5GINC

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
molecule tags Transferase/rna
source organism Sulfolobus solfataricus
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ginC00
3CPQA 1W40A 3LWRC 3E1YA 3LWPC 3CCEF 2OHWA 3J81M 3E20B 3CCVF 1XBIA 3MCAB 3LFOA 1YIJF 2QEXF 5EO3A 1E7KA 5DCVA 3OW2F 3CMEF 3CD6F 2QI2A 3I55F 2HVYD 2OTLF 1X7OA 1VQ8F 5GIOC 2CZWA 3CC2F 1W2BF 5GANK 1DT9A 2I6DA 4BY9D 3CCJF 1KC8H 1K9MH 5EWRA 3OBWA 1S72F 1VQOF 1K73H 3CCRF 1W3EX 1QVGF 1VQKF 3CCMF 1K8AH 1YJWF 4X3MA 2BO1A 1VQ9F 3AGKA 3FFMA 1Q82H 1Q7YH 1IPAA 2JNBA 3G71F 1VQ7F 1CN7A 3ON1A 3N4YA 5GINC 3J7AR 3CG6A 3RA6A 4TZZA 5A2QM 3J80M 4LCKA 1T0KB 3RA5A 5FLXM 3CC4F 3JCMM 3WXMB 2WALA 3LWOC 2LBWA 1JJ2F 2VGNA 3NVIB 1ZWZA 1YI2F 1KD1H 5GIPC 1YJ9F 3VI6A 3PAFA 3CCLF 1Q81H 3NK6A 4C4WC 3CC7F 1CK2A 1VQPF 2KTVA 3G6EF 3LWVC 1X7PA 5GAPK 1VQ4F 1VQ6F 1YHQF 3CPWF 3O85A 1GO1A 3HAXD 3NVKE 1M1KH 2OZBA 2AIFA 3NMUC 3CCQF 3CMAF 1GO0A 3OBYA 1GZ0A 5FJ4C 3I56F 3CCUF 2LBXA 3VMFB 2QA4F 2KTUA 1VQMF 3G4SF 1Q86H 3JAMM 1RLGA 3CCSF 1VQNF 2VGMA 3V7QA 3CXCF 3HJWC 1X52A 4BW0B 3SIVA 4X3LA 2KG4A 1VQ5F 2FC3A 3PLAC 3SIUA 1M90H 2OTJF 1W41A 1SDSA 1YITF 1H7MA 1NJIH 1YJNF 1PXWA 3V7EA 3GYQA 2ALEA 4NUTA 1QVFF 1RA4A 1KQSF 3NK7A 1NMUB 3IR9A 1W42A 3LWQC 3N4ZA 5G4VC 5IT9M 5G4UC 1VQLF 1N8RH
chains in the Genus database with same CATH superfamily
4RHAA 4BT6A 3EORA 1W40A 3IEWA 3JARB 3LWRC 5HY1A 4F6RA 1UFYA 1TUBA 3LWPC 2HX0A 3C9RA 4F6RB 2HRYA 3HKBB 1GX1A 1XBIA 4BVRA 2ZOVA 1YIJF 2HS3A 4O4JB 5EO3A 3RYCA 2RHOA 3I55F 2LBTA 3P10A 5IJ0B 2CZWA 3HKDA 4O4IA 1DT9A 3Q8HA 2NMUA 5CA1A 1K73H 3IMPA 1W3EX 1JFFB 5IYZA 3KHNA 3CCMF 4LNUA 3S06A 3MCQA 5IJ9A 3N2KA 4X3MA 4C8EA 5IJ0A 1QAHA 3VOAA 5LXTB 5ITZA 2LCAA 4IIJA 3B6NA 4ZOLB 1VQ7F 5GINC 3QHDA 3N2GB 4TV9B 3RA6A 4YJ3A 5EIBC 1T0KB 3QUWA 5EAZA 4YJ3B 3F0EA 3C9UA 4FFBB 3F6MA 4HNAA 2WALA 1W5BA 2VXYA 2EWCA 4X1YA 5CB4A 1YI2F 1KD1H 5GIPC 2MQEA 5LOVB 3CYPB 2RHJA 3CCLF 3JAKB 4G4YA 1OFUA 4O2BB 3GTZA 1H47A 2BTOA 1VQLF 3JAKA 3S0YA 2DT4A 5EYPA 1U40A 2HP0A 3LDTA 5GAPK 1VQ6F 1GO1A 3HAXD 4YJ2B 3NVKE 5KX5A 3RYHB 4BT5A 3CCQF 4DRXA 4G4ZA 3WJRA 2UYJA 1W57A 3I56F 1COMA 3CCUF 2KTUA 3G4SF 1U3LA 3UT5B 1VK3A 4BVQA 3JAMM 1RLGA 3CCSF 1NQ3A 4O4IB 5CA0A 3JAWA 3S03A 5BMVA 1Z5WA 5MN5A 3HJWC 4BW0B 4ZHQB 1VQ5F 4I55A 5KMGB 3V3TA 1NJIH 1PXWA 4EI8A 2RHLA 2BTQB 3T80A 3NK7A 3WGLA 1XV2A 3S0WA 3LWQC 4BVTA 1TVKB 5B8FA 4G4XA 2R751 3K2XA 3VO8A 1N8RH 3C9TA 4TV9A 5LA6B 5HWEA 2KGWA 2DYYA 1X25A 3F0FA 2Z01A 3CCEF 3HTNA 3P4EA 5IYZB 4U39A 1J7HA 5JCOA 5DCVA 3MDOA 3CD6F 2QI2A 2VAWA 5J2UB 5GIOC 2YYEA 1PF5A 5JQGA 3KE1A 5EYPB 3ZO8A 3ZP4A 1R1MA 4B5CA 4O2AB 5FNVA 2UZHA 3OBWA 1VQOF 1QVGF 1VQKF 2QTPA 5HY0A 1YJWF 4O4LB 3LYBA 2BO1A 4X1KA 3FFMA 1VQ9F 4G4WA 5EB1B 2K1SA 5JVDA 3FBAA 3TD4A 2V9YA 3V4DA 3WGMA 3BYQA 2ZF8A 3J7AR 3JARA 4TZZA 5A2QM 2YXZA 3RA5A 5FLXM 5LYJA 3MBMA 3WXMB 3LWOC 2LBWA 3NVIB 2F9ZC 3RYFB 4I50B 5HXZA 1YJ9F 3UT5A 4WBNB 3FPIA 2HQSC 3RYCB 4EB6B 5CA0B 3JATB 3JAWB 1IV3A 4X20A 4C81A 2CW4A 4NQ3A 1CK2A 3R0PA 3G6EF 3CYQA 3HKCA 3IEQA 3O85A 4KWEA 2IG8A 1U3PA 2I6RA 3D00A 3NMUC 1JFFA 3CMAF 3LMEA 2P6YA 4EB6A 4BT7A 1TVKA 2QA4F 1Q86H 4O2AA 3V7QA 4U3JB 4C8GA 1X52A 3PLAC 3SIUA 2OTJF 5EIBD 5JH7A 2HS0A 4TV8B 2ZAUA 2Q1YA 3VCZA 1SDSA 3WGKA 5C8YA 1H7MA 3U0OA 1XRGA 2RB9A 5C8YB 1JY8A 3TD3A 1NMUB 1FSZA 2RHHA 4EI7A 2BTUA 2CWJA 3ELCA 3RE3A 3VTIC 5HP7A 5LP6A 3P0ZA 4O2BA 4I4TB 3JALB 5GONB 3CPQA 5LP6B 3FD5A 1FFXB 2HP0B 3E1YA 5LYJB 2ZVYA 3WJQA 2OHWA 4PWTA 3E20B 4C82A 2CVLA 5KX5B 3MCAB 3JVHA 5CA1B 4O4HB 1CLIA 2QEXF 5LP6C 5MN6A 1E7KA 4O4HA 3KJKA 5JVDB 1W5AA 4O4JA 4B46A 3ZP7A 1VQ8F 2UYNA 4IHJA 2H6LA 2CHSA 5HY2A 3OONA 3QTYA 3WPXA 2G9IA 3JASA 4BY9D 4IIJB 4C8IA 3FD6A 4E6EA 1W55A 3ESJA 5LA6A 1K9MH 5EWRA 3HKBA 2H8EA 1S72F 2HP3A 4ZK7A 1IV1A 2Z1TA 1K8AH 1Q8RA 4WBNA 1Q82H 5LXTA 4LNUB 2UYNB 3JATA 3ZOPA 5CB4B 3K14A 4NWOB 1Q7YH 1W581 1IPAA 3M4SA 1CN7A 3ON1A 3L7QA 2VAPA 3WGJA 3CG6A 4M8IA 4XCQA 3J80M 1SA0A 3E22B 3CC4F 4TV8A 2CSLA 4HNAB 3JCMM 2VGNA 2IQQA 1T0AA 4BT2A 1YQNA 3S0HA 1ZWZA 4ZHYB 3WGNA 3I3FA 4DRXB 3PAFA 4O4LA 3MQWA 3NK6A 4X1IB 2HS4A 4C4WC 2AIZP 2PHNA 4BT3A 3VOBA 5JH7B 1X7PA 3M1XA 4EI9A 1YHQF 3CPWF 2GLZA 4ZHQA 3WJPA 1M1KH 2OZBA 2AIFA 3KIZA 1JN1A 1DBFA 2Z1UA 3D01A 5FJ4C 2HRUA 2LBXA 3VMFB 4DXDA 3M84A 5EB0A 1RQ7A 4ZHVA 1W5EA 1KNJA 1VHAA 1IV4A 3JASB 2VGMA 5MN4A 4I55B 3IKEA 2IAFA 4BT4A 3SIVA 2FC3A 4B62A 2FGYA 1W41A 2VAMA 1W5FA 1YITF 2UYKA 2ALEA 3RYFA 1RA4A 1XHOA 1KQSF 2Z1FA 2Z1EA 4IHJB 5G4VC 5BMVB 3TD5A 1RLUA 3HWUA 3K12A 1VH8A 2L26A 3J81M 3CCVF 3HKEB 4ZI7B 1SZQA 3VYSC 2GZLA 1U43A 1UI9A 3LFOA 2CHTA 3KJJA 1Z5VA 2W8BC 3OW2F 3CMEF 5JCOC 2HVYD 2OTLF 1X7OA 2N48A 3GHZA 4X1KB 2H8CA 2ZODA 3CB2A 3RYIB 5FNVB 3CC2F 1W2BF 5GANK 3E22A 2I6DA 4BVSA 3CCJF 1JD1A 1KC8H 2ZVZA 4ZI7A 1YGYA 2R6R1 3DDNA 1W59A 1KNKA 4R40B 3RYHA 3CCRF 5HXUA 1QU9A 5J2UA 3AGKA 3RYIA 5J2TA 3IKFA 1FNKA 5HP8A 1QD9A 5J2TB 2JNBA 5GONA 4I4TA 3ERNA 3JALA 3G71F 1IV2A 1VQVA 3N4YA 4ZHWA 4LCKA 3DC2A 4YJ2A 5KMGA 1FFXA 1TUBB 3C8LA 3VYTC 2AMTA 3HKCB 2PMPA 1JJ2F 5HY4A 4RQOA 4G4VA 1ONIA 3WPWA 3VI6A 5IJ9B 3N2KB 1Q81H 2Q1XA 4X20B 4TUYA 3VYUC 3CC7F 2GVIA 1VQPF 2KTVA 3HKDB 3LWVC 1VQ4F 1OAPA 2B33A 2UYPA 3VIUA 3S02A 4B45A 4I50A 4FFBA 1GO0A 1ODEA 4G88A 3C9SA 3OBYA 4TUYB 1GZ0A 4X1YB 1VQMF 4ERHA 5ITZB 1VQNF 4ZOLA 1FNJA 3K0TA 3CXCF 3D54A 2OTMA 4X3LA 2KG4A 3N2GA 4U3JA 1M90H 1SA0B 3HKEA 5AVMA 1YJNF 1RQ2A 5EZYA 3V7EA 3GYQA 4NUTA 1QVFF 3I7TA 3F0GA 5EZYB 3IR9A 1W42A 1H48A 3F0DA 5LOVA 3N4ZA 5JQGB 5IT9M 5G4UC 4X1IA
chains in the Genus database with same CATH topology
3CPQA 1W40A 5HWEA 3LWRC 5HY1A 3E1YA 3LWPC 3CCEF 2OHWA 3J81M 3E20B 3CCVF 1XBIA 3MCAB 4BVRA 3LFOA 1YIJF 2QEXF 5EO3A 1E7KA 5DCVA 3OW2F 3CMEF 3CD6F 2QI2A 3I55F 2HVYD 2OTLF 1X7OA 1VQ8F 5GIOC 2CZWA 5HY2A 3CC2F 1W2BF 5GANK 1DT9A 2I6DA 4BY9D 4BVSA 3CCJF 1KC8H 1K9MH 5EWRA 3OBWA 1S72F 1VQOF 1K73H 3CCRF 5HXUA 1W3EX 1QVGF 1VQKF 3CCMF 5HY0A 1K8AH 1YJWF 4X3MA 2BO1A 1VQ9F 3AGKA 3FFMA 1Q82H 1Q7YH 1IPAA 2JNBA 3G71F 1VQ7F 1CN7A 3ON1A 3N4YA 5GINC 3J7AR 3CG6A 3RA6A 4TZZA 4XCQA 5A2QM 3J80M 4LCKA 1T0KB 3RA5A 5FLXM 3CC4F 3JCMM 3WXMB 2WALA 3LWOC 2LBWA 1JJ2F 2VGNA 5HY4A 2F9ZC 3NVIB 1ZWZA 5HXZA 1YI2F 1KD1H 5GIPC 1YJ9F 3VI6A 3PAFA 3CCLF 1Q81H 3NK6A 4C4WC 3CC7F 4NQ3A 1CK2A 1VQPF 2KTVA 3G6EF 3LWVC 1X7PA 5GAPK 1VQ4F 1VQ6F 4EI9A 1YHQF 3CPWF 3O85A 1GO1A 2GLZA 3HAXD 3NVKE 1M1KH 2OZBA 2AIFA 3D00A 3NMUC 3CCQF 3CMAF 1GO0A 3OBYA 1GZ0A 5FJ4C 3I56F 3CCUF 2LBXA 3VMFB 2QA4F 2KTUA 1VQMF 3G4SF 4BVQA 1Q86H 3JAMM 1RLGA 3CCSF 1VQNF 2VGMA 3V7QA 3CXCF 3HJWC 1X52A 4BW0B 3SIVA 4X3LA 2KG4A 1VQ5F 2FC3A 3PLAC 3SIUA 2FGYA 1M90H 2OTJF 1W41A 3V3TA 1SDSA 1YITF 1H7MA 1NJIH 1YJNF 1PXWA 3V7EA 3GYQA 2ALEA 4EI8A 4NUTA 1QVFF 1RA4A 1KQSF 3NK7A 1NMUB 3IR9A 1W42A 4EI7A 3LWQC 4BVTA 3N4ZA 5G4VC 5IT9M 5G4UC 1VQLF 1N8RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPQ A;  1W40 A;  3LWR C;  3E1Y A;  3LWP C;  3CCE F;  2OHW A;  3J81 M;  3E20 B;  3CCV F;  1XBI A;  3MCA B;  3LFO A;  1YIJ F;  2QEX F;  5EO3 A;  1E7K A;  5DCV A;  3OW2 F;  3CME F;  3CD6 F;  2QI2 A;  3I55 F;  2HVY D;  2OTL F;  1X7O A;  1VQ8 F;  5GIO C;  2CZW A;  3CC2 F;  1W2B F;  5GAN K;  1DT9 A;  2I6D A;  4BY9 D;  3CCJ F;  1KC8 H;  1K9M H;  5EWR A;  3OBW A;  1S72 F;  1VQO F;  1K73 H;  3CCR F;  1W3E X;  1QVG F;  1VQK F;  3CCM F;  1K8A H;  1YJW F;  4X3M A;  2BO1 A;  1VQ9 F;  3AGK A;  3FFM A;  1Q82 H;  1Q7Y H;  1IPA A;  2JNB A;  3G71 F;  1VQ7 F;  1CN7 A;  3ON1 A;  3N4Y A;  5GIN C;  3J7A R;  3CG6 A;  3RA6 A;  4TZZ A;  5A2Q M;  3J80 M;  4LCK A;  1T0K B;  3RA5 A;  5FLX M;  3CC4 F;  3JCM M;  3WXM B;  2WAL A;  3LWO C;  2LBW A;  1JJ2 F;  2VGN A;  3NVI B;  1ZWZ A;  1YI2 F;  1KD1 H;  5GIP C;  1YJ9 F;  3VI6 A;  3PAF A;  3CCL F;  1Q81 H;  3NK6 A;  4C4W C;  3CC7 F;  1CK2 A;  1VQP F;  2KTV A;  3G6E F;  3LWV C;  1X7P A;  5GAP K;  1VQ4 F;  1VQ6 F;  1YHQ F;  3CPW F;  3O85 A;  1GO1 A;  3HAX D;  3NVK E;  1M1K H;  2OZB A;  2AIF A;  3NMU C;  3CCQ F;  3CMA F;  1GO0 A;  3OBY A;  1GZ0 A;  5FJ4 C;  3I56 F;  3CCU F;  2LBX A;  3VMF B;  2QA4 F;  2KTU A;  1VQM F;  3G4S F;  1Q86 H;  3JAM M;  1RLG A;  3CCS F;  1VQN F;  2VGM A;  3V7Q A;  3CXC F;  3HJW C;  1X52 A;  4BW0 B;  3SIV A;  4X3L A;  2KG4 A;  1VQ5 F;  2FC3 A;  3PLA C;  3SIU A;  1M90 H;  2OTJ F;  1W41 A;  1SDS A;  1YIT F;  1H7M A;  1NJI H;  1YJN F;  1PXW A;  3V7E A;  3GYQ A;  2ALE A;  4NUT A;  1QVF F;  1RA4 A;  1KQS F;  3NK7 A;  1NMU B;  3IR9 A;  1W42 A;  3LWQ C;  3N4Z A;  5G4V C;  5IT9 M;  5G4U C;  1VQL F;  1N8R H; 
#chains in the Genus database with same CATH topology
 4RHA A;  4BT6 A;  3EOR A;  1W40 A;  3IEW A;  3JAR B;  3LWR C;  5HY1 A;  4F6R A;  1UFY A;  1TUB A;  3LWP C;  2HX0 A;  3C9R A;  4F6R B;  2HRY A;  3HKB B;  1GX1 A;  1XBI A;  4BVR A;  2ZOV A;  1YIJ F;  2HS3 A;  4O4J B;  5EO3 A;  3RYC A;  2RHO A;  3I55 F;  2LBT A;  3P10 A;  5IJ0 B;  2CZW A;  3HKD A;  4O4I A;  1DT9 A;  3Q8H A;  2NMU A;  5CA1 A;  1K73 H;  3IMP A;  1W3E X;  1JFF B;  5IYZ A;  3KHN A;  3CCM F;  4LNU A;  3S06 A;  3MCQ A;  5IJ9 A;  3N2K A;  4X3M A;  4C8E A;  5IJ0 A;  1QAH A;  3VOA A;  5LXT B;  5ITZ A;  2LCA A;  4IIJ A;  3B6N A;  4ZOL B;  1VQ7 F;  5GIN C;  3QHD A;  3N2G B;  4TV9 B;  3RA6 A;  4YJ3 A;  5EIB C;  1T0K B;  3QUW A;  5EAZ A;  4YJ3 B;  3F0E A;  3C9U A;  4FFB B;  3F6M A;  4HNA A;  2WAL A;  1W5B A;  2VXY A;  2EWC A;  4X1Y A;  5CB4 A;  1YI2 F;  1KD1 H;  5GIP C;  2MQE A;  5LOV B;  3CYP B;  2RHJ A;  3CCL F;  3JAK B;  4G4Y A;  1OFU A;  4O2B B;  3GTZ A;  1H47 A;  2BTO A;  1VQL F;  3JAK A;  3S0Y A;  2DT4 A;  5EYP A;  1U40 A;  2HP0 A;  3LDT A;  5GAP K;  1VQ6 F;  1GO1 A;  3HAX D;  4YJ2 B;  3NVK E;  5KX5 A;  3RYH B;  4BT5 A;  3CCQ F;  4DRX A;  4G4Z A;  3WJR A;  2UYJ A;  1W57 A;  3I56 F;  1COM A;  3CCU F;  2KTU A;  3G4S F;  1U3L A;  3UT5 B;  1VK3 A;  4BVQ A;  3JAM M;  1RLG A;  3CCS F;  1NQ3 A;  4O4I B;  5CA0 A;  3JAW A;  3S03 A;  5BMV A;  1Z5W A;  5MN5 A;  3HJW C;  4BW0 B;  4ZHQ B;  1VQ5 F;  4I55 A;  5KMG B;  3V3T A;  1NJI H;  1PXW A;  4EI8 A;  2RHL A;  2BTQ B;  3T80 A;  3NK7 A;  3WGL A;  1XV2 A;  3S0W A;  3LWQ C;  4BVT A;  1TVK B;  5B8F A;  4G4X A;  2R75 1;  3K2X A;  3VO8 A;  1N8R H;  3C9T A;  4TV9 A;  5LA6 B;  5HWE A;  2KGW A;  2DYY A;  1X25 A;  3F0F A;  2Z01 A;  3CCE F;  3HTN A;  3P4E A;  5IYZ B;  4U39 A;  1J7H A;  5JCO A;  5DCV A;  3MDO A;  3CD6 F;  2QI2 A;  2VAW A;  5J2U B;  5GIO C;  2YYE A;  1PF5 A;  5JQG A;  3KE1 A;  5EYP B;  3ZO8 A;  3ZP4 A;  1R1M A;  4B5C A;  4O2A B;  5FNV A;  2UZH A;  3OBW A;  1VQO F;  1QVG F;  1VQK F;  2QTP A;  5HY0 A;  1YJW F;  4O4L B;  3LYB A;  2BO1 A;  4X1K A;  3FFM A;  1VQ9 F;  4G4W A;  5EB1 B;  2K1S A;  5JVD A;  3FBA A;  3TD4 A;  2V9Y A;  3V4D A;  3WGM A;  3BYQ A;  2ZF8 A;  3J7A R;  3JAR A;  4TZZ A;  5A2Q M;  2YXZ A;  3RA5 A;  5FLX M;  5LYJ A;  3MBM A;  3WXM B;  3LWO C;  2LBW A;  3NVI B;  2F9Z C;  3RYF B;  4I50 B;  5HXZ A;  1YJ9 F;  3UT5 A;  4WBN B;  3FPI A;  2HQS C;  3RYC B;  4EB6 B;  5CA0 B;  3JAT B;  3JAW B;  1IV3 A;  4X20 A;  4C81 A;  2CW4 A;  4NQ3 A;  1CK2 A;  3R0P A;  3G6E F;  3CYQ A;  3HKC A;  3IEQ A;  3O85 A;  4KWE A;  2IG8 A;  1U3P A;  2I6R A;  3D00 A;  3NMU C;  1JFF A;  3CMA F;  3LME A;  2P6Y A;  4EB6 A;  4BT7 A;  1TVK A;  2QA4 F;  1Q86 H;  4O2A A;  3V7Q A;  4U3J B;  4C8G A;  1X52 A;  3PLA C;  3SIU A;  2OTJ F;  5EIB D;  5JH7 A;  2HS0 A;  4TV8 B;  2ZAU A;  2Q1Y A;  3VCZ A;  1SDS A;  3WGK A;  5C8Y A;  1H7M A;  3U0O A;  1XRG A;  2RB9 A;  5C8Y B;  1JY8 A;  3TD3 A;  1NMU B;  1FSZ A;  2RHH A;  4EI7 A;  2BTU A;  2CWJ A;  3ELC A;  3RE3 A;  3VTI C;  5HP7 A;  5LP6 A;  3P0Z A;  4O2B A;  4I4T B;  3JAL B;  5GON B;  3CPQ A;  5LP6 B;  3FD5 A;  1FFX B;  2HP0 B;  3E1Y A;  5LYJ B;  2ZVY A;  3WJQ A;  2OHW A;  4PWT A;  3E20 B;  4C82 A;  2CVL A;  5KX5 B;  3MCA B;  3JVH A;  5CA1 B;  4O4H B;  1CLI A;  2QEX F;  5LP6 C;  5MN6 A;  1E7K A;  4O4H A;  3KJK A;  5JVD B;  1W5A A;  4O4J A;  4B46 A;  3ZP7 A;  1VQ8 F;  2UYN A;  4IHJ A;  2H6L A;  2CHS A;  5HY2 A;  3OON A;  3QTY A;  3WPX A;  2G9I A;  3JAS A;  4BY9 D;  4IIJ B;  4C8I A;  3FD6 A;  4E6E A;  1W55 A;  3ESJ A;  5LA6 A;  1K9M H;  5EWR A;  3HKB A;  2H8E A;  1S72 F;  2HP3 A;  4ZK7 A;  1IV1 A;  2Z1T A;  1K8A H;  1Q8R A;  4WBN A;  1Q82 H;  5LXT A;  4LNU B;  2UYN B;  3JAT A;  3ZOP A;  5CB4 B;  3K14 A;  4NWO B;  1Q7Y H;  1W58 1;  1IPA A;  3M4S A;  1CN7 A;  3ON1 A;  3L7Q A;  2VAP A;  3WGJ A;  3CG6 A;  4M8I A;  4XCQ A;  3J80 M;  1SA0 A;  3E22 B;  3CC4 F;  4TV8 A;  2CSL A;  4HNA B;  3JCM M;  2VGN A;  2IQQ A;  1T0A A;  4BT2 A;  1YQN A;  3S0H A;  1ZWZ A;  4ZHY B;  3WGN A;  3I3F A;  4DRX B;  3PAF A;  4O4L A;  3MQW A;  3NK6 A;  4X1I B;  2HS4 A;  4C4W C;  2AIZ P;  2PHN A;  4BT3 A;  3VOB A;  5JH7 B;  1X7P A;  3M1X A;  4EI9 A;  1YHQ F;  3CPW F;  2GLZ A;  4ZHQ A;  3WJP A;  1M1K H;  2OZB A;  2AIF A;  3KIZ A;  1JN1 A;  1DBF A;  2Z1U A;  3D01 A;  5FJ4 C;  2HRU A;  2LBX A;  3VMF B;  4DXD A;  3M84 A;  5EB0 A;  1RQ7 A;  4ZHV A;  1W5E A;  1KNJ A;  1VHA A;  1IV4 A;  3JAS B;  2VGM A;  5MN4 A;  4I55 B;  3IKE A;  2IAF A;  4BT4 A;  3SIV A;  2FC3 A;  4B62 A;  2FGY A;  1W41 A;  2VAM A;  1W5F A;  1YIT F;  2UYK A;  2ALE A;  3RYF A;  1RA4 A;  1XHO A;  1KQS F;  2Z1F A;  2Z1E A;  4IHJ B;  5G4V C;  5BMV B;  3TD5 A;  1RLU A;  3HWU A;  3K12 A;  1VH8 A;  2L26 A;  3J81 M;  3CCV F;  3HKE B;  4ZI7 B;  1SZQ A;  3VYS C;  2GZL A;  1U43 A;  1UI9 A;  3LFO A;  2CHT A;  3KJJ A;  1Z5V A;  2W8B C;  3OW2 F;  3CME F;  5JCO C;  2HVY D;  2OTL F;  1X7O A;  2N48 A;  3GHZ A;  4X1K B;  2H8C A;  2ZOD A;  3CB2 A;  3RYI B;  5FNV B;  3CC2 F;  1W2B F;  5GAN K;  3E22 A;  2I6D A;  4BVS A;  3CCJ F;  1JD1 A;  1KC8 H;  2ZVZ A;  4ZI7 A;  1YGY A;  2R6R 1;  3DDN A;  1W59 A;  1KNK A;  4R40 B;  3RYH A;  3CCR F;  5HXU A;  1QU9 A;  5J2U A;  3AGK A;  3RYI A;  5J2T A;  3IKF A;  1FNK A;  5HP8 A;  1QD9 A;  5J2T B;  2JNB A;  5GON A;  4I4T A;  3ERN A;  3JAL A;  3G71 F;  1IV2 A;  1VQV A;  3N4Y A;  4ZHW A;  4LCK A;  3DC2 A;  4YJ2 A;  5KMG A;  1FFX A;  1TUB B;  3C8L A;  3VYT C;  2AMT A;  3HKC B;  2PMP A;  1JJ2 F;  5HY4 A;  4RQO A;  4G4V A;  1ONI A;  3WPW A;  3VI6 A;  5IJ9 B;  3N2K B;  1Q81 H;  2Q1X A;  4X20 B;  4TUY A;  3VYU C;  3CC7 F;  2GVI A;  1VQP F;  2KTV A;  3HKD B;  3LWV C;  1VQ4 F;  1OAP A;  2B33 A;  2UYP A;  3VIU A;  3S02 A;  4B45 A;  4I50 A;  4FFB A;  1GO0 A;  1ODE A;  4G88 A;  3C9S A;  3OBY A;  4TUY B;  1GZ0 A;  4X1Y B;  1VQM F;  4ERH A;  5ITZ B;  1VQN F;  4ZOL A;  1FNJ A;  3K0T A;  3CXC F;  3D54 A;  2OTM A;  4X3L A;  2KG4 A;  3N2G A;  4U3J A;  1M90 H;  1SA0 B;  3HKE A;  5AVM A;  1YJN F;  1RQ2 A;  5EZY A;  3V7E A;  3GYQ A;  4NUT A;  1QVF F;  3I7T A;  3F0G A;  5EZY B;  3IR9 A;  1W42 A;  1H48 A;  3F0D A;  5LOV A;  3N4Z A;  5JQG B;  5IT9 M;  5G4U C;  4X1I A; 
#chains in the Genus database with same CATH homology
 3CPQ A;  1W40 A;  5HWE A;  3LWR C;  5HY1 A;  3E1Y A;  3LWP C;  3CCE F;  2OHW A;  3J81 M;  3E20 B;  3CCV F;  1XBI A;  3MCA B;  4BVR A;  3LFO A;  1YIJ F;  2QEX F;  5EO3 A;  1E7K A;  5DCV A;  3OW2 F;  3CME F;  3CD6 F;  2QI2 A;  3I55 F;  2HVY D;  2OTL F;  1X7O A;  1VQ8 F;  5GIO C;  2CZW A;  5HY2 A;  3CC2 F;  1W2B F;  5GAN K;  1DT9 A;  2I6D A;  4BY9 D;  4BVS A;  3CCJ F;  1KC8 H;  1K9M H;  5EWR A;  3OBW A;  1S72 F;  1VQO F;  1K73 H;  3CCR F;  5HXU A;  1W3E X;  1QVG F;  1VQK F;  3CCM F;  5HY0 A;  1K8A H;  1YJW F;  4X3M A;  2BO1 A;  1VQ9 F;  3AGK A;  3FFM A;  1Q82 H;  1Q7Y H;  1IPA A;  2JNB A;  3G71 F;  1VQ7 F;  1CN7 A;  3ON1 A;  3N4Y A;  5GIN C;  3J7A R;  3CG6 A;  3RA6 A;  4TZZ A;  4XCQ A;  5A2Q M;  3J80 M;  4LCK A;  1T0K B;  3RA5 A;  5FLX M;  3CC4 F;  3JCM M;  3WXM B;  2WAL A;  3LWO C;  2LBW A;  1JJ2 F;  2VGN A;  5HY4 A;  2F9Z C;  3NVI B;  1ZWZ A;  5HXZ A;  1YI2 F;  1KD1 H;  5GIP C;  1YJ9 F;  3VI6 A;  3PAF A;  3CCL F;  1Q81 H;  3NK6 A;  4C4W C;  3CC7 F;  4NQ3 A;  1CK2 A;  1VQP F;  2KTV A;  3G6E F;  3LWV C;  1X7P A;  5GAP K;  1VQ4 F;  1VQ6 F;  4EI9 A;  1YHQ F;  3CPW F;  3O85 A;  1GO1 A;  2GLZ A;  3HAX D;  3NVK E;  1M1K H;  2OZB A;  2AIF A;  3D00 A;  3NMU C;  3CCQ F;  3CMA F;  1GO0 A;  3OBY A;  1GZ0 A;  5FJ4 C;  3I56 F;  3CCU F;  2LBX A;  3VMF B;  2QA4 F;  2KTU A;  1VQM F;  3G4S F;  4BVQ A;  1Q86 H;  3JAM M;  1RLG A;  3CCS F;  1VQN F;  2VGM A;  3V7Q A;  3CXC F;  3HJW C;  1X52 A;  4BW0 B;  3SIV A;  4X3L A;  2KG4 A;  1VQ5 F;  2FC3 A;  3PLA C;  3SIU A;  2FGY A;  1M90 H;  2OTJ F;  1W41 A;  3V3T A;  1SDS A;  1YIT F;  1H7M A;  1NJI H;  1YJN F;  1PXW A;  3V7E A;  3GYQ A;  2ALE A;  4EI8 A;  4NUT A;  1QVF F;  1RA4 A;  1KQS F;  3NK7 A;  1NMU B;  3IR9 A;  1W42 A;  4EI7 A;  3LWQ C;  4BVT A;  3N4Z A;  5G4V C;  5IT9 M;  5G4U C;  1VQL F;  1N8R H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...