2 A;  5HY4 A;  2KG4 A;  3LWR C;  4NQ3 A;  3ON1 A;  3HAX D;  2GLZ A;  1YJN F;  2OZB A;  2OTL F;  1DT9 A;  1W41 A;  3IR9 A;  3LFO A;  1SDS A;  5HXZ A;  4EI7 A;  1K73 H;  1H7M A;  1GO0 A;  4BVT A;  1W3E X;  3CCS F;  3CCU F;  3LWO C;  3I55 F;  1Q86 H;  1QVF F;  3HJW C;  3JCM M;  3J7A R;  1K9M H;  2BO1 A;  3J80 M;  3MCA B;  1NJI H;  5GIN C;  5HY0 A;  2AIF A;  5IT9 M;  3RA6 A;  3I56 F;  3N4Z A;  3RA5 A;  1X7P A;  1S72 F;  1M1K H;  3CC2 F;  3V3T A;  2I6D A;  3NVK E;  1W40 A;  4TZZ A;  2WAL A;  3CXC F;  3E20 B;  3PLA C;  5G4V C;  4LCK A;  1YIT F;  5HY2 A;  4C4W C;  1VQ8 F;  3CCV F;  5GIO C;  1GO1 A;  1ZWZ A;  5HXU A;  2KTU A;  1YJ9 F;  3CMA F;  1Q82 H;  4NUT A;  3VI6 A;  1YHQ F;  3NK7 A;  3NMU C;  4XCQ A;  1T0K B;  3CCQ F;  1YIJ F;  1N8R H;  3E1Y A;  1QVG F;  3AGK A;  2OTJ F;  1JJ2 F;  3VMF B;  2QEX F;  1VQO F;  2FC3 A;  1GZ0 A;  1X52 A;  3CPW F;  3G4S F;  3N4Y A;  5HWE A;  5FLX M;  1E7K A;  3G71 F;  3SIU A;  1K8A H;  1RLG A;  3CPQ A;  3SIV A;  1CK2 A;  4X3L A;  2JNB A;  1PXW A;  1CN7 A;  3OBY A;  5EO3 A;  1W42 A;  1VQ7 F;  2HVY D;  1KQS F;  3PAF A;  4EI8 A;  5DCV A;  4BVS A;  1VQK F;  4EI9 A;  2LBX A;  1VQ9 F;  3GYQ A;  3OBW A;  2VGM A;  1VQM F;  3CC4 F;  3NK6 A;  2ALE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...