1YJNF

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1yjnF00
3NVKE 1YJWF 5GINC 2KTUA 1KC8H 4LCKA 4X3LA 3CCEF 3VI6A 3LWOC 3G4SF 1K8AH 3CC7F 1NMUB 1VQOF 1K73H 3LWVC 3PAFA 3I55F 3MCAB 1KQSF 5A2QM 5GANK 2KG4A 3FFMA 5G4VC 3HAXD 3NMUC 3AGKA 3J7AR 1RA4A 5GIOC 2BO1A 1VQ8F 2VGNA 2FC3A 1YITF 2OZBA 1NJIH 1YJ9F 3V7QA 3NVIB 3CCJF 2LBWA 3CMEF 1ZWZA 1VQKF 3LFOA 3CCSF 1JJ2F 2AIFA 3CCQF 1VQ7F 2OHWA 1GO1A 1Q81H 3JAMM 3CPWF 1H7MA 1XBIA 1VQMF 1W42A 1Q7YH 1CK2A 1E7KA 3GYQA 1X7OA 3CC2F 1CN7A 3OBYA 3CCVF 1GO0A 2ALEA 3LWQC 3PLAC 5FLXM 3LWRC 1VQ6F 2LBXA 1GZ0A 1S72F 3CC4F 1VQ5F 2WALA 1M90H 4X3MA 5G4UC 3CD6F 4BW0B 3JCMM 2I6DA 1W40A 2HVYD 5EO3A 3CPQA 3J80M 5EWRA 2JNBA 3CXCF 1Q82H 1VQLF 4TZZA 1X52A 1K9MH 3RA5A 3SIUA 5IT9M 1QVFF 1IPAA 3VMFB 3N4ZA 2OTLF 1RLGA 1Q86H 3ON1A 3N4YA 3CCLF 3IR9A 2QEXF 4NUTA 5DCVA 1VQ4F 3CG6A 1QVGF 2VGMA 1YIJF 3WXMB 3I56F 3CCMF 2CZWA 1VQ9F 1SDSA 1DT9A 1YI2F 3HJWC 1W2BF 1M1KH 3V7EA 1KD1H 4BY9D 3CCUF 3LWPC 3CCRF 1VQNF 5GAPK 1W3EX 5FJ4C 2QI2A 3G6EF 3NK6A 3J81M 1W41A 3O85A 5GIPC 3SIVA 3E20B 1T0KB 1N8RH 3NK7A 3OW2F 1PXWA 1YHQF 2OTJF 3RA6A 4C4WC 2QA4F 3E1YA 1YJNF 3G71F 2KTVA 1VQPF 1X7PA 3CMAF 3OBWA
chains in the Genus database with same CATH superfamily
3NVKE 4BT6A 4F6RB 4YJ2A 1KC8H 4X3LA 3VI6A 5LOVB 3VTIC 2CHTA 3K14A 2ZODA 3JAKB 3LWVC 1TUBA 4BVQA 3CYPB 3MCAB 2VAWA 4WBNB 5JH7A 5A2QM 5GANK 2K1SA 3JALA 2KG4A 3FFMA 3HKDA 5LXTA 3VYTC 4BT7A 3J7AR 3F0DA 3P10A 1RA4A 5HP7A 4TV9B 4X1KB 2BO1A 2HRYA 1H48A 2OZBA 3U0OA 3GHZA 3NVIB 2LBWA 4EB6A 4HNAA 5BMVA 5IJ0A 2Z1FA 1FFXA 4YJ2B 5HWEA 1SA0B 1W59A 2AIFA 4I4TB 3CCQF 1KNKA 1VQ7F 1CK2A 4G4YA 3JASA 4M8IA 1TVKA 1X7OA 3QUWA 3OBYA 4I50B 3CCVF 1GO0A 2ZF8A 3LWQC 3PLAC 5FNVA 1XHOA 4TUYA 3HKDB 3ZO8A 4BT5A 5FLXM 1QU9A 4O2AA 1S72F 3CC4F 5HY1A 3B6NA 1M90H 1ONIA 3ESJA 4BW0B 1JFFA 3JCMM 2LBTA 4HNAB 3C9RA 3VYUC 5JCOA 2HVYD 1J7HA 2JNBA 3CXCF 1Q82H 5EZYB 2RHLA 3HKBB 1FNJA 1W5EA 4EI7A 4O4LB 2I6RA 1TVKB 2QTPA 4O4JB 4TV8B 1RLGA 1H47A 3ON1A 4O2AB 3N2KB 3IR9A 4ZHVA 4NUTA 5GONB 1VQ4F 3CG6A 4RHAA 1QVGF 3CCMF 2AIZP 2R6R1 3RE3A 3VCZA 5J2UB 3WGJA 3JARA 2YYEA 1KD1H 1KNJA 2VXYA 3IEWA 3KJJA 5KMGB 3CCRF 3WJQA 1PF5A 3MQWA 4IIJB 1W55A 1VQVA 3VYSC 3NK6A 5C8YA 4DXDA 5IJ9B 5GIPC 3SIVA 5KX5A 1PXWA 3M1XA 5EYPB 2OTJF 4G4WA 2QA4F 2Z01A 4XCQA 3WJRA 3CMAF 5LYJB 3FBAA 4ZHQB 5GINC 4LCKA 3CCEF 4G4VA 2CVLA 4X1YB 1NMUB 1K73H 3N2GA 3PAFA 2BTOA 4O4HA 2DT4A 4YJ3B 1Q8RA 3I55F 3CB2A 2Q1YA 3C8LA 3VIUA 5C8YB 5LP6C 3HAXD 5EB1B 5ITZB 5G4VC 4LNUB 3NMUC 1Z5WA 4X20A 5J2TA 2Z1EA 1VQ8F 5LA6B 3RYHA 2HX0A 5CA1A 1YJ9F 1ODEA 3CCJF 3VOBA 3CMEF 1ZWZA 1VQKF 2PMPA 3D54A 1RLUA 3ERNA 3HKEB 4B62A 2OHWA 1Q81H 1RQ2A 3I3FA 3JAMM 1H7MA 1R1MA 1XBIA 4ZK7A 4O2BA 1VQMF 4O4HB 4G4XA 3ZP7A 3CC2F 1CN7A 3TD5A 2ALEA 2RB9A 2HP0A 2HS0A 4X20B 4C8EA 4ZOLB 2AMTA 5J2TB 3FPIA 5MN6A 4B45A 3S0YA 1FSZA 3VO8A 5CA1B 2FGYA 5B8FA 2CWJA 4BT2A 3WPWA 2N48A 4NQ3A 4X1IA 4FFBA 1QAHA 3TD3A 5EO3A 1IV3A 2V9YA 5HXZA 3ZP4A 2VAMA 4C81A 3LDTA 3S06A 1K9MH 2VAPA 2Z1TA 1IPAA 1OFUA 1TUBB 1OAPA 4ZHYB 5JH7B 1DBFA 3VOAA 2B33A 3JALB 5LXTB 3E22A 3L7QA 1W5FA 3N4YA 2QEXF 1JY8A 2BTQB 3JAWA 2HS3A 3RYCA 4E6EA 3WXMB 1U3LA 3UT5A 4X1IB 2CZWA 4EB6B 5BMVB 5IJ0B 2CSLA 3R0PA 1FFXB 1YI2F 1M1KH 1X25A 5EIBC 3TD4A 4B5CA 2H6LA 5CA0A 2UYPA 1W581 1FNKA 3JASB 3MDOA 3RYFA 1W41A 5FNVB 4TUYB 1U40A 1T0KB 3HWUA 3NK7A 1YHQF 3I7TA 3QTYA 2ZAUA 3E1YA 4C8GA 1RQ7A 3G71F 2KTVA 1VQPF 1X7PA 1JFFB 5JVDA 2YXZA 2HS4A 2KTUA 5LP6A 4EI8A 2HRUA 3LWOC 2Z1UA 3K12A 1K8AH 4B46A 1VQOF 2LCAA 3MCQA 2UYNA 2UZHA 1U43A 2IG8A 4IHJA 1UI9A 3HKCA 1VHAA 3S0HA 2VGNA 4I55A 2FC3A 5JQGA 1YITF 2KGWA 1VH8A 3IEQA 2HQSC 1IV1A 3GTZA 3QHDA 3S0WA 3WPXA 5EAZA 5LP6B 1JD1A 3CCSF 5IYZA 3JARB 1GO1A 3JATA 4ZHWA 3KIZA 2BTUA 1Q7YH 1IV2A 1YGYA 3GYQA 4ZI7A 3RYIA 3WGLA 3KHNA 5MN4A 1JN1A 4BVTA 3LWRC 4DRXA 4G88A 5KX5B 2LBXA 1GZ0A 3DC2A 1VQ5F 4I55B 4X3MA 5G4UC 3K2XA 3CD6F 3KE1A 4F6RA 2I6DA 1W40A 2RHOA 4G4ZA 5LOVA 3J80M 5EWRA 2HP3A 3JATB 3JAKA 3C9UA 1VQLF 4TZZA 3FD5A 3KJKA 5HXUA 3N2GB 1QVFF 3VMFB 3RYIB 5HY2A 1UFYA 3HTNA 2OTLF 1Q86H 4O4IA 5EIBD 2H8EA 4TV9A 3ELCA 3CCLF 1NQ3A 3BYQA 3LYBA 3WGMA 3RYHB 5HY0A 3I56F 1VQ9F 3ZOPA 3EORA 3CYQA 1SA0A 3T80A 4I4TA 3LMEA 3V7EA 4BY9D 3S02A 1VQNF 5GAPK 1COMA 3F0GA 1W3EX 4O2BB 4I50A 5FJ4C 2QI2A 3G6EF 4R40B 2GZLA 3C9TA 3F0FA 3J81M 4C82A 4O4IB 2HP0B 3OW2F 2ZOVA 3M4SA 4BVSA 3WGNA 4NWOB 2UYKA 3D01A 5HY4A 3K0TA 1Z5VA 3OBWA 1YJWF 2F9ZC 4U39A 4FFBB 3DDNA 4RQOA 2R751 2RHHA 5EZYA 2ZVZA 3HKBA 3G4SF 4BVRA 3IMPA 4O4LA 3CC7F 4O4JA 2GLZA 4TV8A 1KQSF 2Q1XA 3V3TA 2EWCA 4C8IA 2CW4A 2G9IA 3AGKA 3JVHA 3N2KA 3M84A 3E22B 5HP8A 5GONA 5GIOC 3F0EA 3OONA 5MN5A 1SZQA 3JAWB 1NJIH 1QD9A 5CB4A 3V7QA 2IQQA 3RYCB 1T0AA 4U3JA 3LFOA 3UT5B 3S03A 5J2UA 2W8BC 1W5AA 1JJ2F 5KMGA 3CPWF 3P0ZA 5CA0B 4IIJA 1W42A 1E7KA 2P6YA 3RYFB 1VK3A 3FD6A 4BT3A 5IJ9A 1VQ6F 2GVIA 4BT4A 5EYPA 1W57A 2WALA 2MQEA 2L26A 4KWEA 3IKFA 5LYJA 5CB4B 4ZHQA 3F6MA 5JVDB 4U3JB 1XRGA 3C9SA 3CPQA 4X1YA 1CLIA 1XV2A 2RHJA 3MBMA 3Q8HA 4YJ3A 1X52A 3RA5A 3SIUA 5IT9M 4ERHA 2OTMA 3WJPA 5JCOC 3P4EA 2UYNB 3N4ZA 5ITZA 4LNUA 4EI9A 4IHJB 2H8CA 5EB0A 1IV4A 1YQNA 3HKCB 4PWTA 5LA6A 2IAFA 5DCVA 3WGKA 3IKEA 5JQGB 2VGMA 1YIJF 2NMUA 1SDSA 1DT9A 3HJWC 1W2BF 3HKEA 3V4DA 1U3PA 5IYZB 3CCUF 2ZVYA 3D00A 3LWPC 1W5BA 2PHNA 4WBNA 1GX1A 5AVMA 4ZI7B 3O85A 3E20B 4DRXB 4ZOLA 2CHSA 1N8RH 2DYYA 4X1KA 3RA6A 4C4WC 1YJNF 2UYJA
chains in the Genus database with same CATH topology
3NVKE 1YJWF 2F9ZC 5GINC 2KTUA 1KC8H 4LCKA 4X3LA 3CCEF 3VI6A 4EI8A 3LWOC 3G4SF 4BVRA 1K8AH 3CC7F 1NMUB 1VQOF 1K73H 3LWVC 3PAFA 3I55F 4BVQA 3MCAB 2GLZA 1KQSF 5A2QM 5GANK 3V3TA 2KG4A 3FFMA 5G4VC 3HAXD 3NMUC 3AGKA 3J7AR 1RA4A 5GIOC 2BO1A 1VQ8F 2VGNA 2FC3A 1YITF 2OZBA 1NJIH 1YJ9F 3V7QA 3NVIB 3CCJF 2LBWA 3CMEF 1ZWZA 1VQKF 3LFOA 5HWEA 3CCSF 1JJ2F 2AIFA 3CCQF 1VQ7F 2OHWA 1GO1A 1Q81H 3JAMM 3CPWF 1H7MA 1XBIA 1VQMF 1W42A 1Q7YH 1CK2A 1E7KA 3GYQA 1X7OA 3CC2F 1CN7A 3OBYA 3CCVF 1GO0A 2ALEA 3LWQC 3PLAC 5FLXM 4BVTA 3LWRC 1VQ6F 2LBXA 1GZ0A 1S72F 3CC4F 5HY1A 1VQ5F 2WALA 1M90H 4X3MA 2FGYA 3CD6F 5G4UC 4BW0B 3JCMM 4NQ3A 2I6DA 1W40A 2HVYD 5EO3A 3CPQA 5HXZA 3J80M 5EWRA 2JNBA 3CXCF 1Q82H 4EI7A 1VQLF 4TZZA 1X52A 5HXUA 3RA5A 1K9MH 3SIUA 5IT9M 1QVFF 1IPAA 3VMFB 5HY2A 3N4ZA 2OTLF 1RLGA 1Q86H 4EI9A 3ON1A 3N4YA 3CCLF 3IR9A 2QEXF 4NUTA 5DCVA 1VQ4F 3CG6A 1QVGF 2VGMA 1YIJF 3WXMB 5HY0A 3I56F 3CCMF 2CZWA 1VQ9F 1SDSA 1DT9A 1YI2F 3HJWC 1W2BF 1M1KH 3V7EA 1KD1H 4BY9D 3CCUF 3D00A 3LWPC 3CCRF 1VQNF 5GAPK 1W3EX 5FJ4C 2QI2A 3G6EF 3NK6A 3J81M 1W41A 3O85A 5GIPC 3SIVA 3E20B 1T0KB 1N8RH 3NK7A 3OW2F 1PXWA 1YHQF 4BVSA 2OTJF 3RA6A 4C4WC 2QA4F 3E1YA 1YJNF 4XCQA 5HY4A 3G71F 2KTVA 1VQPF 1X7PA 3CMAF 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVK E;  1YJW F;  5GIN C;  2KTU A;  1KC8 H;  4LCK A;  4X3L A;  3CCE F;  3VI6 A;  3LWO C;  3G4S F;  1K8A H;  3CC7 F;  1NMU B;  1VQO F;  1K73 H;  3LWV C;  3PAF A;  3I55 F;  3MCA B;  1KQS F;  5A2Q M;  5GAN K;  2KG4 A;  3FFM A;  5G4V C;  3HAX D;  3NMU C;  3AGK A;  3J7A R;  1RA4 A;  5GIO C;  2BO1 A;  1VQ8 F;  2VGN A;  2FC3 A;  1YIT F;  2OZB A;  1NJI H;  1YJ9 F;  3V7Q A;  3NVI B;  3CCJ F;  2LBW A;  3CME F;  1ZWZ A;  1VQK F;  3LFO A;  3CCS F;  1JJ2 F;  2AIF A;  3CCQ F;  1VQ7 F;  2OHW A;  1GO1 A;  1Q81 H;  3JAM M;  3CPW F;  1H7M A;  1XBI A;  1VQM F;  1W42 A;  1Q7Y H;  1CK2 A;  1E7K A;  3GYQ A;  1X7O A;  3CC2 F;  1CN7 A;  3OBY A;  3CCV F;  1GO0 A;  2ALE A;  3LWQ C;  3PLA C;  5FLX M;  3LWR C;  1VQ6 F;  2LBX A;  1GZ0 A;  1S72 F;  3CC4 F;  1VQ5 F;  2WAL A;  1M90 H;  4X3M A;  5G4U C;  3CD6 F;  4BW0 B;  3JCM M;  2I6D A;  1W40 A;  2HVY D;  5EO3 A;  3CPQ A;  3J80 M;  5EWR A;  2JNB A;  3CXC F;  1Q82 H;  1VQL F;  4TZZ A;  1X52 A;  1K9M H;  3RA5 A;  3SIU A;  5IT9 M;  1QVF F;  1IPA A;  3VMF B;  3N4Z A;  2OTL F;  1RLG A;  1Q86 H;  3ON1 A;  3N4Y A;  3CCL F;  3IR9 A;  2QEX F;  4NUT A;  5DCV A;  1VQ4 F;  3CG6 A;  1QVG F;  2VGM A;  1YIJ F;  3WXM B;  3I56 F;  3CCM F;  2CZW A;  1VQ9 F;  1SDS A;  1DT9 A;  1YI2 F;  3HJW C;  1W2B F;  1M1K H;  3V7E A;  1KD1 H;  4BY9 D;  3CCU F;  3LWP C;  3CCR F;  1VQN F;  5GAP K;  1W3E X;  5FJ4 C;  2QI2 A;  3G6E F;  3NK6 A;  3J81 M;  1W41 A;  3O85 A;  5GIP C;  3SIV A;  3E20 B;  1T0K B;  1N8R H;  3NK7 A;  3OW2 F;  1PXW A;  1YHQ F;  2OTJ F;  3RA6 A;  4C4W C;  2QA4 F;  3E1Y A;  1YJN F;  3G71 F;  2KTV A;  1VQP F;  1X7P A;  3CMA F;  3OBW A; 
#chains in the Genus database with same CATH topology
 3NVK E;  4BT6 A;  4F6R B;  4YJ2 A;  1KC8 H;  4X3L A;  3VI6 A;  5LOV B;  3VTI C;  2CHT A;  3K14 A;  2ZOD A;  3JAK B;  3LWV C;  1TUB A;  4BVQ A;  3CYP B;  3MCA B;  2VAW A;  4WBN B;  5JH7 A;  5A2Q M;  5GAN K;  2K1S A;  3JAL A;  2KG4 A;  3FFM A;  3HKD A;  5LXT A;  3VYT C;  4BT7 A;  3J7A R;  3F0D A;  3P10 A;  1RA4 A;  5HP7 A;  4TV9 B;  4X1K B;  2BO1 A;  2HRY A;  1H48 A;  2OZB A;  3U0O A;  3GHZ A;  3NVI B;  2LBW A;  4EB6 A;  4HNA A;  5BMV A;  5IJ0 A;  2Z1F A;  1FFX A;  4YJ2 B;  5HWE A;  1SA0 B;  1W59 A;  2AIF A;  4I4T B;  3CCQ F;  1KNK A;  1VQ7 F;  1CK2 A;  4G4Y A;  3JAS A;  4M8I A;  1TVK A;  1X7O A;  3QUW A;  3OBY A;  4I50 B;  3CCV F;  1GO0 A;  2ZF8 A;  3LWQ C;  3PLA C;  5FNV A;  1XHO A;  4TUY A;  3HKD B;  3ZO8 A;  4BT5 A;  5FLX M;  1QU9 A;  4O2A A;  1S72 F;  3CC4 F;  5HY1 A;  3B6N A;  1M90 H;  1ONI A;  3ESJ A;  4BW0 B;  1JFF A;  3JCM M;  2LBT A;  4HNA B;  3C9R A;  3VYU C;  5JCO A;  2HVY D;  1J7H A;  2JNB A;  3CXC F;  1Q82 H;  5EZY B;  2RHL A;  3HKB B;  1FNJ A;  1W5E A;  4EI7 A;  4O4L B;  2I6R A;  1TVK B;  2QTP A;  4O4J B;  4TV8 B;  1RLG A;  1H47 A;  3ON1 A;  4O2A B;  3N2K B;  3IR9 A;  4ZHV A;  4NUT A;  5GON B;  1VQ4 F;  3CG6 A;  4RHA A;  1QVG F;  3CCM F;  2AIZ P;  2R6R 1;  3RE3 A;  3VCZ A;  5J2U B;  3WGJ A;  3JAR A;  2YYE A;  1KD1 H;  1KNJ A;  2VXY A;  3IEW A;  3KJJ A;  5KMG B;  3CCR F;  3WJQ A;  1PF5 A;  3MQW A;  4IIJ B;  1W55 A;  1VQV A;  3VYS C;  3NK6 A;  5C8Y A;  4DXD A;  5IJ9 B;  5GIP C;  3SIV A;  5KX5 A;  1PXW A;  3M1X A;  5EYP B;  2OTJ F;  4G4W A;  2QA4 F;  2Z01 A;  4XCQ A;  3WJR A;  3CMA F;  5LYJ B;  3FBA A;  4ZHQ B;  5GIN C;  4LCK A;  3CCE F;  4G4V A;  2CVL A;  4X1Y B;  1NMU B;  1K73 H;  3N2G A;  3PAF A;  2BTO A;  4O4H A;  2DT4 A;  4YJ3 B;  1Q8R A;  3I55 F;  3CB2 A;  2Q1Y A;  3C8L A;  3VIU A;  5C8Y B;  5LP6 C;  3HAX D;  5EB1 B;  5ITZ B;  5G4V C;  4LNU B;  3NMU C;  1Z5W A;  4X20 A;  5J2T A;  2Z1E A;  1VQ8 F;  5LA6 B;  3RYH A;  2HX0 A;  5CA1 A;  1YJ9 F;  1ODE A;  3CCJ F;  3VOB A;  3CME F;  1ZWZ A;  1VQK F;  2PMP A;  3D54 A;  1RLU A;  3ERN A;  3HKE B;  4B62 A;  2OHW A;  1Q81 H;  1RQ2 A;  3I3F A;  3JAM M;  1H7M A;  1R1M A;  1XBI A;  4ZK7 A;  4O2B A;  1VQM F;  4O4H B;  4G4X A;  3ZP7 A;  3CC2 F;  1CN7 A;  3TD5 A;  2ALE A;  2RB9 A;  2HP0 A;  2HS0 A;  4X20 B;  4C8E A;  4ZOL B;  2AMT A;  5J2T B;  3FPI A;  5MN6 A;  4B45 A;  3S0Y A;  1FSZ A;  3VO8 A;  5CA1 B;  2FGY A;  5B8F A;  2CWJ A;  4BT2 A;  3WPW A;  2N48 A;  4NQ3 A;  4X1I A;  4FFB A;  1QAH A;  3TD3 A;  5EO3 A;  1IV3 A;  2V9Y A;  5HXZ A;  3ZP4 A;  2VAM A;  4C81 A;  3LDT A;  3S06 A;  1K9M H;  2VAP A;  2Z1T A;  1IPA A;  1OFU A;  1TUB B;  1OAP A;  4ZHY B;  5JH7 B;  1DBF A;  3VOA A;  2B33 A;  3JAL B;  5LXT B;  3E22 A;  3L7Q A;  1W5F A;  3N4Y A;  2QEX F;  1JY8 A;  2BTQ B;  3JAW A;  2HS3 A;  3RYC A;  4E6E A;  3WXM B;  1U3L A;  3UT5 A;  4X1I B;  2CZW A;  4EB6 B;  5BMV B;  5IJ0 B;  2CSL A;  3R0P A;  1FFX B;  1YI2 F;  1M1K H;  1X25 A;  5EIB C;  3TD4 A;  4B5C A;  2H6L A;  5CA0 A;  2UYP A;  1W58 1;  1FNK A;  3JAS B;  3MDO A;  3RYF A;  1W41 A;  5FNV B;  4TUY B;  1U40 A;  1T0K B;  3HWU A;  3NK7 A;  1YHQ F;  3I7T A;  3QTY A;  2ZAU A;  3E1Y A;  4C8G A;  1RQ7 A;  3G71 F;  2KTV A;  1VQP F;  1X7P A;  1JFF B;  5JVD A;  2YXZ A;  2HS4 A;  2KTU A;  5LP6 A;  4EI8 A;  2HRU A;  3LWO C;  2Z1U A;  3K12 A;  1K8A H;  4B46 A;  1VQO F;  2LCA A;  3MCQ A;  2UYN A;  2UZH A;  1U43 A;  2IG8 A;  4IHJ A;  1UI9 A;  3HKC A;  1VHA A;  3S0H A;  2VGN A;  4I55 A;  2FC3 A;  5JQG A;  1YIT F;  2KGW A;  1VH8 A;  3IEQ A;  2HQS C;  1IV1 A;  3GTZ A;  3QHD A;  3S0W A;  3WPX A;  5EAZ A;  5LP6 B;  1JD1 A;  3CCS F;  5IYZ A;  3JAR B;  1GO1 A;  3JAT A;  4ZHW A;  3KIZ A;  2BTU A;  1Q7Y H;  1IV2 A;  1YGY A;  3GYQ A;  4ZI7 A;  3RYI A;  3WGL A;  3KHN A;  5MN4 A;  1JN1 A;  4BVT A;  3LWR C;  4DRX A;  4G88 A;  5KX5 B;  2LBX A;  1GZ0 A;  3DC2 A;  1VQ5 F;  4I55 B;  4X3M A;  5G4U C;  3K2X A;  3CD6 F;  3KE1 A;  4F6R A;  2I6D A;  1W40 A;  2RHO A;  4G4Z A;  5LOV A;  3J80 M;  5EWR A;  2HP3 A;  3JAT B;  3JAK A;  3C9U A;  1VQL F;  4TZZ A;  3FD5 A;  3KJK A;  5HXU A;  3N2G B;  1QVF F;  3VMF B;  3RYI B;  5HY2 A;  1UFY A;  3HTN A;  2OTL F;  1Q86 H;  4O4I A;  5EIB D;  2H8E A;  4TV9 A;  3ELC A;  3CCL F;  1NQ3 A;  3BYQ A;  3LYB A;  3WGM A;  3RYH B;  5HY0 A;  3I56 F;  1VQ9 F;  3ZOP A;  3EOR A;  3CYQ A;  1SA0 A;  3T80 A;  4I4T A;  3LME A;  3V7E A;  4BY9 D;  3S02 A;  1VQN F;  5GAP K;  1COM A;  3F0G A;  1W3E X;  4O2B B;  4I50 A;  5FJ4 C;  2QI2 A;  3G6E F;  4R40 B;  2GZL A;  3C9T A;  3F0F A;  3J81 M;  4C82 A;  4O4I B;  2HP0 B;  3OW2 F;  2ZOV A;  3M4S A;  4BVS A;  3WGN A;  4NWO B;  2UYK A;  3D01 A;  5HY4 A;  3K0T A;  1Z5V A;  3OBW A;  1YJW F;  2F9Z C;  4U39 A;  4FFB B;  3DDN A;  4RQO A;  2R75 1;  2RHH A;  5EZY A;  2ZVZ A;  3HKB A;  3G4S F;  4BVR A;  3IMP A;  4O4L A;  3CC7 F;  4O4J A;  2GLZ A;  4TV8 A;  1KQS F;  2Q1X A;  3V3T A;  2EWC A;  4C8I A;  2CW4 A;  2G9I A;  3AGK A;  3JVH A;  3N2K A;  3M84 A;  3E22 B;  5HP8 A;  5GON A;  5GIO C;  3F0E A;  3OON A;  5MN5 A;  1SZQ A;  3JAW B;  1NJI H;  1QD9 A;  5CB4 A;  3V7Q A;  2IQQ A;  3RYC B;  1T0A A;  4U3J A;  3LFO A;  3UT5 B;  3S03 A;  5J2U A;  2W8B C;  1W5A A;  1JJ2 F;  5KMG A;  3CPW F;  3P0Z A;  5CA0 B;  4IIJ A;  1W42 A;  1E7K A;  2P6Y A;  3RYF B;  1VK3 A;  3FD6 A;  4BT3 A;  5IJ9 A;  1VQ6 F;  2GVI A;  4BT4 A;  5EYP A;  1W57 A;  2WAL A;  2MQE A;  2L26 A;  4KWE A;  3IKF A;  5LYJ A;  5CB4 B;  4ZHQ A;  3F6M A;  5JVD B;  4U3J B;  1XRG A;  3C9S A;  3CPQ A;  4X1Y A;  1CLI A;  1XV2 A;  2RHJ A;  3MBM A;  3Q8H A;  4YJ3 A;  1X52 A;  3RA5 A;  3SIU A;  5IT9 M;  4ERH A;  2OTM A;  3WJP A;  5JCO C;  3P4E A;  2UYN B;  3N4Z A;  5ITZ A;  4LNU A;  4EI9 A;  4IHJ B;  2H8C A;  5EB0 A;  1IV4 A;  1YQN A;  3HKC B;  4PWT A;  5LA6 A;  2IAF A;  5DCV A;  3WGK A;  3IKE A;  5JQG B;  2VGM A;  1YIJ F;  2NMU A;  1SDS A;  1DT9 A;  3HJW C;  1W2B F;  3HKE A;  3V4D A;  1U3P A;  5IYZ B;  3CCU F;  2ZVY A;  3D00 A;  3LWP C;  1W5B A;  2PHN A;  4WBN A;  1GX1 A;  5AVM A;  4ZI7 B;  3O85 A;  3E20 B;  4DRX B;  4ZOL A;  2CHS A;  1N8R H;  2DYY A;  4X1K A;  3RA6 A;  4C4W C;  1YJN F;  2UYJ A; 
#chains in the Genus database with same CATH homology
 3NVK E;  1YJW F;  2F9Z C;  5GIN C;  2KTU A;  1KC8 H;  4LCK A;  4X3L A;  3CCE F;  3VI6 A;  4EI8 A;  3LWO C;  3G4S F;  4BVR A;  1K8A H;  3CC7 F;  1NMU B;  1VQO F;  1K73 H;  3LWV C;  3PAF A;  3I55 F;  4BVQ A;  3MCA B;  2GLZ A;  1KQS F;  5A2Q M;  5GAN K;  3V3T A;  2KG4 A;  3FFM A;  5G4V C;  3HAX D;  3NMU C;  3AGK A;  3J7A R;  1RA4 A;  5GIO C;  2BO1 A;  1VQ8 F;  2VGN A;  2FC3 A;  1YIT F;  2OZB A;  1NJI H;  1YJ9 F;  3V7Q A;  3NVI B;  3CCJ F;  2LBW A;  3CME F;  1ZWZ A;  1VQK F;  3LFO A;  5HWE A;  3CCS F;  1JJ2 F;  2AIF A;  3CCQ F;  1VQ7 F;  2OHW A;  1GO1 A;  1Q81 H;  3JAM M;  3CPW F;  1H7M A;  1XBI A;  1VQM F;  1W42 A;  1Q7Y H;  1CK2 A;  1E7K A;  3GYQ A;  1X7O A;  3CC2 F;  1CN7 A;  3OBY A;  3CCV F;  1GO0 A;  2ALE A;  3LWQ C;  3PLA C;  5FLX M;  4BVT A;  3LWR C;  1VQ6 F;  2LBX A;  1GZ0 A;  1S72 F;  3CC4 F;  5HY1 A;  1VQ5 F;  2WAL A;  1M90 H;  4X3M A;  2FGY A;  3CD6 F;  5G4U C;  4BW0 B;  3JCM M;  4NQ3 A;  2I6D A;  1W40 A;  2HVY D;  5EO3 A;  3CPQ A;  5HXZ A;  3J80 M;  5EWR A;  2JNB A;  3CXC F;  1Q82 H;  4EI7 A;  1VQL F;  4TZZ A;  1X52 A;  5HXU A;  3RA5 A;  1K9M H;  3SIU A;  5IT9 M;  1QVF F;  1IPA A;  3VMF B;  5HY2 A;  3N4Z A;  2OTL F;  1RLG A;  1Q86 H;  4EI9 A;  3ON1 A;  3N4Y A;  3CCL F;  3IR9 A;  2QEX F;  4NUT A;  5DCV A;  1VQ4 F;  3CG6 A;  1QVG F;  2VGM A;  1YIJ F;  3WXM B;  5HY0 A;  3I56 F;  3CCM F;  2CZW A;  1VQ9 F;  1SDS A;  1DT9 A;  1YI2 F;  3HJW C;  1W2B F;  1M1K H;  3V7E A;  1KD1 H;  4BY9 D;  3CCU F;  3D00 A;  3LWP C;  3CCR F;  1VQN F;  5GAP K;  1W3E X;  5FJ4 C;  2QI2 A;  3G6E F;  3NK6 A;  3J81 M;  1W41 A;  3O85 A;  5GIP C;  3SIV A;  3E20 B;  1T0K B;  1N8R H;  3NK7 A;  3OW2 F;  1PXW A;  1YHQ F;  4BVS A;  2OTJ F;  3RA6 A;  4C4W C;  2QA4 F;  3E1Y A;  1YJN F;  4XCQ A;  5HY4 A;  3G71 F;  2KTV A;  1VQP F;  1X7P A;  3CMA F;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...