3ELCA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 41
structure length 157
sequence length 157
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3elcA00
3KE1A 1GX1A 1U43A 3FPIA 3F0FA 1IV4A 3P10A 3IKFA 2AMTA 1H47A 1KNJA 3K14A 3T80A 1YQNA 3ESJA 3FBAA 3JVHA 1KNKA 4C8EA 4C8GA 3K2XA 1W55A 1VHAA 3QHDA 3P0ZA 5B8FA 3F0GA 4C8IA 1IV1A 2UZHA 3GHZA 3IKEA 3F0EA 1U3LA 1JN1A 3B6NA 3MBMA 4C82A 3ERNA 4C81A 2PMPA 1U40A 1T0AA 2GZLA 3IEWA 3F6MA 3ELCA 3Q8HA 1VH8A 1H48A 1IV2A 3EORA 1W57A 1IV3A 1U3PA 1JY8A 3IEQA 3RE3A 3F0DA
chains in the Genus database with same CATH superfamily
1W41A 3BYQA 3JAKA 2AMTA 3S0YA 2RB9A 1PF5A 4X1KB 3TD3A 3RYHB 4X1YA 3C8LA 3V7EA 3CCVF 3AGKA 1TVKA 4I4TB 3VMFB 1UFYA 2CWJA 2UYPA 5HXUA 3JCMM 1GO1A 4DRXA 4ERHA 1VQ8F 2QA4F 3C9SA 3ZP7A 3HTNA 3JARA 3FPIA 3HKDB 1H47A 5EWRA 5EYPA 1CLIA 5EZYB 3K2XA 3CYQA 1K73H 1W5FA 2Z1TA 3ON1A 3KHNA 5B8FA 1RQ7A 3JATB 3V3TA 3MQWA 1J7HA 3RYIA 1FSZA 1XV2A 1NQ3A 5HWEA 4WBNA 3JAWA 4ZI7B 3D00A 4LCKA 3LWOC 3IEWA 1M90H 1X7OA 4O4JB 3VOBA 1SDSA 4DRXB 1KQSF 4BVSA 1YI2F 5JH7A 5IJ0A 2HVYD 2LCAA 3F0FA 3S03A 5CA1A 1CN7A 1KNKA 4G4XA 3NVIB 2BO1A 5EYPB 1NJIH 3WJRA 4ZHVA 3B6NA 1XBIA 4RHAA 4YJ2A 3RYFB 4ZHYB 4WBNB 2UYKA 5EO3A 1VQPF 1YGYA 1TUBB 5KX5A 3WJQA 5G4UC 1W2BF 3NK7A 2ZOVA 5HY0A 2UYNB 4ZHWA 4O2BA 5GONA 1NMUB 5CA0A 1W55A 1YJWF 4O2AA 4O4IB 5GIOC 4HNAA 3FD5A 5BMVB 2R751 2UZHA 5HP8A 4I55A 1U3LA 4TV8A 4KWEA 2Q1XA 1QAHA 3HWUA 2QEXF 4EB6A 5LYJA 3F6MA 3D54A 3D01A 1VH8A 2I6RA 5EB0A 3RYCA 1T0KB 3CCJF 2MQEA 5ITZB 4X3MA 1W5AA 4BT7A 5KX5B 3WGMA 2DYYA 3MCQA 3RA6A 2OTJF 2ZF8A 1RLGA 3FBAA 2KTVA 3C9UA 2RHOA 4BW0B 4O4HA 4NQ3A 3LFOA 4TUYB 4O2AB 2LBTA 4TV9A 3F0EA 4HNAB 2GVIA 2CHSA 3ERNA 4I55B 2QTPA 5LOVB 1FNJA 4TV8B 2HRUA 5JQGB 3N2GA 3HKBA 5LYJB 1W57A 3OONA 5AVMA 1Z5VA 5IYZA 3RYCB 2ZODA 2Z01A 5FNVB 3DC2A 5JVDA 2H6LA 3C9TA 3ESJA 5C8YA 3E20B 1COMA 3F0GA 4LNUA 4O4HB 3VYSC 3WPWA 4BVTA 1SA0B 3K0TA 3WGKA 3TD5A 4O4LA 4R40B 2HRYA 1IPAA 1ODEA 3FD6A 1H48A 3N2GB 3HKBB 3VYTC 4BVQA 2ZVZA 1VQOF 4BVRA 1JFFA 3P10A 3U0OA 1W59A 3JAKB 4X20A 3GTZA 1X52A 2HP0A 5C8YB 3P0ZA 3CYPB 5IJ9A 2ALEA 4X1YB 3IR9A 3CC7F 4LNUB 3WXMB 2H8CA 4G4WA 1TVKB 1U40A 3N4ZA 1JD1A 5LA6A 1W581 3PAFA 3LWQC 1E7KA 1YJ9F 1Q86H 5KMGA 3JALA 4BY9D 3MDOA 4E6EA 2WALA 2R6R1 1JFFB 3K12A 1CK2A 1RA4A 3K14A 3LDTA 4ZOLA 3M4SA 2N48A 3JARB 3KJJA 5EIBD 4C8GA 1VQVA 5LP6C 4ZHQA 2CHTA 5MN6A 3N4YA 2KTUA 3ZOPA 2VAMA 5HY4A 3CPWF 4IHJA 3RYIB 3VIUA 2HS4A 3WGNA 3JAWB 3I7TA 2FC3A 3S06A 3RE3A 2H8EA 2EWCA 2HQSC 3F0DA 3NK6A 3NMUC 4BT3A 3O85A 3TD4A 5JH7B 5IJ0B 3S02A 5GANK 1ZWZA 4G4ZA 3CCRF 3OBYA 5CA1B 4C8IA 4ZHQB 1Q82H 4F6RA 4RQOA 1FFXA 2GLZA 2W8BC 3CG6A 2CW4A 4YJ3A 4YJ2B 3E22A 3OW2F 3ELCA 1QD9A 2CVLA 2KG4A 3HKEA 4U3JA 4EI8A 3J80M 3SIUA 2VAWA 4I50A 1Q8RA 2CZWA 3CMAF 3QUWA 4IIJA 1IV4A 2RHHA 2P6YA 1GO0A 4C8EA 2IAFA 2L26A 3UT5A 3WPXA 3LMEA 4O2BB 4NWOB 4X3LA 3CMEF 1VQNF 5GONB 5CA0B 1Q7YH 1KD1H 1S72F 1QVGF 2HS0A 2UYJA 4C4WC 2PMPA 4NUTA 2GZLA 3HAXD 3ZP4A 4EI7A 2NMUA 1N8RH 1UI9A 4EB6B 5J2UA 1PXWA 5J2TA 4B5CA 3J81M 5G4VC 4X1KA 2I6DA 2DT4A 3QTYA 3RYHA 1KNJA 3CB2A 3L7QA 4IIJB 5EB1B 3S0HA 1Q81H 4ZK7A 2VGNA 3LWPC 2IQQA 2BTQB 1VQMF 3UT5B 2G9IA 1W42A 3CCQF 3IKEA 5FJ4C 2VXYA 3LYBA 4TV9B 3HJWC 2FGYA 3V7QA 3VI6A 3VTIC 3I56F 3PLAC 2V9YA 3V4DA 1IV2A 5HY1A 1X25A 2RHLA 3N2KA 4X1IA 1JY8A 1YHQF 1XRGA 5EZYA 5IYZB 3I55F 1R1MA 3T80A 4B62A 1YQNA 4EI9A 2OHWA 5JVDB 3JATA 2OZBA 4BT4A 3CPQA 3R0PA 2YYEA 2QI2A 2OTMA 4ZI7A 3C9RA 3NVKE 1YJNF 4C81A 3JASA 1OAPA 5GAPK 3GYQA 2LBXA 4O4JA 2PHNA 2VGMA 1M1KH 4O4LB 1U3PA 3IEQA 1VQ6F 4X1IB 2JNBA 3N2KB 2KGWA 5GINC 5DCVA 3CCUF 1RQ2A 5EAZA 1VQKF 2Z1UA 3VCZA 3CC4F 3KIZA 3ZO8A 3M84A 3M1XA 5HXZA 4X20B 3RYFA 2CSLA 5MN5A 2HP0B 1H7MA 5IJ9B 3VO8A 4G4YA 1VQ4F 1TUBA 3JASB 3P4EA 3WGLA 3CCMF 3Q8HA 4PWTA 1XHOA 2BTOA 5FLXM 1KC8H 2HS3A 1Z5WA 1W40A 3MCAB 1K9MH 2UYNA 5LA6B 2F9ZC 3OBWA 3J7AR 3WJPA 3KE1A 1U43A 2VAPA 4B46A 3DDNA 2LBWA 5KMGB 4O4IA 4FFBA 3JALB 5BMVA 3CD6F 3G6EF 4ZOLB 1GZ0A 3LWRC 1YIJF 3G4SF 3CCEF 2ZVYA 1ONIA 3GHZA 1JN1A 4U39A 4DXDA 3CCLF 4BT6A 5ITZA 5LP6A 3S0WA 1W5BA 4IHJB 3CXCF 3I3FA 4G88A 1VQLF 1GX1A 1QU9A 2ZAUA 2OTLF 3RA5A 3IKFA 3VYUC 1RLUA 4BT2A 5MN4A 2B33A 5EIBC 5A2QM 3JAMM 4TUYA 1VK3A 4FFBB 5JCOC 1K8AH 5LOVA 1FNKA 1IV1A 5LXTA 5JQGA 1W3EX 1DBFA 1VQ9F 3VOAA 1DT9A 4XCQA 4F6RB 3CC2F 1T0AA 3IMPA 1VQ5F 5CB4A 1X7PA 4TZZA 1FFXB 5GIPC 3EORA 3HKCA 5FNVA 1VQ7F 2YXZA 4YJ3B 2RHJA 3E22B 2HP3A 5LP6B 4G4VA 3HKEB 4U3JB 1W5EA 4BT5A 2BTUA 2HX0A 3E1YA 4I50B 3CCSF 3JVHA 1YITF 1VHAA 3WGJA 1JJ2F 1QVFF 1SZQA 2Q1YA 4I4TA 1SA0A 3QHDA 4B45A 3MBMA 4C82A 3KJKA 3LWVC 5LXTB 2AIZP 1OFUA 2AIFA 5HY2A 5JCOA 2Z1FA 4M8IA 3FFMA 5CB4B 1IV3A 3G71F 5IT9M 2Z1EA 3SIVA 2IG8A 3HKCB 5J2UB 3HKDA 2K1SA 5HP7A 5J2TB
chains in the Genus database with same CATH topology
3KE1A 1GX1A 1U43A 3FPIA 3F0FA 1IV4A 3P10A 3IKFA 2AMTA 1H47A 1KNJA 3K14A 3T80A 1YQNA 3ESJA 3FBAA 3JVHA 1KNKA 4C8EA 4C8GA 3K2XA 1W55A 1VHAA 3QHDA 3P0ZA 5B8FA 3F0GA 4C8IA 1IV1A 2UZHA 3GHZA 3IKEA 3F0EA 1U3LA 1JN1A 3B6NA 3MBMA 4C82A 3ERNA 4C81A 2PMPA 1U40A 1T0AA 2GZLA 3IEWA 3F6MA 3ELCA 3Q8HA 1VH8A 1H48A 1IV2A 3EORA 1W57A 1IV3A 1U3PA 1JY8A 3IEQA 3RE3A 3F0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KE1 A;  1GX1 A;  1U43 A;  3FPI A;  3F0F A;  1IV4 A;  3P10 A;  3IKF A;  2AMT A;  1H47 A;  1KNJ A;  3K14 A;  3T80 A;  1YQN A;  3ESJ A;  3FBA A;  3JVH A;  1KNK A;  4C8E A;  4C8G A;  3K2X A;  1W55 A;  1VHA A;  3QHD A;  3P0Z A;  5B8F A;  3F0G A;  4C8I A;  1IV1 A;  2UZH A;  3GHZ A;  3IKE A;  3F0E A;  1U3L A;  1JN1 A;  3B6N A;  3MBM A;  4C82 A;  3ERN A;  4C81 A;  2PMP A;  1U40 A;  1T0A A;  2GZL A;  3IEW A;  3F6M A;  3ELC A;  3Q8H A;  1VH8 A;  1H48 A;  1IV2 A;  3EOR A;  1W57 A;  1IV3 A;  1U3P A;  1JY8 A;  3IEQ A;  3RE3 A;  3F0D A; 
#chains in the Genus database with same CATH topology
 1W41 A;  3BYQ A;  3JAK A;  2AMT A;  3S0Y A;  2RB9 A;  1PF5 A;  4X1K B;  3TD3 A;  3RYH B;  4X1Y A;  3C8L A;  3V7E A;  3CCV F;  3AGK A;  1TVK A;  4I4T B;  3VMF B;  1UFY A;  2CWJ A;  2UYP A;  5HXU A;  3JCM M;  1GO1 A;  4DRX A;  4ERH A;  1VQ8 F;  2QA4 F;  3C9S A;  3ZP7 A;  3HTN A;  3JAR A;  3FPI A;  3HKD B;  1H47 A;  5EWR A;  5EYP A;  1CLI A;  5EZY B;  3K2X A;  3CYQ A;  1K73 H;  1W5F A;  2Z1T A;  3ON1 A;  3KHN A;  5B8F A;  1RQ7 A;  3JAT B;  3V3T A;  3MQW A;  1J7H A;  3RYI A;  1FSZ A;  1XV2 A;  1NQ3 A;  5HWE A;  4WBN A;  3JAW A;  4ZI7 B;  3D00 A;  4LCK A;  3LWO C;  3IEW A;  1M90 H;  1X7O A;  4O4J B;  3VOB A;  1SDS A;  4DRX B;  1KQS F;  4BVS A;  1YI2 F;  5JH7 A;  5IJ0 A;  2HVY D;  2LCA A;  3F0F A;  3S03 A;  5CA1 A;  1CN7 A;  1KNK A;  4G4X A;  3NVI B;  2BO1 A;  5EYP B;  1NJI H;  3WJR A;  4ZHV A;  3B6N A;  1XBI A;  4RHA A;  4YJ2 A;  3RYF B;  4ZHY B;  4WBN B;  2UYK A;  5EO3 A;  1VQP F;  1YGY A;  1TUB B;  5KX5 A;  3WJQ A;  5G4U C;  1W2B F;  3NK7 A;  2ZOV A;  5HY0 A;  2UYN B;  4ZHW A;  4O2B A;  5GON A;  1NMU B;  5CA0 A;  1W55 A;  1YJW F;  4O2A A;  4O4I B;  5GIO C;  4HNA A;  3FD5 A;  5BMV B;  2R75 1;  2UZH A;  5HP8 A;  4I55 A;  1U3L A;  4TV8 A;  4KWE A;  2Q1X A;  1QAH A;  3HWU A;  2QEX F;  4EB6 A;  5LYJ A;  3F6M A;  3D54 A;  3D01 A;  1VH8 A;  2I6R A;  5EB0 A;  3RYC A;  1T0K B;  3CCJ F;  2MQE A;  5ITZ B;  4X3M A;  1W5A A;  4BT7 A;  5KX5 B;  3WGM A;  2DYY A;  3MCQ A;  3RA6 A;  2OTJ F;  2ZF8 A;  1RLG A;  3FBA A;  2KTV A;  3C9U A;  2RHO A;  4BW0 B;  4O4H A;  4NQ3 A;  3LFO A;  4TUY B;  4O2A B;  2LBT A;  4TV9 A;  3F0E A;  4HNA B;  2GVI A;  2CHS A;  3ERN A;  4I55 B;  2QTP A;  5LOV B;  1FNJ A;  4TV8 B;  2HRU A;  5JQG B;  3N2G A;  3HKB A;  5LYJ B;  1W57 A;  3OON A;  5AVM A;  1Z5V A;  5IYZ A;  3RYC B;  2ZOD A;  2Z01 A;  5FNV B;  3DC2 A;  5JVD A;  2H6L A;  3C9T A;  3ESJ A;  5C8Y A;  3E20 B;  1COM A;  3F0G A;  4LNU A;  4O4H B;  3VYS C;  3WPW A;  4BVT A;  1SA0 B;  3K0T A;  3WGK A;  3TD5 A;  4O4L A;  4R40 B;  2HRY A;  1IPA A;  1ODE A;  3FD6 A;  1H48 A;  3N2G B;  3HKB B;  3VYT C;  4BVQ A;  2ZVZ A;  1VQO F;  4BVR A;  1JFF A;  3P10 A;  3U0O A;  1W59 A;  3JAK B;  4X20 A;  3GTZ A;  1X52 A;  2HP0 A;  5C8Y B;  3P0Z A;  3CYP B;  5IJ9 A;  2ALE A;  4X1Y B;  3IR9 A;  3CC7 F;  4LNU B;  3WXM B;  2H8C A;  4G4W A;  1TVK B;  1U40 A;  3N4Z A;  1JD1 A;  5LA6 A;  1W58 1;  3PAF A;  3LWQ C;  1E7K A;  1YJ9 F;  1Q86 H;  5KMG A;  3JAL A;  4BY9 D;  3MDO A;  4E6E A;  2WAL A;  2R6R 1;  1JFF B;  3K12 A;  1CK2 A;  1RA4 A;  3K14 A;  3LDT A;  4ZOL A;  3M4S A;  2N48 A;  3JAR B;  3KJJ A;  5EIB D;  4C8G A;  1VQV A;  5LP6 C;  4ZHQ A;  2CHT A;  5MN6 A;  3N4Y A;  2KTU A;  3ZOP A;  2VAM A;  5HY4 A;  3CPW F;  4IHJ A;  3RYI B;  3VIU A;  2HS4 A;  3WGN A;  3JAW B;  3I7T A;  2FC3 A;  3S06 A;  3RE3 A;  2H8E A;  2EWC A;  2HQS C;  3F0D A;  3NK6 A;  3NMU C;  4BT3 A;  3O85 A;  3TD4 A;  5JH7 B;  5IJ0 B;  3S02 A;  5GAN K;  1ZWZ A;  4G4Z A;  3CCR F;  3OBY A;  5CA1 B;  4C8I A;  4ZHQ B;  1Q82 H;  4F6R A;  4RQO A;  1FFX A;  2GLZ A;  2W8B C;  3CG6 A;  2CW4 A;  4YJ3 A;  4YJ2 B;  3E22 A;  3OW2 F;  3ELC A;  1QD9 A;  2CVL A;  2KG4 A;  3HKE A;  4U3J A;  4EI8 A;  3J80 M;  3SIU A;  2VAW A;  4I50 A;  1Q8R A;  2CZW A;  3CMA F;  3QUW A;  4IIJ A;  1IV4 A;  2RHH A;  2P6Y A;  1GO0 A;  4C8E A;  2IAF A;  2L26 A;  3UT5 A;  3WPX A;  3LME A;  4O2B B;  4NWO B;  4X3L A;  3CME F;  1VQN F;  5GON B;  5CA0 B;  1Q7Y H;  1KD1 H;  1S72 F;  1QVG F;  2HS0 A;  2UYJ A;  4C4W C;  2PMP A;  4NUT A;  2GZL A;  3HAX D;  3ZP4 A;  4EI7 A;  2NMU A;  1N8R H;  1UI9 A;  4EB6 B;  5J2U A;  1PXW A;  5J2T A;  4B5C A;  3J81 M;  5G4V C;  4X1K A;  2I6D A;  2DT4 A;  3QTY A;  3RYH A;  1KNJ A;  3CB2 A;  3L7Q A;  4IIJ B;  5EB1 B;  3S0H A;  1Q81 H;  4ZK7 A;  2VGN A;  3LWP C;  2IQQ A;  2BTQ B;  1VQM F;  3UT5 B;  2G9I A;  1W42 A;  3CCQ F;  3IKE A;  5FJ4 C;  2VXY A;  3LYB A;  4TV9 B;  3HJW C;  2FGY A;  3V7Q A;  3VI6 A;  3VTI C;  3I56 F;  3PLA C;  2V9Y A;  3V4D A;  1IV2 A;  5HY1 A;  1X25 A;  2RHL A;  3N2K A;  4X1I A;  1JY8 A;  1YHQ F;  1XRG A;  5EZY A;  5IYZ B;  3I55 F;  1R1M A;  3T80 A;  4B62 A;  1YQN A;  4EI9 A;  2OHW A;  5JVD B;  3JAT A;  2OZB A;  4BT4 A;  3CPQ A;  3R0P A;  2YYE A;  2QI2 A;  2OTM A;  4ZI7 A;  3C9R A;  3NVK E;  1YJN F;  4C81 A;  3JAS A;  1OAP A;  5GAP K;  3GYQ A;  2LBX A;  4O4J A;  2PHN A;  2VGM A;  1M1K H;  4O4L B;  1U3P A;  3IEQ A;  1VQ6 F;  4X1I B;  2JNB A;  3N2K B;  2KGW A;  5GIN C;  5DCV A;  3CCU F;  1RQ2 A;  5EAZ A;  1VQK F;  2Z1U A;  3VCZ A;  3CC4 F;  3KIZ A;  3ZO8 A;  3M84 A;  3M1X A;  5HXZ A;  4X20 B;  3RYF A;  2CSL A;  5MN5 A;  2HP0 B;  1H7M A;  5IJ9 B;  3VO8 A;  4G4Y A;  1VQ4 F;  1TUB A;  3JAS B;  3P4E A;  3WGL A;  3CCM F;  3Q8H A;  4PWT A;  1XHO A;  2BTO A;  5FLX M;  1KC8 H;  2HS3 A;  1Z5W A;  1W40 A;  3MCA B;  1K9M H;  2UYN A;  5LA6 B;  2F9Z C;  3OBW A;  3J7A R;  3WJP A;  3KE1 A;  1U43 A;  2VAP A;  4B46 A;  3DDN A;  2LBW A;  5KMG B;  4O4I A;  4FFB A;  3JAL B;  5BMV A;  3CD6 F;  3G6E F;  4ZOL B;  1GZ0 A;  3LWR C;  1YIJ F;  3G4S F;  3CCE F;  2ZVY A;  1ONI A;  3GHZ A;  1JN1 A;  4U39 A;  4DXD A;  3CCL F;  4BT6 A;  5ITZ A;  5LP6 A;  3S0W A;  1W5B A;  4IHJ B;  3CXC F;  3I3F A;  4G88 A;  1VQL F;  1GX1 A;  1QU9 A;  2ZAU A;  2OTL F;  3RA5 A;  3IKF A;  3VYU C;  1RLU A;  4BT2 A;  5MN4 A;  2B33 A;  5EIB C;  5A2Q M;  3JAM M;  4TUY A;  1VK3 A;  4FFB B;  5JCO C;  1K8A H;  5LOV A;  1FNK A;  1IV1 A;  5LXT A;  5JQG A;  1W3E X;  1DBF A;  1VQ9 F;  3VOA A;  1DT9 A;  4XCQ A;  4F6R B;  3CC2 F;  1T0A A;  3IMP A;  1VQ5 F;  5CB4 A;  1X7P A;  4TZZ A;  1FFX B;  5GIP C;  3EOR A;  3HKC A;  5FNV A;  1VQ7 F;  2YXZ A;  4YJ3 B;  2RHJ A;  3E22 B;  2HP3 A;  5LP6 B;  4G4V A;  3HKE B;  4U3J B;  1W5E A;  4BT5 A;  2BTU A;  2HX0 A;  3E1Y A;  4I50 B;  3CCS F;  3JVH A;  1YIT F;  1VHA A;  3WGJ A;  1JJ2 F;  1QVF F;  1SZQ A;  2Q1Y A;  4I4T A;  1SA0 A;  3QHD A;  4B45 A;  3MBM A;  4C82 A;  3KJK A;  3LWV C;  5LXT B;  2AIZ P;  1OFU A;  2AIF A;  5HY2 A;  5JCO A;  2Z1F A;  4M8I A;  3FFM A;  5CB4 B;  1IV3 A;  3G71 F;  5IT9 M;  2Z1E A;  3SIV A;  2IG8 A;  3HKC B;  5J2U B;  3HKD A;  2K1S A;  5HP7 A;  5J2T B; 
#chains in the Genus database with same CATH homology
 3KE1 A;  1GX1 A;  1U43 A;  3FPI A;  3F0F A;  1IV4 A;  3P10 A;  3IKF A;  2AMT A;  1H47 A;  1KNJ A;  3K14 A;  3T80 A;  1YQN A;  3ESJ A;  3FBA A;  3JVH A;  1KNK A;  4C8E A;  4C8G A;  3K2X A;  1W55 A;  1VHA A;  3QHD A;  3P0Z A;  5B8F A;  3F0G A;  4C8I A;  1IV1 A;  2UZH A;  3GHZ A;  3IKE A;  3F0E A;  1U3L A;  1JN1 A;  3B6N A;  3MBM A;  4C82 A;  3ERN A;  4C81 A;  2PMP A;  1U40 A;  1T0A A;  2GZL A;  3IEW A;  3F6M A;  3ELC A;  3Q8H A;  1VH8 A;  1H48 A;  1IV2 A;  3EOR A;  1W57 A;  1IV3 A;  1U3P A;  1JY8 A;  3IEQ A;  3RE3 A;  3F0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...