5GINC

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ginC00
3ON1A 3CCLF 1VQ4F 1IPAA 3HAXD 5GIOC 5G4VC 3IR9A 3LWVC 4X3MA 1VQNF 2QA4F 1S72F 3LWOC 5EO3A 1X7OA 3NK7A 3CPWF 1SDSA 1K73H 1VQ7F 1YJNF 1GO1A 3JAMM 1VQKF 1X52A 1NMUB 1M1KH 3GYQA 3CCJF 1VQ5F 3E20B 3LWQC 3CD6F 3V7EA 3NK6A 3HJWC 1XBIA 3OBYA 3AGKA 1YITF 1Q7YH 1KD1H 1M90H 1RA4A 2AIFA 5GINC 1CK2A 1K8AH 2OTJF 3O85A 3CCUF 5DCVA 2KG4A 3VI6A 1VQ6F 1QVFF 3NMUC 3LWRC 2BO1A 2HVYD 2VGMA 3E1YA 3I55F 1VQ8F 1K9MH 2QEXF 3N4ZA 3JCMM 3N4YA 3CC7F 3VMFB 1VQMF 3LFOA 4LCKA 3CC4F 1YI2F 1VQ9F 1H7MA 3J80M 2QI2A 5GAPK 1KQSF 2KTUA 3LWPC 3CCVF 2VGNA 3RA6A 3CCSF 1X7PA 2KTVA 1ZWZA 2JNBA 4BW0B 3PAFA 4BY9D 3V7QA 4C4WC 2LBWA 1CN7A 1VQOF 2OHWA 2OTLF 3CMAF 3CCRF 3NVIB 1W42A 4TZZA 5FLXM 3J81M 3OBWA 2ALEA 1YJWF 1W2BF 2FC3A 1PXWA 5FJ4C 5EWRA 1KC8H 1JJ2F 4X3LA 2CZWA 4NUTA 1Q86H 5G4UC 1QVGF 3SIUA 1DT9A 3G71F 1GO0A 2WALA 1VQPF 3PLAC 1VQLF 3CCQF 1W40A 3NVKE 3RA5A 3MCAB 3G4SF 2LBXA 3I56F 1W41A 3CC2F 3SIVA 1Q81H 5IT9M 1T0KB 1NJIH 3CCMF 1YIJF 3FFMA 3WXMB 5GANK 3CPQA 3CCEF 1YHQF 5GIPC 1E7KA 3J7AR 1N8RH 3CG6A 2OZBA 3G6EF 1GZ0A 1RLGA 2I6DA 1Q82H 3CXCF 3CMEF 5A2QM 1YJ9F 1W3EX 3OW2F
chains in the Genus database with same CATH superfamily
4TV8A 2AIZP 4BVSA 5CA1A 4YJ2A 2OTMA 3FPIA 3IR9A 2QA4F 2G9IA 2RHOA 3M84A 1X7OA 5JVDB 4B5CA 2Z1TA 1IV3A 4BT3A 4RQOA 1VQ7F 3JAMM 3JALB 3QUWA 2N48A 1X52A 1SA0A 3HWUA 4ZHQB 1M1KH 1IV1A 1VQ5F 1W5FA 4O4JA 3F0EA 3DDNA 1XBIA 3OBYA 1YITF 3HKCA 2CHTA 2B33A 4X1IA 3B6NA 1U40A 1CK2A 2ZVZA 3TD4A 1CLIA 3JARB 1H47A 4FFBA 4ZI7A 3WPXA 1U43A 3VI6A 5BMVB 3LWRC 2BO1A 2HRYA 5HWEA 5MN4A 1K9MH 2K1SA 4C8EA 3WGMA 4C8IA 2RB9A 4I55A 2NMUA 1H7MA 3M1XA 5EIBC 1KQSF 3CCVF 2CHSA 1VHAA 3CCSF 1OAPA 3C9SA 3PAFA 4BW0B 3VIUA 2W8BC 1FNJA 3I3FA 1CN7A 3JAWA 4EI8A 5ITZA 4LNUA 2UZHA 1UI9A 3J81M 2Z1FA 1GX1A 2YYEA 1PXWA 4ZI7B 3K2XA 4NUTA 1RLUA 5HXZA 5EYPA 5G4UC 2F9ZC 5J2UB 2AMTA 3F0GA 4NQ3A 1DT9A 3G71F 1U3LA 2HS0A 3SIUA 4TV9A 2CVLA 5IYZB 2UYNB 3E22B 3NVKE 3MCAB 2MQEA 3CC2F 3UT5A 3RYCB 5CA0A 3P0ZA 2ZOVA 5LYJA 2HX0A 1Z5WA 4ZOLA 3BYQA 3WXMB 3ELCA 3J7AR 2I6RA 1N8RH 3N2KA 4F6RB 3JATB 4G4ZA 4I50B 3FD5A 5LP6A 2I6DA 3P4EA 3V3TA 4O4HB 5GONA 2IG8A 4U3JB 3WJQA 1TUBB 3HTNA 4I4TB 3WGLA 2CW4A 3T80A 1Z5VA 4IIJB 1W5BA 5LA6B 5MN6A 3CCLF 1VQ4F 5JVDA 3HAXD 4X3MA 4DXDA 1S72F 3VOAA 4G88A 3JALA 4BT6A 5HY4A 1JY8A 5KMGB 2YXZA 3KJJA 4RHAA 1XRGA 4BT5A 4ZHQA 4C81A 3LDTA 1YJNF 5LOVB 1QU9A 1UFYA 2EWCA 4BT4A 1IV4A 1W59A 3HJWC 5C8YB 3AGKA 5FNVB 3MBMA 4WBNB 2HS3A 5HP8A 3TD3A 1RA4A 3IMPA 5HY2A 3JARA 3CYQA 5BMVA 1FFXB 1H48A 5J2TB 3U0OA 3O85A 2FGYA 1QAHA 3M4SA 2HP0B 1VQ6F 2DYYA 1QVFF 2Q1YA 4IHJB 4ZHVA 2VGMA 2HVYD 4C82A 2BTUA 3MDOA 3S0HA 2QEXF 3JVHA 1XV2A 3CYPB 3VMFB 4DRXB 2VXYA 1VQMF 4LCKA 1YI2F 4O4LB 3VYSC 3FBAA 2ZAUA 3LWPC 3WPWA 4BVQA 2Z1EA 1Q8RA 1W5AA 5CB4B 2Q1XA 4EI7A 5HP7A 4TZZA 3KE1A 3WGNA 2RHJA 4YJ3B 3D00A 1NQ3A 3S0WA 2GLZA 2UYKA 3GTZA 5J2UA 2FC3A 5FJ4C 2Z01A 2RHHA 2QTPA 1JJ2F 5IYZA 2UYNA 2CSLA 3E22A 3KHNA 2VAPA 3RYCA 2R6R1 3FD6A 2PHNA 3JASB 3I56F 3SIVA 1Q81H 4G4VA 5IT9M 1NJIH 4F6RA 2UYJA 4B62A 1YIJF 3JATA 4I50A 5GANK 3CG6A 4O4HA 4U3JA 3TD5A 4BT7A 1TUBA 4I4TA 2OZBA 3G6EF 2R751 2GZLA 1FNKA 4NWOB 2H6LA 4IIJA 3CXCF 3JAKB 3MQWA 5B8FA 3C9TA 1TVKB 5LA6A 1YJ9F 2ZVYA 3ON1A 4HNAB 2IAFA 1RQ7A 2H8EA 5EB1B 2HS4A 3D54A 5KMGA 1IPAA 5GIOC 5G4VC 3LWVC 1ODEA 4ERHA 1COMA 3GHZA 3LWOC 5LOVA 2VAWA 1SDSA 1K73H 1W55A 5IJ9B 3WJRA 1VQKF 3RYIB 4BVRA 5HY0A 3ESJA 3GYQA 5C8YA 5FNVA 3L7QA 4KWEA 3E20B 4G4XA 4WBNA 3LWQC 1QD9A 5KX5B 3CD6F 3NK6A 4G4YA 3V7EA 5HXUA 2ZODA 3S0YA 1Q7YH 1M90H 1FFXA 2AIFA 1W57A 3F0FA 1DBFA 5GINC 1YQNA 5J2TA 4ZHWA 1VQVA 1JN1A 5EIBD 2HP0A 1T0AA 1K8AH 4IHJA 1R1MA 4X1KB 3N2GB 3CCUF 2KG4A 4ZK7A 3NMUC 4DRXA 3E1YA 3I55F 3C9UA 5EZYB 4O2AB 1IV2A 4O4LA 3Q8HA 1VK3A 3N4ZA 3JCMM 3N4YA 2LBTA 5MN5A 2GVIA 5HY1A 3LMEA 5EAZA 3CC4F 4EI9A 5GAPK 3VTIC 1VH8A 1U3PA 3HKDB 3KJKA 3RA6A 2HQSC 5JCOC 2KTVA 5CB4A 1ZWZA 2JNBA 4TUYB 5IJ0B 1X25A 3RYFB 2LBWA 4YJ3A 3VYTC 1VQOF 2OHWA 2OTLF 3CMAF 4O4IB 3RE3A 4ZHYB 2BTQB 1YJWF 1W2BF 2HP3A 5EWRA 1KC8H 3WGKA 1Q86H 3VCZA 5JH7B 3JASA 4X20B 1GO0A 3OONA 2BTOA 3HKBB 3IEQA 3EORA 1ONIA 3K12A 3IEWA 1W40A 3I7TA 3RA5A 2LBXA 2H8CA 1W41A 2LCAA 3WJPA 3S02A 1KNKA 4EB6B 1J7HA 3LYBA 1JFFB 3HKEB 5LXTB 3FFMA 3QTYA 3CCEF 3CPQA 1E7KA 2DT4A 4BT2A 4X1YB 1GZ0A 3JAKA 5JQGB 1RLGA 1TVKA 4HNAA 5AVMA 3CMEF 3VOBA 5A2QM 1W3EX 3OW2F 3RYHB 2KGWA 2PMPA 4TV8B 4YJ2B 5CA1B 1VQNF 5LP6C 4G4WA 3DC2A 5IJ9A 5EO3A 2CWJA 3NK7A 4PWTA 3CPWF 5JCOA 3RYIA 1GO1A 3D01A 3ZP4A 3S03A 5KX5A 1NMUB 1XHOA 4BVTA 3CCJF 1JD1A 3R0PA 1SA0B 1YGYA 4O2BA 1KD1H 4O4JB 3K0TA 3VYUC 4X1KA 3HKCB 3N2GA 3P10A 5EB0A 2OTJF 4X1IB 5DCVA 5EZYA 4O2AA 4B45A 2Z1UA 1FSZA 4FFBB 1VQ8F 2HRUA 3CC7F 3IKEA 3HKDA 3S06A 4R40B 3V4DA 3LFOA 1VQ9F 3J80M 2QI2A 3F6MA 3MCQA 2KTUA 4TUYA 4U39A 2UYPA 5IJ0A 2VGNA 2RHLA 2IQQA 3RYFA 3K14A 4I55B 1W5EA 4O2BB 1X7PA 4XCQA 3C8LA 4O4IA 4BY9D 3V7QA 1SZQA 1KNJA 4C4WC 3WGJA 3CCRF 3NVIB 1W581 1W42A 5FLXM 2P6YA 3JAWB 3OBWA 4M8IA 2ALEA 5ITZB 5JH7A 1RQ2A 4X20A 4LNUB 3HKBA 4X3LA 2CZWA 3ZP7A 2WALA 3F0DA 1VQPF 3PLAC 1VQLF 4B46A 3CCQF 2V9YA 5EYPB 4EB6A 3G4SF 3ZO8A 3ERNA 4TV9B 1JFFA 3HKEA 5LXTA 3KIZA 1T0KB 3CCMF 3UT5B 3QHDA 3IKFA 5CA0B 1YHQF 2ZF8A 5GIPC 5LYJB 4X1YA 5JQGA 3CB2A 2L26A 1PF5A 4ZOLB 3N2KB 4C8GA 3ZOPA 1OFUA 4E6EA 3VO8A 1Q82H 3RYHA 5LP6B 3C9RA 2VAMA 1QVGF 5GONB
chains in the Genus database with same CATH topology
3ON1A 4BVSA 3CCLF 1VQ4F 1IPAA 3HAXD 5GIOC 5G4VC 3IR9A 3LWVC 4X3MA 1VQNF 2QA4F 1S72F 3LWOC 5HY4A 5EO3A 1X7OA 3NK7A 3CPWF 1SDSA 1K73H 1VQ7F 1YJNF 1GO1A 3JAMM 1VQKF 1X52A 1NMUB 4BVRA 5HY0A 4BVTA 1M1KH 3GYQA 3CCJF 1VQ5F 3E20B 3LWQC 3CD6F 3V7EA 3NK6A 3HJWC 1XBIA 3OBYA 5HXUA 3AGKA 1YITF 1Q7YH 1KD1H 1M90H 1RA4A 2AIFA 5GINC 5HY2A 1CK2A 1K8AH 2OTJF 3O85A 3CCUF 5DCVA 2FGYA 2KG4A 3VI6A 1VQ6F 1QVFF 3NMUC 3LWRC 2BO1A 2HVYD 5HWEA 2VGMA 3E1YA 3I55F 1VQ8F 1K9MH 2QEXF 3N4ZA 3JCMM 3N4YA 3CC7F 3VMFB 5HY1A 1VQMF 3LFOA 4LCKA 3CC4F 1YI2F 1VQ9F 1H7MA 3J80M 2QI2A 4EI9A 5GAPK 1KQSF 2KTUA 3LWPC 3CCVF 2VGNA 3RA6A 4BVQA 3CCSF 4XCQA 1X7PA 2KTVA 1ZWZA 2JNBA 4BW0B 3PAFA 4BY9D 3V7QA 4C4WC 2LBWA 1CN7A 1VQOF 4EI8A 2OHWA 2OTLF 3CMAF 3CCRF 4EI7A 3NVIB 1W42A 4TZZA 5FLXM 3J81M 3OBWA 3D00A 2ALEA 2GLZA 1YJWF 1W2BF 2FC3A 1PXWA 5FJ4C 5EWRA 1KC8H 1JJ2F 4X3LA 2CZWA 4NUTA 1Q86H 5G4UC 5HXZA 1QVGF 2F9ZC 4NQ3A 1DT9A 3G71F 3SIUA 2WALA 1VQPF 3PLAC 1GO0A 1VQLF 3CCQF 1W40A 3NVKE 3RA5A 3MCAB 3G4SF 2LBXA 3I56F 1W41A 3CC2F 3SIVA 1Q81H 5IT9M 1T0KB 1NJIH 3CCMF 1YIJF 3FFMA 3WXMB 5GANK 3CPQA 3CCEF 1YHQF 5GIPC 1E7KA 3J7AR 1N8RH 3CG6A 2OZBA 3G6EF 1GZ0A 1RLGA 2I6DA 3V3TA 1Q82H 3CXCF 3CMEF 5A2QM 1YJ9F 1W3EX 3OW2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ON1 A;  3CCL F;  1VQ4 F;  1IPA A;  3HAX D;  5GIO C;  5G4V C;  3IR9 A;  3LWV C;  4X3M A;  1VQN F;  2QA4 F;  1S72 F;  3LWO C;  5EO3 A;  1X7O A;  3NK7 A;  3CPW F;  1SDS A;  1K73 H;  1VQ7 F;  1YJN F;  1GO1 A;  3JAM M;  1VQK F;  1X52 A;  1NMU B;  1M1K H;  3GYQ A;  3CCJ F;  1VQ5 F;  3E20 B;  3LWQ C;  3CD6 F;  3V7E A;  3NK6 A;  3HJW C;  1XBI A;  3OBY A;  3AGK A;  1YIT F;  1Q7Y H;  1KD1 H;  1M90 H;  1RA4 A;  2AIF A;  5GIN C;  1CK2 A;  1K8A H;  2OTJ F;  3O85 A;  3CCU F;  5DCV A;  2KG4 A;  3VI6 A;  1VQ6 F;  1QVF F;  3NMU C;  3LWR C;  2BO1 A;  2HVY D;  2VGM A;  3E1Y A;  3I55 F;  1VQ8 F;  1K9M H;  2QEX F;  3N4Z A;  3JCM M;  3N4Y A;  3CC7 F;  3VMF B;  1VQM F;  3LFO A;  4LCK A;  3CC4 F;  1YI2 F;  1VQ9 F;  1H7M A;  3J80 M;  2QI2 A;  5GAP K;  1KQS F;  2KTU A;  3LWP C;  3CCV F;  2VGN A;  3RA6 A;  3CCS F;  1X7P A;  2KTV A;  1ZWZ A;  2JNB A;  4BW0 B;  3PAF A;  4BY9 D;  3V7Q A;  4C4W C;  2LBW A;  1CN7 A;  1VQO F;  2OHW A;  2OTL F;  3CMA F;  3CCR F;  3NVI B;  1W42 A;  4TZZ A;  5FLX M;  3J81 M;  3OBW A;  2ALE A;  1YJW F;  1W2B F;  2FC3 A;  1PXW A;  5FJ4 C;  5EWR A;  1KC8 H;  1JJ2 F;  4X3L A;  2CZW A;  4NUT A;  1Q86 H;  5G4U C;  1QVG F;  3SIU A;  1DT9 A;  3G71 F;  1GO0 A;  2WAL A;  1VQP F;  3PLA C;  1VQL F;  3CCQ F;  1W40 A;  3NVK E;  3RA5 A;  3MCA B;  3G4S F;  2LBX A;  3I56 F;  1W41 A;  3CC2 F;  3SIV A;  1Q81 H;  5IT9 M;  1T0K B;  1NJI H;  3CCM F;  1YIJ F;  3FFM A;  3WXM B;  5GAN K;  3CPQ A;  3CCE F;  1YHQ F;  5GIP C;  1E7K A;  3J7A R;  1N8R H;  3CG6 A;  2OZB A;  3G6E F;  1GZ0 A;  1RLG A;  2I6D A;  1Q82 H;  3CXC F;  3CME F;  5A2Q M;  1YJ9 F;  1W3E X;  3OW2 F; 
#chains in the Genus database with same CATH topology
 4TV8 A;  2AIZ P;  4BVS A;  5CA1 A;  4YJ2 A;  2OTM A;  3FPI A;  3IR9 A;  2QA4 F;  2G9I A;  2RHO A;  3M84 A;  1X7O A;  5JVD B;  4B5C A;  2Z1T A;  1IV3 A;  4BT3 A;  4RQO A;  1VQ7 F;  3JAM M;  3JAL B;  3QUW A;  2N48 A;  1X52 A;  1SA0 A;  3HWU A;  4ZHQ B;  1M1K H;  1IV1 A;  1VQ5 F;  1W5F A;  4O4J A;  3F0E A;  3DDN A;  1XBI A;  3OBY A;  1YIT F;  3HKC A;  2CHT A;  2B33 A;  4X1I A;  3B6N A;  1U40 A;  1CK2 A;  2ZVZ A;  3TD4 A;  1CLI A;  3JAR B;  1H47 A;  4FFB A;  4ZI7 A;  3WPX A;  1U43 A;  3VI6 A;  5BMV B;  3LWR C;  2BO1 A;  2HRY A;  5HWE A;  5MN4 A;  1K9M H;  2K1S A;  4C8E A;  3WGM A;  4C8I A;  2RB9 A;  4I55 A;  2NMU A;  1H7M A;  3M1X A;  5EIB C;  1KQS F;  3CCV F;  2CHS A;  1VHA A;  3CCS F;  1OAP A;  3C9S A;  3PAF A;  4BW0 B;  3VIU A;  2W8B C;  1FNJ A;  3I3F A;  1CN7 A;  3JAW A;  4EI8 A;  5ITZ A;  4LNU A;  2UZH A;  1UI9 A;  3J81 M;  2Z1F A;  1GX1 A;  2YYE A;  1PXW A;  4ZI7 B;  3K2X A;  4NUT A;  1RLU A;  5HXZ A;  5EYP A;  5G4U C;  2F9Z C;  5J2U B;  2AMT A;  3F0G A;  4NQ3 A;  1DT9 A;  3G71 F;  1U3L A;  2HS0 A;  3SIU A;  4TV9 A;  2CVL A;  5IYZ B;  2UYN B;  3E22 B;  3NVK E;  3MCA B;  2MQE A;  3CC2 F;  3UT5 A;  3RYC B;  5CA0 A;  3P0Z A;  2ZOV A;  5LYJ A;  2HX0 A;  1Z5W A;  4ZOL A;  3BYQ A;  3WXM B;  3ELC A;  3J7A R;  2I6R A;  1N8R H;  3N2K A;  4F6R B;  3JAT B;  4G4Z A;  4I50 B;  3FD5 A;  5LP6 A;  2I6D A;  3P4E A;  3V3T A;  4O4H B;  5GON A;  2IG8 A;  4U3J B;  3WJQ A;  1TUB B;  3HTN A;  4I4T B;  3WGL A;  2CW4 A;  3T80 A;  1Z5V A;  4IIJ B;  1W5B A;  5LA6 B;  5MN6 A;  3CCL F;  1VQ4 F;  5JVD A;  3HAX D;  4X3M A;  4DXD A;  1S72 F;  3VOA A;  4G88 A;  3JAL A;  4BT6 A;  5HY4 A;  1JY8 A;  5KMG B;  2YXZ A;  3KJJ A;  4RHA A;  1XRG A;  4BT5 A;  4ZHQ A;  4C81 A;  3LDT A;  1YJN F;  5LOV B;  1QU9 A;  1UFY A;  2EWC A;  4BT4 A;  1IV4 A;  1W59 A;  3HJW C;  5C8Y B;  3AGK A;  5FNV B;  3MBM A;  4WBN B;  2HS3 A;  5HP8 A;  3TD3 A;  1RA4 A;  3IMP A;  5HY2 A;  3JAR A;  3CYQ A;  5BMV A;  1FFX B;  1H48 A;  5J2T B;  3U0O A;  3O85 A;  2FGY A;  1QAH A;  3M4S A;  2HP0 B;  1VQ6 F;  2DYY A;  1QVF F;  2Q1Y A;  4IHJ B;  4ZHV A;  2VGM A;  2HVY D;  4C82 A;  2BTU A;  3MDO A;  3S0H A;  2QEX F;  3JVH A;  1XV2 A;  3CYP B;  3VMF B;  4DRX B;  2VXY A;  1VQM F;  4LCK A;  1YI2 F;  4O4L B;  3VYS C;  3FBA A;  2ZAU A;  3LWP C;  3WPW A;  4BVQ A;  2Z1E A;  1Q8R A;  1W5A A;  5CB4 B;  2Q1X A;  4EI7 A;  5HP7 A;  4TZZ A;  3KE1 A;  3WGN A;  2RHJ A;  4YJ3 B;  3D00 A;  1NQ3 A;  3S0W A;  2GLZ A;  2UYK A;  3GTZ A;  5J2U A;  2FC3 A;  5FJ4 C;  2Z01 A;  2RHH A;  2QTP A;  1JJ2 F;  5IYZ A;  2UYN A;  2CSL A;  3E22 A;  3KHN A;  2VAP A;  3RYC A;  2R6R 1;  3FD6 A;  2PHN A;  3JAS B;  3I56 F;  3SIV A;  1Q81 H;  4G4V A;  5IT9 M;  1NJI H;  4F6R A;  2UYJ A;  4B62 A;  1YIJ F;  3JAT A;  4I50 A;  5GAN K;  3CG6 A;  4O4H A;  4U3J A;  3TD5 A;  4BT7 A;  1TUB A;  4I4T A;  2OZB A;  3G6E F;  2R75 1;  2GZL A;  1FNK A;  4NWO B;  2H6L A;  4IIJ A;  3CXC F;  3JAK B;  3MQW A;  5B8F A;  3C9T A;  1TVK B;  5LA6 A;  1YJ9 F;  2ZVY A;  3ON1 A;  4HNA B;  2IAF A;  1RQ7 A;  2H8E A;  5EB1 B;  2HS4 A;  3D54 A;  5KMG A;  1IPA A;  5GIO C;  5G4V C;  3LWV C;  1ODE A;  4ERH A;  1COM A;  3GHZ A;  3LWO C;  5LOV A;  2VAW A;  1SDS A;  1K73 H;  1W55 A;  5IJ9 B;  3WJR A;  1VQK F;  3RYI B;  4BVR A;  5HY0 A;  3ESJ A;  3GYQ A;  5C8Y A;  5FNV A;  3L7Q A;  4KWE A;  3E20 B;  4G4X A;  4WBN A;  3LWQ C;  1QD9 A;  5KX5 B;  3CD6 F;  3NK6 A;  4G4Y A;  3V7E A;  5HXU A;  2ZOD A;  3S0Y A;  1Q7Y H;  1M90 H;  1FFX A;  2AIF A;  1W57 A;  3F0F A;  1DBF A;  5GIN C;  1YQN A;  5J2T A;  4ZHW A;  1VQV A;  1JN1 A;  5EIB D;  2HP0 A;  1T0A A;  1K8A H;  4IHJ A;  1R1M A;  4X1K B;  3N2G B;  3CCU F;  2KG4 A;  4ZK7 A;  3NMU C;  4DRX A;  3E1Y A;  3I55 F;  3C9U A;  5EZY B;  4O2A B;  1IV2 A;  4O4L A;  3Q8H A;  1VK3 A;  3N4Z A;  3JCM M;  3N4Y A;  2LBT A;  5MN5 A;  2GVI A;  5HY1 A;  3LME A;  5EAZ A;  3CC4 F;  4EI9 A;  5GAP K;  3VTI C;  1VH8 A;  1U3P A;  3HKD B;  3KJK A;  3RA6 A;  2HQS C;  5JCO C;  2KTV A;  5CB4 A;  1ZWZ A;  2JNB A;  4TUY B;  5IJ0 B;  1X25 A;  3RYF B;  2LBW A;  4YJ3 A;  3VYT C;  1VQO F;  2OHW A;  2OTL F;  3CMA F;  4O4I B;  3RE3 A;  4ZHY B;  2BTQ B;  1YJW F;  1W2B F;  2HP3 A;  5EWR A;  1KC8 H;  3WGK A;  1Q86 H;  3VCZ A;  5JH7 B;  3JAS A;  4X20 B;  1GO0 A;  3OON A;  2BTO A;  3HKB B;  3IEQ A;  3EOR A;  1ONI A;  3K12 A;  3IEW A;  1W40 A;  3I7T A;  3RA5 A;  2LBX A;  2H8C A;  1W41 A;  2LCA A;  3WJP A;  3S02 A;  1KNK A;  4EB6 B;  1J7H A;  3LYB A;  1JFF B;  3HKE B;  5LXT B;  3FFM A;  3QTY A;  3CCE F;  3CPQ A;  1E7K A;  2DT4 A;  4BT2 A;  4X1Y B;  1GZ0 A;  3JAK A;  5JQG B;  1RLG A;  1TVK A;  4HNA A;  5AVM A;  3CME F;  3VOB A;  5A2Q M;  1W3E X;  3OW2 F;  3RYH B;  2KGW A;  2PMP A;  4TV8 B;  4YJ2 B;  5CA1 B;  1VQN F;  5LP6 C;  4G4W A;  3DC2 A;  5IJ9 A;  5EO3 A;  2CWJ A;  3NK7 A;  4PWT A;  3CPW F;  5JCO A;  3RYI A;  1GO1 A;  3D01 A;  3ZP4 A;  3S03 A;  5KX5 A;  1NMU B;  1XHO A;  4BVT A;  3CCJ F;  1JD1 A;  3R0P A;  1SA0 B;  1YGY A;  4O2B A;  1KD1 H;  4O4J B;  3K0T A;  3VYU C;  4X1K A;  3HKC B;  3N2G A;  3P10 A;  5EB0 A;  2OTJ F;  4X1I B;  5DCV A;  5EZY A;  4O2A A;  4B45 A;  2Z1U A;  1FSZ A;  4FFB B;  1VQ8 F;  2HRU A;  3CC7 F;  3IKE A;  3HKD A;  3S06 A;  4R40 B;  3V4D A;  3LFO A;  1VQ9 F;  3J80 M;  2QI2 A;  3F6M A;  3MCQ A;  2KTU A;  4TUY A;  4U39 A;  2UYP A;  5IJ0 A;  2VGN A;  2RHL A;  2IQQ A;  3RYF A;  3K14 A;  4I55 B;  1W5E A;  4O2B B;  1X7P A;  4XCQ A;  3C8L A;  4O4I A;  4BY9 D;  3V7Q A;  1SZQ A;  1KNJ A;  4C4W C;  3WGJ A;  3CCR F;  3NVI B;  1W58 1;  1W42 A;  5FLX M;  2P6Y A;  3JAW B;  3OBW A;  4M8I A;  2ALE A;  5ITZ B;  5JH7 A;  1RQ2 A;  4X20 A;  4LNU B;  3HKB A;  4X3L A;  2CZW A;  3ZP7 A;  2WAL A;  3F0D A;  1VQP F;  3PLA C;  1VQL F;  4B46 A;  3CCQ F;  2V9Y A;  5EYP B;  4EB6 A;  3G4S F;  3ZO8 A;  3ERN A;  4TV9 B;  1JFF A;  3HKE A;  5LXT A;  3KIZ A;  1T0K B;  3CCM F;  3UT5 B;  3QHD A;  3IKF A;  5CA0 B;  1YHQ F;  2ZF8 A;  5GIP C;  5LYJ B;  4X1Y A;  5JQG A;  3CB2 A;  2L26 A;  1PF5 A;  4ZOL B;  3N2K B;  4C8G A;  3ZOP A;  1OFU A;  4E6E A;  3VO8 A;  1Q82 H;  3RYH A;  5LP6 B;  3C9R A;  2VAM A;  1QVG F;  5GON B; 
#chains in the Genus database with same CATH homology
 3ON1 A;  4BVS A;  3CCL F;  1VQ4 F;  1IPA A;  3HAX D;  5GIO C;  5G4V C;  3IR9 A;  3LWV C;  4X3M A;  1VQN F;  2QA4 F;  1S72 F;  3LWO C;  5HY4 A;  5EO3 A;  1X7O A;  3NK7 A;  3CPW F;  1SDS A;  1K73 H;  1VQ7 F;  1YJN F;  1GO1 A;  3JAM M;  1VQK F;  1X52 A;  1NMU B;  4BVR A;  5HY0 A;  4BVT A;  1M1K H;  3GYQ A;  3CCJ F;  1VQ5 F;  3E20 B;  3LWQ C;  3CD6 F;  3V7E A;  3NK6 A;  3HJW C;  1XBI A;  3OBY A;  5HXU A;  3AGK A;  1YIT F;  1Q7Y H;  1KD1 H;  1M90 H;  1RA4 A;  2AIF A;  5GIN C;  5HY2 A;  1CK2 A;  1K8A H;  2OTJ F;  3O85 A;  3CCU F;  5DCV A;  2FGY A;  2KG4 A;  3VI6 A;  1VQ6 F;  1QVF F;  3NMU C;  3LWR C;  2BO1 A;  2HVY D;  5HWE A;  2VGM A;  3E1Y A;  3I55 F;  1VQ8 F;  1K9M H;  2QEX F;  3N4Z A;  3JCM M;  3N4Y A;  3CC7 F;  3VMF B;  5HY1 A;  1VQM F;  3LFO A;  4LCK A;  3CC4 F;  1YI2 F;  1VQ9 F;  1H7M A;  3J80 M;  2QI2 A;  4EI9 A;  5GAP K;  1KQS F;  2KTU A;  3LWP C;  3CCV F;  2VGN A;  3RA6 A;  4BVQ A;  3CCS F;  4XCQ A;  1X7P A;  2KTV A;  1ZWZ A;  2JNB A;  4BW0 B;  3PAF A;  4BY9 D;  3V7Q A;  4C4W C;  2LBW A;  1CN7 A;  1VQO F;  4EI8 A;  2OHW A;  2OTL F;  3CMA F;  3CCR F;  4EI7 A;  3NVI B;  1W42 A;  4TZZ A;  5FLX M;  3J81 M;  3OBW A;  3D00 A;  2ALE A;  2GLZ A;  1YJW F;  1W2B F;  2FC3 A;  1PXW A;  5FJ4 C;  5EWR A;  1KC8 H;  1JJ2 F;  4X3L A;  2CZW A;  4NUT A;  1Q86 H;  5G4U C;  5HXZ A;  1QVG F;  2F9Z C;  4NQ3 A;  1DT9 A;  3G71 F;  3SIU A;  2WAL A;  1VQP F;  3PLA C;  1GO0 A;  1VQL F;  3CCQ F;  1W40 A;  3NVK E;  3RA5 A;  3MCA B;  3G4S F;  2LBX A;  3I56 F;  1W41 A;  3CC2 F;  3SIV A;  1Q81 H;  5IT9 M;  1T0K B;  1NJI H;  3CCM F;  1YIJ F;  3FFM A;  3WXM B;  5GAN K;  3CPQ A;  3CCE F;  1YHQ F;  5GIP C;  1E7K A;  3J7A R;  1N8R H;  3CG6 A;  2OZB A;  3G6E F;  1GZ0 A;  1RLG A;  2I6D A;  3V3T A;  1Q82 H;  3CXC F;  3CME F;  5A2Q M;  1YJ9 F;  1W3E X;  3OW2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...