1YJNF

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjnF00
3PAFA 3I55F 3CCJF 3CCRF 1W40A 3LWQC 2LBXA 5FJ4C 2OTJF 1PXWA 5GINC 3JAMM 3E20B 3LWPC 1X7OA 3RA5A 4C4WC 1NMUB 1X52A 3CPQA 5IT9M 4NUTA 3LWOC 1VQ5F 3NMUC 2AIFA 3CPWF 1YHQF 3IR9A 3CCQF 1X7PA 2KG4A 1H7MA 1YJWF 3J80M 3FFMA 1DT9A 3AGKA 5A2QM 1W2BF 3I56F 1Q81H 1M1KH 2OTLF 5EO3A 1YITF 3WXMB 3HAXD 1YJNF 2JNBA 1KQSF 5GIOC 3G71F 3J7AR 1YI2F 1RLGA 2OZBA 3CXCF 3NVKE 3CCSF 2HVYD 3V7QA 3LFOA 1VQ8F 1N8RH 1K8AH 3HJWC 1KD1H 3CCEF 1YJ9F 4TZZA 5DCVA 1CN7A 3JCMM 1VQNF 3CMEF 1VQPF 2KTUA 3OBYA 5GIPC 2FC3A 1YIJF 5GANK 4BY9D 3SIVA 1K73H 1GO0A 3CC7F 1XBIA 3CCLF 4X3LA 2ALEA 2VGNA 1M90H 1QVGF 2CZWA 3SIUA 1SDSA 1VQ7F 2BO1A 3ON1A 1Q7YH 2QEXF 1NJIH 3PLAC 3CD6F 1JJ2F 1T0KB 4BW0B 1ZWZA 3MCAB 3RA6A 1VQMF 1S72F 3NK6A 1GO1A 1W42A 3LWVC 4LCKA 1VQ4F 2WALA 3GYQA 1VQKF 1E7KA 3N4YA 1VQLF 3CG6A 4X3MA 1QVFF 1RA4A 5GAPK 3NK7A 3VI6A 1Q82H 5G4VC 3J81M 3CCMF 1VQOF 3N4ZA 2VGMA 3CCUF 2LBWA 1Q86H 1VQ6F 1VQ9F 3VMFB 3CC2F 1W3EX 5G4UC 5EWRA 2KTVA 1K9MH 2QI2A 5FLXM 2I6DA 1W41A 1KC8H 1CK2A 3LWRC 3OW2F 3CMAF 3G4SF 1GZ0A 3O85A 3CCVF 3NVIB 2QA4F 3V7EA 2OHWA 3CC4F 1IPAA 3E1YA 3OBWA 3G6EF
chains in the Genus database with same CATH superfamily
3I55F 3RYFA 4ZOLA 3VIUA 3JASB 5FJ4C 2UYPA 3JAMM 3HKDB 1X7OA 3HWUA 1NMUB 2CSLA 3MDOA 3LWOC 5BMVB 1KNKA 1VQ5F 2AIZP 3CPWF 2H8CA 4B45A 4R40B 3QTYA 2RHHA 1XHOA 1IV2A 1H7MA 3J80M 4IIJA 4BT7A 1JN1A 5ITZA 2HP3A 1JFFA 4O4JA 1W2BF 1M1KH 1H47A 3WGMA 2OTLF 3DDNA 2HS4A 3S06A 4O4HA 4O4LB 3VTIC 5IJ0B 3HAXD 2IG8A 4U3JB 1U43A 4NWOB 4NQ3A 2P6YA 5MN4A 3JAWA 3RYHB 2JNBA 4C8IA 5CB4B 3B6NA 1KQSF 3N2KB 5JH7A 1U3LA 5J2TB 1UI9A 1YJ9F 5DCVA 1VQNF 3OBYA 5HXZA 2FC3A 4BY9D 4BT2A 4ZHQB 4O2BA 4C82A 1M90H 2ALEA 2MQEA 2VGNA 4DXDA 5J2UA 1QVGF 4EI7A 3SIUA 2ZVYA 3ON1A 5EYPB 1NJIH 3CD6F 5EZYB 3M84A 1KNJA 4BW0B 2F9ZC 1COMA 3WJPA 1VHAA 3LWVC 4LNUA 4TUYB 1VQ4F 2WALA 4ZOLB 1VK3A 3WJRA 3F6MA 3KJJA 4O4IA 5B8FA 5EIBD 4YJ3A 2KGWA 3IEQA 1UFYA 1TVKA 4C8GA 3VI6A 3CCMF 3N4ZA 4ZHYB 5HY2A 3T80A 5LA6A 1VQ9F 4IIJB 2Q1XA 2HX0A 5ITZB 4RQOA 4G4ZA 3ZP7A 1JFFB 4O4JB 2UZHA 4EB6B 3VOAA 1CK2A 3OW2F 2NMUA 3JVHA 2Z1FA 3VYTC 3MQWA 2B33A 1SZQA 3CC4F 2PHNA 2LBTA 3M4SA 3TD5A 4G4YA 2GLZA 4YJ2A 4U39A 4ZI7A 2OTJF 5GINC 3HKCB 3FBAA 3LWPC 2UYKA 4C4WC 4BVRA 1PF5A 1W5EA 2AIFA 2HQSC 3S0HA 1J7HA 3CCQF 5HP8A 4G4XA 4X20A 2KG4A 1IV3A 4FFBB 3S0WA 3C9SA 1DT9A 3WGJA 1TUBA 1OFUA 2ZAUA 3CYPB 2Z1TA 5J2UB 5JQGB 1RLUA 3JAKA 5EO3A 1SA0A 3CB2A 3M1XA 2Q1YA 1VQVA 5KX5A 3JATA 3K14A 1FNKA 3RYCA 5HWEA 2HS0A 4LNUB 3J7AR 1RLGA 3NVKE 2HVYD 4I55B 4O4IB 3HJWC 1N8RH 1K8AH 4X1KB 1KD1H 4TZZA 1CN7A 4YJ3B 3CMEF 1YIJF 5GIPC 5LP6A 1TVKB 5GONA 1K73H 5CA0B 4X1IA 1X25A 5LYJB 1XBIA 4HNAA 4RHAA 5LA6B 4ZK7A 4IHJA 4X3LA 1SDSA 2CHTA 3KHNA 3K0TA 3EORA 2W8BC 3HKBA 3PLAC 2IQQA 1W55A 3D00A 3IKFA 5CA1A 3MCAB 3V4DA 3NK6A 5FNVA 4LCKA 3WPWA 2Z1EA 4YJ2B 4ZI7B 3C9UA 1VQKF 5HP7A 3K2XA 3MCQA 3FD5A 3CYQA 4TV9A 5EAZA 2UYNB 3C9TA 1RA4A 1JY8A 5JCOC 2Z1UA 3ZO8A 5G4VC 1VQOF 4X20B 5JVDA 4DRXB 2AMTA 1VH8A 3VMFB 3CC2F 1T0AA 5G4UC 5EB0A 5EWRA 4B5CA 3LMEA 3Q8HA 3JALA 3JAKB 2DT4A 1SA0B 2CHSA 3G4SF 5KX5B 3CCVF 3JATB 5HY4A 2QA4F 3RYFB 4EI9A 2QTPA 3V7EA 3RYCB 4XCQA 2OHWA 3CCRF 1IV4A 3UT5A 4TV8A 3CCJF 1W40A 2G9IA 2RB9A 1R1MA 1PXWA 3E22A 3TD4A 2R751 1YQNA 5IJ9A 2VAPA 1GX1A 4NUTA 2PMPA 5LP6B 4C81A 4X1IB 3ZP4A 5BMVA 4BVQA 4IHJB 4O4HB 2BTQB 4F6RA 1Q81H 2YYEA 5IYZA 3WJQA 2YXZA 3R0PA 3JAWB 3KJKA 1YITF 1CLIA 4BT3A 3WXMB 4I50A 2N48A 5EIBC 5JH7B 1XV2A 5MN5A 5IJ0A 1W5FA 4I4TA 4U3JA 1ODEA 2V9YA 3MBMA 2EWCA 1U3PA 3P0ZA 4BT6A 2OZBA 3CXCF 3RYHA 3V7QA 3N2GA 3V3TA 3N2KA 3CCEF 2HRUA 3JCMM 1NQ3A 4O2BB 3RYIA 2KTUA 3ERNA 3SIVA 1GO0A 4ZHVA 3CC7F 3F0EA 1XRGA 1YGYA 1Q8RA 2CZWA 2GVIA 2VAWA 5HY1A 1VQ7F 2BO1A 4ZHQA 1Q7YH 3GHZA 3IEWA 1T0KB 1ZWZA 1VQMF 5EYPA 3S0YA 2HS3A 3HTNA 1GO1A 3DC2A 1W42A 4TV8B 1W57A 2CWJA 5EZYA 4G88A 5C8YA 1E7KA 3N4YA 3F0GA 3RE3A 4B62A 1ONIA 4BVTA 3P4EA 4TUYA 5IJ9B 1Z5VA 1QAHA 4ERHA 3C9RA 3S03A 4M8IA 3J81M 2R6R1 4EI8A 3KE1A 3CCUF 2HRYA 2RHOA 4F6RB 3F0DA 2KTVA 2L26A 1QD9A 3I7TA 2QI2A 5IYZB 5FLXM 4B46A 2H6LA 2HP0A 1U40A 1KC8H 3S02A 3LWRC 3CMAF 3F0FA 3QHDA 5HXUA 1FFXA 3NVIB 3VYSC 1JD1A 4I50B 4EB6A 4BVSA 2ZOVA 3FD6A 1W581 1IPAA 3E1YA 4BT5A 3PAFA 4I4TB 3WPXA 3LWQC 2LBXA 3E20B 5LOVA 3RA5A 1X52A 3CPQA 3D01A 3N2GB 5IT9M 3NMUC 3JARA 3HKCA 4O2AA 3RYIB 1YHQF 3BYQA 3IR9A 1TUBB 1X7PA 2VXYA 1H48A 2RHLA 3WGNA 1YJWF 1QU9A 1FSZA 2IAFA 3FFMA 5LXTA 3AGKA 5A2QM 3I56F 4WBNA 1FNJA 3IKEA 2LCAA 5KMGA 4FFBA 5HY0A 3HKEA 2ZODA 4E6EA 5JQGA 3VYUC 3D54A 4X1YA 1YJNF 4C8EA 5AVMA 2DYYA 1IV1A 3ELCA 3IMPA 5GIOC 3G71F 3JASA 1YI2F 3OONA 2I6RA 3HKDA 3KIZA 5C8YB 3CCSF 2ZVZA 5GONB 3WGKA 1W5AA 3LFOA 1VQ8F 3LYBA 4HNAB 1VQPF 2K1SA 3WGLA 4BT4A 5GANK 4I55A 3GTZA 3K12A 3ESJA 4X1KA 5JCOA 3CCLF 5CA0A 3HKBB 5EB1B 5LYJA 4ZHWA 3VO8A 2BTOA 2CW4A 5CA1B 4G4VA 2HP0B 3U0OA 1DBFA 4O4LA 2QEXF 3LDTA 1FFXB 3VCZA 5FNVB 3VOBA 4G4WA 1JJ2F 2UYJA 3RA6A 5CB4A 1S72F 1RQ7A 2H8EA 4TV9B 2OTMA 3L7QA 4KWEA 1W59A 2RHJA 3GYQA 2VAMA 1VQLF 1Z5WA 3CG6A 5LOVB 2Z01A 5J2TA 3I3FA 4X3MA 5LP6C 5JVDB 3ZOPA 1QVFF 1RQ2A 3JARB 4O2AB 2CVLA 5GAPK 3NK7A 1Q82H 5MN6A 2VGMA 3C8LA 2ZF8A 3JALB 2LBWA 1Q86H 1VQ6F 2UYNA 1W3EX 5LXTB 3QUWA 1K9MH 3P10A 1OAPA 4WBNB 2I6DA 4DRXA 1W41A 5KMGB 2BTUA 1GZ0A 3O85A 3UT5B 3HKEB 4PWTA 2FGYA 2GZLA 3FPIA 3TD3A 1W5BA 3E22B 4X1YB 3OBWA 3G6EF
chains in the Genus database with same CATH topology
3PAFA 3I55F 3CCJF 3CCRF 1W40A 3LWQC 2GLZA 2LBXA 5FJ4C 2OTJF 1PXWA 5GINC 3JAMM 3E20B 3LWPC 1X7OA 3RA5A 4C4WC 1NMUB 1X52A 3CPQA 4BVRA 5IT9M 4NUTA 3LWOC 1VQ5F 3NMUC 2AIFA 3CPWF 1YHQF 3IR9A 3CCQF 1X7PA 2KG4A 1H7MA 1YJWF 4BVQA 3J80M 3FFMA 1DT9A 3AGKA 5A2QM 1W2BF 3I56F 1Q81H 1M1KH 2OTLF 5EO3A 1YITF 3WXMB 5HY0A 3HAXD 4NQ3A 1YJNF 5HWEA 2JNBA 1KQSF 5GIOC 3G71F 3J7AR 1YI2F 1RLGA 2OZBA 3CXCF 3NVKE 3CCSF 2HVYD 3V7QA 3LFOA 1VQ8F 1N8RH 1K8AH 3HJWC 3V3TA 1KD1H 3CCEF 1YJ9F 4TZZA 5DCVA 1CN7A 3JCMM 1VQNF 3CMEF 1VQPF 2KTUA 3OBYA 5HXZA 2FC3A 5GIPC 5GANK 1YIJF 4BY9D 3SIVA 1K73H 1GO0A 3CC7F 1XBIA 3CCLF 4X3LA 2ALEA 2VGNA 1M90H 1QVGF 2CZWA 4EI7A 5HY1A 3SIUA 1SDSA 1VQ7F 2BO1A 3ON1A 1Q7YH 2QEXF 1NJIH 3PLAC 3CD6F 1JJ2F 1T0KB 4BW0B 3D00A 1ZWZA 2F9ZC 3MCAB 3RA6A 1VQMF 1S72F 3NK6A 1GO1A 1W42A 3LWVC 4LCKA 1VQ4F 2WALA 3GYQA 1VQKF 1E7KA 3N4YA 1VQLF 3CG6A 4BVTA 4X3MA 1QVFF 1RA4A 5GAPK 3NK7A 3VI6A 1Q82H 5G4VC 3J81M 3CCMF 1VQOF 3N4ZA 2VGMA 4EI8A 5HY2A 3CCUF 2LBWA 1Q86H 1VQ6F 1VQ9F 3VMFB 3CC2F 1W3EX 5G4UC 5EWRA 2KTVA 1K9MH 2QI2A 5FLXM 2I6DA 1W41A 1KC8H 1CK2A 3LWRC 3OW2F 3CMAF 3G4SF 5HXUA 1GZ0A 3O85A 3CCVF 5HY4A 3NVIB 2FGYA 2QA4F 4EI9A 3V7EA 4XCQA 2OHWA 4BVSA 3CC4F 1IPAA 3E1YA 3OBWA 3G6EF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  3I55 F;  3CCJ F;  3CCR F;  1W40 A;  3LWQ C;  2LBX A;  5FJ4 C;  2OTJ F;  1PXW A;  5GIN C;  3JAM M;  3E20 B;  3LWP C;  1X7O A;  3RA5 A;  4C4W C;  1NMU B;  1X52 A;  3CPQ A;  5IT9 M;  4NUT A;  3LWO C;  1VQ5 F;  3NMU C;  2AIF A;  3CPW F;  1YHQ F;  3IR9 A;  3CCQ F;  1X7P A;  2KG4 A;  1H7M A;  1YJW F;  3J80 M;  3FFM A;  1DT9 A;  3AGK A;  5A2Q M;  1W2B F;  3I56 F;  1Q81 H;  1M1K H;  2OTL F;  5EO3 A;  1YIT F;  3WXM B;  3HAX D;  1YJN F;  2JNB A;  1KQS F;  5GIO C;  3G71 F;  3J7A R;  1YI2 F;  1RLG A;  2OZB A;  3CXC F;  3NVK E;  3CCS F;  2HVY D;  3V7Q A;  3LFO A;  1VQ8 F;  1N8R H;  1K8A H;  3HJW C;  1KD1 H;  3CCE F;  1YJ9 F;  4TZZ A;  5DCV A;  1CN7 A;  3JCM M;  1VQN F;  3CME F;  1VQP F;  2KTU A;  3OBY A;  5GIP C;  2FC3 A;  1YIJ F;  5GAN K;  4BY9 D;  3SIV A;  1K73 H;  1GO0 A;  3CC7 F;  1XBI A;  3CCL F;  4X3L A;  2ALE A;  2VGN A;  1M90 H;  1QVG F;  2CZW A;  3SIU A;  1SDS A;  1VQ7 F;  2BO1 A;  3ON1 A;  1Q7Y H;  2QEX F;  1NJI H;  3PLA C;  3CD6 F;  1JJ2 F;  1T0K B;  4BW0 B;  1ZWZ A;  3MCA B;  3RA6 A;  1VQM F;  1S72 F;  3NK6 A;  1GO1 A;  1W42 A;  3LWV C;  4LCK A;  1VQ4 F;  2WAL A;  3GYQ A;  1VQK F;  1E7K A;  3N4Y A;  1VQL F;  3CG6 A;  4X3M A;  1QVF F;  1RA4 A;  5GAP K;  3NK7 A;  3VI6 A;  1Q82 H;  5G4V C;  3J81 M;  3CCM F;  1VQO F;  3N4Z A;  2VGM A;  3CCU F;  2LBW A;  1Q86 H;  1VQ6 F;  1VQ9 F;  3VMF B;  3CC2 F;  1W3E X;  5G4U C;  5EWR A;  2KTV A;  1K9M H;  2QI2 A;  5FLX M;  2I6D A;  1W41 A;  1KC8 H;  1CK2 A;  3LWR C;  3OW2 F;  3CMA F;  3G4S F;  1GZ0 A;  3O85 A;  3CCV F;  3NVI B;  2QA4 F;  3V7E A;  2OHW A;  3CC4 F;  1IPA A;  3E1Y A;  3OBW A;  3G6E F; 
#chains in the Genus database with same CATH topology
 3I55 F;  3RYF A;  4ZOL A;  3VIU A;  3JAS B;  5FJ4 C;  2UYP A;  3JAM M;  3HKD B;  1X7O A;  3HWU A;  1NMU B;  2CSL A;  3MDO A;  3LWO C;  5BMV B;  1KNK A;  1VQ5 F;  2AIZ P;  3CPW F;  2H8C A;  4B45 A;  4R40 B;  3QTY A;  2RHH A;  1XHO A;  1IV2 A;  1H7M A;  3J80 M;  4IIJ A;  4BT7 A;  1JN1 A;  5ITZ A;  2HP3 A;  1JFF A;  4O4J A;  1W2B F;  1M1K H;  1H47 A;  3WGM A;  2OTL F;  3DDN A;  2HS4 A;  3S06 A;  4O4H A;  4O4L B;  3VTI C;  5IJ0 B;  3HAX D;  2IG8 A;  4U3J B;  1U43 A;  4NWO B;  4NQ3 A;  2P6Y A;  5MN4 A;  3JAW A;  3RYH B;  2JNB A;  4C8I A;  5CB4 B;  3B6N A;  1KQS F;  3N2K B;  5JH7 A;  1U3L A;  5J2T B;  1UI9 A;  1YJ9 F;  5DCV A;  1VQN F;  3OBY A;  5HXZ A;  2FC3 A;  4BY9 D;  4BT2 A;  4ZHQ B;  4O2B A;  4C82 A;  1M90 H;  2ALE A;  2MQE A;  2VGN A;  4DXD A;  5J2U A;  1QVG F;  4EI7 A;  3SIU A;  2ZVY A;  3ON1 A;  5EYP B;  1NJI H;  3CD6 F;  5EZY B;  3M84 A;  1KNJ A;  4BW0 B;  2F9Z C;  1COM A;  3WJP A;  1VHA A;  3LWV C;  4LNU A;  4TUY B;  1VQ4 F;  2WAL A;  4ZOL B;  1VK3 A;  3WJR A;  3F6M A;  3KJJ A;  4O4I A;  5B8F A;  5EIB D;  4YJ3 A;  2KGW A;  3IEQ A;  1UFY A;  1TVK A;  4C8G A;  3VI6 A;  3CCM F;  3N4Z A;  4ZHY B;  5HY2 A;  3T80 A;  5LA6 A;  1VQ9 F;  4IIJ B;  2Q1X A;  2HX0 A;  5ITZ B;  4RQO A;  4G4Z A;  3ZP7 A;  1JFF B;  4O4J B;  2UZH A;  4EB6 B;  3VOA A;  1CK2 A;  3OW2 F;  2NMU A;  3JVH A;  2Z1F A;  3VYT C;  3MQW A;  2B33 A;  1SZQ A;  3CC4 F;  2PHN A;  2LBT A;  3M4S A;  3TD5 A;  4G4Y A;  2GLZ A;  4YJ2 A;  4U39 A;  4ZI7 A;  2OTJ F;  5GIN C;  3HKC B;  3FBA A;  3LWP C;  2UYK A;  4C4W C;  4BVR A;  1PF5 A;  1W5E A;  2AIF A;  2HQS C;  3S0H A;  1J7H A;  3CCQ F;  5HP8 A;  4G4X A;  4X20 A;  2KG4 A;  1IV3 A;  4FFB B;  3S0W A;  3C9S A;  1DT9 A;  3WGJ A;  1TUB A;  1OFU A;  2ZAU A;  3CYP B;  2Z1T A;  5J2U B;  5JQG B;  1RLU A;  3JAK A;  5EO3 A;  1SA0 A;  3CB2 A;  3M1X A;  2Q1Y A;  1VQV A;  5KX5 A;  3JAT A;  3K14 A;  1FNK A;  3RYC A;  5HWE A;  2HS0 A;  4LNU B;  3J7A R;  1RLG A;  3NVK E;  2HVY D;  4I55 B;  4O4I B;  3HJW C;  1N8R H;  1K8A H;  4X1K B;  1KD1 H;  4TZZ A;  1CN7 A;  4YJ3 B;  3CME F;  1YIJ F;  5GIP C;  5LP6 A;  1TVK B;  5GON A;  1K73 H;  5CA0 B;  4X1I A;  1X25 A;  5LYJ B;  1XBI A;  4HNA A;  4RHA A;  5LA6 B;  4ZK7 A;  4IHJ A;  4X3L A;  1SDS A;  2CHT A;  3KHN A;  3K0T A;  3EOR A;  2W8B C;  3HKB A;  3PLA C;  2IQQ A;  1W55 A;  3D00 A;  3IKF A;  5CA1 A;  3MCA B;  3V4D A;  3NK6 A;  5FNV A;  4LCK A;  3WPW A;  2Z1E A;  4YJ2 B;  4ZI7 B;  3C9U A;  1VQK F;  5HP7 A;  3K2X A;  3MCQ A;  3FD5 A;  3CYQ A;  4TV9 A;  5EAZ A;  2UYN B;  3C9T A;  1RA4 A;  1JY8 A;  5JCO C;  2Z1U A;  3ZO8 A;  5G4V C;  1VQO F;  4X20 B;  5JVD A;  4DRX B;  2AMT A;  1VH8 A;  3VMF B;  3CC2 F;  1T0A A;  5G4U C;  5EB0 A;  5EWR A;  4B5C A;  3LME A;  3Q8H A;  3JAL A;  3JAK B;  2DT4 A;  1SA0 B;  2CHS A;  3G4S F;  5KX5 B;  3CCV F;  3JAT B;  5HY4 A;  2QA4 F;  3RYF B;  4EI9 A;  2QTP A;  3V7E A;  3RYC B;  4XCQ A;  2OHW A;  3CCR F;  1IV4 A;  3UT5 A;  4TV8 A;  3CCJ F;  1W40 A;  2G9I A;  2RB9 A;  1R1M A;  1PXW A;  3E22 A;  3TD4 A;  2R75 1;  1YQN A;  5IJ9 A;  2VAP A;  1GX1 A;  4NUT A;  2PMP A;  5LP6 B;  4C81 A;  4X1I B;  3ZP4 A;  5BMV A;  4BVQ A;  4IHJ B;  4O4H B;  2BTQ B;  4F6R A;  1Q81 H;  2YYE A;  5IYZ A;  3WJQ A;  2YXZ A;  3R0P A;  3JAW B;  3KJK A;  1YIT F;  1CLI A;  4BT3 A;  3WXM B;  4I50 A;  2N48 A;  5EIB C;  5JH7 B;  1XV2 A;  5MN5 A;  5IJ0 A;  1W5F A;  4I4T A;  4U3J A;  1ODE A;  2V9Y A;  3MBM A;  2EWC A;  1U3P A;  3P0Z A;  4BT6 A;  2OZB A;  3CXC F;  3RYH A;  3V7Q A;  3N2G A;  3V3T A;  3N2K A;  3CCE F;  2HRU A;  3JCM M;  1NQ3 A;  4O2B B;  3RYI A;  2KTU A;  3ERN A;  3SIV A;  1GO0 A;  4ZHV A;  3CC7 F;  3F0E A;  1XRG A;  1YGY A;  1Q8R A;  2CZW A;  2GVI A;  2VAW A;  5HY1 A;  1VQ7 F;  2BO1 A;  4ZHQ A;  1Q7Y H;  3GHZ A;  3IEW A;  1T0K B;  1ZWZ A;  1VQM F;  5EYP A;  3S0Y A;  2HS3 A;  3HTN A;  1GO1 A;  3DC2 A;  1W42 A;  4TV8 B;  1W57 A;  2CWJ A;  5EZY A;  4G88 A;  5C8Y A;  1E7K A;  3N4Y A;  3F0G A;  3RE3 A;  4B62 A;  1ONI A;  4BVT A;  3P4E A;  4TUY A;  5IJ9 B;  1Z5V A;  1QAH A;  4ERH A;  3C9R A;  3S03 A;  4M8I A;  3J81 M;  2R6R 1;  4EI8 A;  3KE1 A;  3CCU F;  2HRY A;  2RHO A;  4F6R B;  3F0D A;  2KTV A;  2L26 A;  1QD9 A;  3I7T A;  2QI2 A;  5IYZ B;  5FLX M;  4B46 A;  2H6L A;  2HP0 A;  1U40 A;  1KC8 H;  3S02 A;  3LWR C;  3CMA F;  3F0F A;  3QHD A;  5HXU A;  1FFX A;  3NVI B;  3VYS C;  1JD1 A;  4I50 B;  4EB6 A;  4BVS A;  2ZOV A;  3FD6 A;  1W58 1;  1IPA A;  3E1Y A;  4BT5 A;  3PAF A;  4I4T B;  3WPX A;  3LWQ C;  2LBX A;  3E20 B;  5LOV A;  3RA5 A;  1X52 A;  3CPQ A;  3D01 A;  3N2G B;  5IT9 M;  3NMU C;  3JAR A;  3HKC A;  4O2A A;  3RYI B;  1YHQ F;  3BYQ A;  3IR9 A;  1TUB B;  1X7P A;  2VXY A;  1H48 A;  2RHL A;  3WGN A;  1YJW F;  1QU9 A;  1FSZ A;  2IAF A;  3FFM A;  5LXT A;  3AGK A;  5A2Q M;  3I56 F;  4WBN A;  1FNJ A;  3IKE A;  2LCA A;  5KMG A;  4FFB A;  5HY0 A;  3HKE A;  2ZOD A;  4E6E A;  5JQG A;  3VYU C;  3D54 A;  4X1Y A;  1YJN F;  4C8E A;  5AVM A;  2DYY A;  1IV1 A;  3ELC A;  3IMP A;  5GIO C;  3G71 F;  3JAS A;  1YI2 F;  3OON A;  2I6R A;  3HKD A;  3KIZ A;  5C8Y B;  3CCS F;  2ZVZ A;  5GON B;  3WGK A;  1W5A A;  3LFO A;  1VQ8 F;  3LYB A;  4HNA B;  1VQP F;  2K1S A;  3WGL A;  4BT4 A;  5GAN K;  4I55 A;  3GTZ A;  3K12 A;  3ESJ A;  4X1K A;  5JCO A;  3CCL F;  5CA0 A;  3HKB B;  5EB1 B;  5LYJ A;  4ZHW A;  3VO8 A;  2BTO A;  2CW4 A;  5CA1 B;  4G4V A;  2HP0 B;  3U0O A;  1DBF A;  4O4L A;  2QEX F;  3LDT A;  1FFX B;  3VCZ A;  5FNV B;  3VOB A;  4G4W A;  1JJ2 F;  2UYJ A;  3RA6 A;  5CB4 A;  1S72 F;  1RQ7 A;  2H8E A;  4TV9 B;  2OTM A;  3L7Q A;  4KWE A;  1W59 A;  2RHJ A;  3GYQ A;  2VAM A;  1VQL F;  1Z5W A;  3CG6 A;  5LOV B;  2Z01 A;  5J2T A;  3I3F A;  4X3M A;  5LP6 C;  5JVD B;  3ZOP A;  1QVF F;  1RQ2 A;  3JAR B;  4O2A B;  2CVL A;  5GAP K;  3NK7 A;  1Q82 H;  5MN6 A;  2VGM A;  3C8L A;  2ZF8 A;  3JAL B;  2LBW A;  1Q86 H;  1VQ6 F;  2UYN A;  1W3E X;  5LXT B;  3QUW A;  1K9M H;  3P10 A;  1OAP A;  4WBN B;  2I6D A;  4DRX A;  1W41 A;  5KMG B;  2BTU A;  1GZ0 A;  3O85 A;  3UT5 B;  3HKE B;  4PWT A;  2FGY A;  2GZL A;  3FPI A;  3TD3 A;  1W5B A;  3E22 B;  4X1Y B;  3OBW A;  3G6E F; 
#chains in the Genus database with same CATH homology
 3PAF A;  3I55 F;  3CCJ F;  3CCR F;  1W40 A;  3LWQ C;  2GLZ A;  2LBX A;  5FJ4 C;  2OTJ F;  1PXW A;  5GIN C;  3JAM M;  3E20 B;  3LWP C;  1X7O A;  3RA5 A;  4C4W C;  1NMU B;  1X52 A;  3CPQ A;  4BVR A;  5IT9 M;  4NUT A;  3LWO C;  1VQ5 F;  3NMU C;  2AIF A;  3CPW F;  1YHQ F;  3IR9 A;  3CCQ F;  1X7P A;  2KG4 A;  1H7M A;  1YJW F;  4BVQ A;  3J80 M;  3FFM A;  1DT9 A;  3AGK A;  5A2Q M;  1W2B F;  3I56 F;  1Q81 H;  1M1K H;  2OTL F;  5EO3 A;  1YIT F;  3WXM B;  5HY0 A;  3HAX D;  4NQ3 A;  1YJN F;  5HWE A;  2JNB A;  1KQS F;  5GIO C;  3G71 F;  3J7A R;  1YI2 F;  1RLG A;  2OZB A;  3CXC F;  3NVK E;  3CCS F;  2HVY D;  3V7Q A;  3LFO A;  1VQ8 F;  1N8R H;  1K8A H;  3HJW C;  3V3T A;  1KD1 H;  3CCE F;  1YJ9 F;  4TZZ A;  5DCV A;  1CN7 A;  3JCM M;  1VQN F;  3CME F;  1VQP F;  2KTU A;  3OBY A;  5HXZ A;  2FC3 A;  5GIP C;  5GAN K;  1YIJ F;  4BY9 D;  3SIV A;  1K73 H;  1GO0 A;  3CC7 F;  1XBI A;  3CCL F;  4X3L A;  2ALE A;  2VGN A;  1M90 H;  1QVG F;  2CZW A;  4EI7 A;  5HY1 A;  3SIU A;  1SDS A;  1VQ7 F;  2BO1 A;  3ON1 A;  1Q7Y H;  2QEX F;  1NJI H;  3PLA C;  3CD6 F;  1JJ2 F;  1T0K B;  4BW0 B;  3D00 A;  1ZWZ A;  2F9Z C;  3MCA B;  3RA6 A;  1VQM F;  1S72 F;  3NK6 A;  1GO1 A;  1W42 A;  3LWV C;  4LCK A;  1VQ4 F;  2WAL A;  3GYQ A;  1VQK F;  1E7K A;  3N4Y A;  1VQL F;  3CG6 A;  4BVT A;  4X3M A;  1QVF F;  1RA4 A;  5GAP K;  3NK7 A;  3VI6 A;  1Q82 H;  5G4V C;  3J81 M;  3CCM F;  1VQO F;  3N4Z A;  2VGM A;  4EI8 A;  5HY2 A;  3CCU F;  2LBW A;  1Q86 H;  1VQ6 F;  1VQ9 F;  3VMF B;  3CC2 F;  1W3E X;  5G4U C;  5EWR A;  2KTV A;  1K9M H;  2QI2 A;  5FLX M;  2I6D A;  1W41 A;  1KC8 H;  1CK2 A;  3LWR C;  3OW2 F;  3CMA F;  3G4S F;  5HXU A;  1GZ0 A;  3O85 A;  3CCV F;  5HY4 A;  3NVI B;  2FGY A;  2QA4 F;  4EI9 A;  3V7E A;  4XCQ A;  2OHW A;  4BVS A;  3CC4 F;  1IPA A;  3E1Y A;  3OBW A;  3G6E F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...