5GINC

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ginC00
5EWRA 3CC7F 1QVGF 2QA4F 1W41A 1RLGA 3PAFA 3G4SF 1ZWZA 1KC8H 2LBXA 3AGKA 5GIOC 1YJ9F 1YJNF 3V7EA 1KD1H 1YITF 5IT9M 3CCMF 3OBYA 1GO0A 4BW0B 1M1KH 1W40A 1S72F 3CCSF 3CCJF 2JNBA 1YJWF 1GZ0A 5G4UC 3WXMB 2KTVA 5GIPC 3JAMM 3CCRF 3G6EF 3LWQC 1VQPF 1NJIH 1K8AH 1VQ6F 2QI2A 3OW2F 1QVFF 5GANK 2I6DA 3HAXD 3IR9A 1W42A 5GINC 4TZZA 3NMUC 1DT9A 1Q7YH 1VQ7F 3LWRC 3HJWC 5G4VC 1K73H 3VI6A 3VMFB 2KTUA 3E1YA 1W2BF 1H7MA 1VQKF 1RA4A 3I56F 3I55F 3NK6A 3CCQF 1YIJF 1YHQF 1Q82H 5FJ4C 2HVYD 2FC3A 4X3LA 3CXCF 3CC2F 3CPWF 3CCUF 1PXWA 4X3MA 1NMUB 2LBWA 3LWVC 1X7OA 3CG6A 3CCVF 1XBIA 2VGMA 1YI2F 3SIUA 3J7AR 3J80M 3G71F 4C4WC 2AIFA 5GAPK 3LWPC 1X52A 3LFOA 1M90H 3NVKE 1CN7A 2CZWA 3E20B 1VQ4F 1T0KB 1VQ5F 1VQLF 3N4YA 3OBWA 5EO3A 3GYQA 3MCAB 1GO1A 2OTLF 3LWOC 2KG4A 3NVIB 1VQMF 4LCKA 3CMAF 2OZBA 1E7KA 2VGNA 3CMEF 5FLXM 3ON1A 1JJ2F 2OHWA 1VQOF 5A2QM 4BY9D 1N8RH 2OTJF 3N4ZA 5DCVA 1Q81H 1VQ9F 2QEXF 1VQNF 4NUTA 2ALEA 1K9MH 1W3EX 3V7QA 1IPAA 2WALA 1X7PA 3J81M 3CD6F 1CK2A 3CCEF 3FFMA 3JCMM 3SIVA 3CPQA 1SDSA 3O85A 3NK7A 3RA5A 2BO1A 1KQSF 1VQ8F 3CC4F 3CCLF 3PLAC 3RA6A 1Q86H
chains in the Genus database with same CATH superfamily
2BTQB 5EWRA 3CC7F 2ZVZA 5LP6A 5HXUA 2HRYA 2CSLA 1SZQA 1W41A 3HWUA 3JALB 3B6NA 1ZWZA 2H8CA 1KC8H 4BT7A 5JCOA 2Q1YA 3JALA 3JVHA 2KGWA 1U43A 1YGYA 3RYFB 5HP7A 5LP6C 5IT9M 4BVRA 4B62A 2HX0A 1GO0A 4BW0B 3RYFA 1W40A 1S72F 3CCSF 2RHLA 2CHTA 3ELCA 1YQNA 3HKCB 2KTVA 4U3JB 3Q8HA 4ZHQB 3F6MA 3HKCA 4U3JA 1VQPF 2YYEA 4ZHQA 3OW2F 1QVFF 2VAMA 3HAXD 1NQ3A 1W42A 4X1KB 3S02A 3TD4A 2NMUA 1Q7YH 5G4VC 3MBMA 2BTOA 4X1KA 3VMFB 3WGLA 1RLUA 1RA4A 1Q8RA 1Q82H 1YIJF 1YHQF 4TV9A 5FJ4C 2FC3A 3CXCF 5MN4A 1U3LA 1H48A 3K0TA 3IKEA 2LBWA 1X7OA 2ZF8A 3RYIB 5BMVB 3J80M 3LDTA 3ZOPA 1W5EA 5GAPK 1CLIA 1M90H 5EYPB 5BMVA 3LYBA 3TD5A 1Z5WA 4ZK7A 5LA6B 3N2KB 3M4SA 1JN1A 4I55B 1XHOA 3FD5A 4XCQA 3N2KA 5LA6A 4G4XA 3OBWA 3C8LA 3QTYA 2AMTA 3VOAA 1GO1A 4NWOB 4I50B 1W55A 2KG4A 3LWOC 5LOVB 3P0ZA 1DBFA 4ZOLB 2OZBA 1E7KA 5LOVA 3CMEF 3BYQA 3FPIA 3ON1A 4ZOLA 1ODEA 3UT5B 3F0FA 1IV2A 3IEQA 5C8YA 5IJ9A 3N4ZA 3HKBB 1PF5A 2VXYA 3VOBA 1VQNF 3HKBA 5EIBD 1W581 2IQQA 3J81M 1CK2A 3CCEF 2Z01A 3HKEB 1OFUA 4X1YB 4O4JB 3U0OA 4G4WA 2HP3A 3HTNA 3HKEA 3V4DA 3NK7A 4O4JA 5ITZB 4O4IB 2EWCA 5ITZA 3E22A 3RYCB 1FNKA 4O4IA 3RYCA 2QA4F 5FNVB 2L26A 1OAPA 2V9YA 3PAFA 3G4SF 5FNVA 5GIOC 1YJ9F 1W57A 4ZHVA 4PWTA 3VYTC 3JARB 5JVDA 1M1KH 3ZP7A 5HP8A 4ERHA 5IJ0B 3RYHB 1YJWF 1H47A 1GZ0A 4KWEA 3EORA 1VK3A 4U39A 5G4UC 2RHJA 5IJ0A 3RYHA 5GIPC 1QU9A 3G6EF 4HNAA 4NQ3A 3VYUC 2P6YA 3M1XA 3NMUC 1DT9A 3HJWC 3P10A 2YXZA 4BVQA 4EI9A 1K73H 3LMEA 3E1YA 3I55F 2CVLA 5J2TB 1VHAA 3CC2F 4G4ZA 5J2TA 1PXWA 3GTZA 5JCOC 3CG6A 4O2AB 2Z1TA 3P4EA 5JH7B 1YI2F 4WBNB 3G71F 4C8IA 4O2AA 4C4WC 2AIFA 4BT3A 5JH7A 1CN7A 1W59A 4WBNA 2FGYA 3E20B 3F0EA 3K12A 4BT5A 1QD9A 2G9IA 2ZVYA 4TV9B 3KE1A 3GYQA 4IHJB 2CW4A 2Z1UA 4IHJA 3CMAF 4O4LA 4YJ2B 3V3TA 5EB1B 5FLXM 2F9ZC 1JJ2F 4YJ2A 1VQOF 4BY9D 2K1SA 2OTJF 5DCVA 3WGNA 2CWJA 3ERNA 3F0DA 1W3EX 5J2UB 3KJKA 2ZAUA 3V7QA 3S06A 3HKDB 3MDOA 1X7PA 4BT4A 5J2UA 3HKDA 2IG8A 1FSZA 3MCQA 2GVIA 3CPQA 2BO1A 1KQSF 3CC4F 3JAKB 1GX1A 2HQSC 3C9RA 3RA6A 3CCRF 5C8YB 3JAKA 5IJ9B 3M84A 2VAWA 4BT2A 5B8FA 1QVGF 2PHNA 4RHAA 1RLGA 2LBXA 1YJNF 4TUYB 4B45A 3CYQA 1YITF 2MQEA 1W5BA 2GZLA 4TUYA 3OBYA 2H6LA 2CHSA 4R40B 3CCJF 3N2GA 3JAWB 3WJQA 3JASB 5JQGB 3WXMB 3JAWA 3E22B 1FFXB 2UYKA 3JAMM 3JASA 5JQGA 2QTPA 4C8GA 3LWQC 4G4YA 1RQ2A 1K8AH 1FFXA 5KX5B 2I6DA 1UI9A 4B5CA 3IR9A 5GINC 5KX5A 2ZODA 4TZZA 4O4HB 3VI6A 4TV8B 1SA0B 3D54A 2LBTA 3T80A 2I6RA 1Z5VA 3DC2A 5GONB 5JVDB 3VIUA 3WGMA 4EB6B 1W2BF 4O4HA 3I56F 4TV8A 3NK6A 3CB2A 1SA0A 3WPXA 5LYJA 5GONA 4X3LA 4EB6A 2W8BC 3ESJA 2B33A 4EI7A 3C9UA 1U3PA 4X3MA 3CCUF 4G88A 1NMUB 3WJPA 1IV1A 3J7AR 4HNAB 4X1IB 5HWEA 4RQOA 2Z1FA 3I7TA 2HP0B 4LNUB 3IKFA 4X1IA 5EAZA 1X52A 3LFOA 2HP0A 3F0GA 4LNUA 2CZWA 4YJ3A 3K14A 5MN5A 4I4TB 2DT4A 1JD1A 3N4YA 1XV2A 3IEWA 4I4TA 5HY2A 5EIBC 5EB0A 3MCAB 4BVSA 4DRXA 4LCKA 4IIJB 5HY1A 3S0WA 3C9SA 5LXTA 1JY8A 2VGNA 4IIJA 5EZYB 2OHWA 3GHZA 1J7HA 4O2BB 4B46A 1Q81H 1VQ9F 5EZYA 3IMPA 5HXZA 4C82A 5HY0A 2ALEA 4O2BA 1K9MH 1W5AA 3CD6F 1COMA 3FFMA 5KMGB 3SIVA 2VAPA 4O4LB 3O85A 5KMGA 1IV4A 3RA5A 2OTMA 4BVTA 1VQ8F 3QUWA 3L7QA 2UYPA 3CCLF 4G4VA 4ZHWA 4M8IA 3RE3A 4E6EA 5CB4B 3VO8A 1T0AA 3ZP4A 4DXDA 5CB4A 2UZHA 5IYZB 3AGKA 1TVKB 3V7EA 2ZOVA 1X25A 3VCZA 5IYZA 1KD1H 2HS0A 3CCMF 1TVKA 2RHHA 3K2XA 3FBAA 1FNJA 2JNBA 1QAHA 2Z1EA 2GLZA 1UFYA 2UYNB 1U40A 3C9TA 3RYIA 3S0YA 2PMPA 5HY4A 1NJIH 1VQ6F 2QI2A 3ZO8A 2UYNA 5GANK 1RQ7A 2DYYA 3WPWA 5EYPA 3D01A 1VH8A 2Q1XA 2RHOA 3LWRC 2N48A 1VQ7F 2AIZP 2KTUA 3S0HA 2H8EA 1H7MA 4I55A 1VQKF 4F6RB 3CCQF 3DDNA 1KNKA 2HVYD 3N2GB 4F6RA 3CPWF 3OONA 3S03A 4I50A 2BTUA 3LWVC 3SIUA 3CCVF 1XBIA 2VGMA 1W5FA 5MN6A 3I3FA 3MQWA 3R0PA 1R1MA 3VTIC 3UT5A 3LWPC 1XRGA 3NVKE 1VQ4F 4ZHYB 4FFBB 1T0KB 1VQ5F 5AVMA 4EI8A 1VQLF 5LYJB 4FFBA 3WGKA 2HRUA 3CYPB 2LCAA 5EO3A 2R751 2UYJA 2OTLF 3D00A 3NVIB 1VQMF 4X1YA 2HS4A 2R6R1 3KJJA 3KHNA 3QHDA 2RB9A 4C81A 3TD3A 5CA0B 3VYSC 5A2QM 1N8RH 4ZI7B 1KNJA 5CA0A 4YJ3B 2QEXF 1VQVA 4NUTA 4ZI7A 4X20B 1JFFB 3WJRA 1TUBB 3WGJA 4X20A 3JATB 1JFFA 1IPAA 2WALA 1TUBA 4BT6A 3JATA 3JCMM 4DRXB 3JARA 5CA1B 5LXTB 1SDSA 1IV3A 3FD6A 4C8EA 5CA1A 3KIZA 1ONIA 2IAFA 2HS3A 5LP6B 3PLAC 1Q86H
chains in the Genus database with same CATH topology
5EWRA 3CC7F 1QVGF 5HXUA 2QA4F 1W41A 1RLGA 3PAFA 3G4SF 1ZWZA 1KC8H 2LBXA 3AGKA 5GIOC 1YJ9F 1YJNF 3V7EA 1KD1H 1YITF 5IT9M 4BVRA 3CCMF 3OBYA 1GO0A 4BW0B 1M1KH 1W40A 1S72F 3CCSF 3CCJF 2JNBA 1YJWF 1GZ0A 5G4UC 3WXMB 2KTVA 2GLZA 5GIPC 3JAMM 3CCRF 3G6EF 5HY4A 3LWQC 1VQPF 4NQ3A 1NJIH 2QI2A 3OW2F 1K8AH 1VQ6F 1QVFF 5GANK 2I6DA 3HAXD 3IR9A 1W42A 5GINC 4TZZA 3NMUC 1DT9A 1Q7YH 1VQ7F 4EI9A 3LWRC 4BVQA 5G4VC 3HJWC 1K73H 3VI6A 3VMFB 2KTUA 3E1YA 1W2BF 1H7MA 1VQKF 1RA4A 3I56F 3I55F 3NK6A 3CCQF 1YIJF 1YHQF 1Q82H 5FJ4C 2HVYD 2FC3A 4X3LA 3CXCF 3CC2F 3CPWF 4EI7A 3CCUF 1PXWA 4X3MA 1NMUB 2LBWA 3LWVC 1X7OA 3CG6A 3CCVF 1XBIA 2VGMA 1YI2F 3SIUA 3J7AR 5HWEA 3J80M 3G71F 4C4WC 2AIFA 5GAPK 3LWPC 1X52A 3LFOA 1M90H 3NVKE 1CN7A 2FGYA 2CZWA 3E20B 1VQ4F 1T0KB 1VQ5F 4XCQA 4EI8A 1VQLF 3N4YA 3OBWA 5EO3A 5HY2A 3GYQA 3MCAB 1GO1A 2OTLF 3D00A 4BVSA 2KG4A 3LWOC 3NVIB 1VQMF 4LCKA 5HY1A 3CMAF 2OZBA 1E7KA 3V3TA 2VGNA 3CMEF 5FLXM 2F9ZC 3ON1A 1JJ2F 2OHWA 1VQOF 5A2QM 4BY9D 1N8RH 2OTJF 3N4ZA 5DCVA 1Q81H 1VQ9F 2QEXF 5HXZA 1VQNF 5HY0A 4NUTA 2ALEA 1K9MH 1W3EX 3V7QA 1IPAA 2WALA 1X7PA 3J81M 3CD6F 1CK2A 3CCEF 3FFMA 3JCMM 3SIVA 3CPQA 1SDSA 3O85A 3NK7A 3RA5A 4BVTA 2BO1A 1KQSF 1VQ8F 3CC4F 3CCLF 3PLAC 3RA6A 1Q86H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWR A;  3CC7 F;  1QVG F;  2QA4 F;  1W41 A;  1RLG A;  3PAF A;  3G4S F;  1ZWZ A;  1KC8 H;  2LBX A;  3AGK A;  5GIO C;  1YJ9 F;  1YJN F;  3V7E A;  1KD1 H;  1YIT F;  5IT9 M;  3CCM F;  3OBY A;  1GO0 A;  4BW0 B;  1M1K H;  1W40 A;  1S72 F;  3CCS F;  3CCJ F;  2JNB A;  1YJW F;  1GZ0 A;  5G4U C;  3WXM B;  2KTV A;  5GIP C;  3JAM M;  3CCR F;  3G6E F;  3LWQ C;  1VQP F;  1NJI H;  1K8A H;  1VQ6 F;  2QI2 A;  3OW2 F;  1QVF F;  5GAN K;  2I6D A;  3HAX D;  3IR9 A;  1W42 A;  5GIN C;  4TZZ A;  3NMU C;  1DT9 A;  1Q7Y H;  1VQ7 F;  3LWR C;  3HJW C;  5G4V C;  1K73 H;  3VI6 A;  3VMF B;  2KTU A;  3E1Y A;  1W2B F;  1H7M A;  1VQK F;  1RA4 A;  3I56 F;  3I55 F;  3NK6 A;  3CCQ F;  1YIJ F;  1YHQ F;  1Q82 H;  5FJ4 C;  2HVY D;  2FC3 A;  4X3L A;  3CXC F;  3CC2 F;  3CPW F;  3CCU F;  1PXW A;  4X3M A;  1NMU B;  2LBW A;  3LWV C;  1X7O A;  3CG6 A;  3CCV F;  1XBI A;  2VGM A;  1YI2 F;  3SIU A;  3J7A R;  3J80 M;  3G71 F;  4C4W C;  2AIF A;  5GAP K;  3LWP C;  1X52 A;  3LFO A;  1M90 H;  3NVK E;  1CN7 A;  2CZW A;  3E20 B;  1VQ4 F;  1T0K B;  1VQ5 F;  1VQL F;  3N4Y A;  3OBW A;  5EO3 A;  3GYQ A;  3MCA B;  1GO1 A;  2OTL F;  3LWO C;  2KG4 A;  3NVI B;  1VQM F;  4LCK A;  3CMA F;  2OZB A;  1E7K A;  2VGN A;  3CME F;  5FLX M;  3ON1 A;  1JJ2 F;  2OHW A;  1VQO F;  5A2Q M;  4BY9 D;  1N8R H;  2OTJ F;  3N4Z A;  5DCV A;  1Q81 H;  1VQ9 F;  2QEX F;  1VQN F;  4NUT A;  2ALE A;  1K9M H;  1W3E X;  3V7Q A;  1IPA A;  2WAL A;  1X7P A;  3J81 M;  3CD6 F;  1CK2 A;  3CCE F;  3FFM A;  3JCM M;  3SIV A;  3CPQ A;  1SDS A;  3O85 A;  3NK7 A;  3RA5 A;  2BO1 A;  1KQS F;  1VQ8 F;  3CC4 F;  3CCL F;  3PLA C;  3RA6 A;  1Q86 H; 
#chains in the Genus database with same CATH topology
 2BTQ B;  5EWR A;  3CC7 F;  2ZVZ A;  5LP6 A;  5HXU A;  2HRY A;  2CSL A;  1SZQ A;  1W41 A;  3HWU A;  3JAL B;  3B6N A;  1ZWZ A;  2H8C A;  1KC8 H;  4BT7 A;  5JCO A;  2Q1Y A;  3JAL A;  3JVH A;  2KGW A;  1U43 A;  1YGY A;  3RYF B;  5HP7 A;  5LP6 C;  5IT9 M;  4BVR A;  4B62 A;  2HX0 A;  1GO0 A;  4BW0 B;  3RYF A;  1W40 A;  1S72 F;  3CCS F;  2RHL A;  2CHT A;  3ELC A;  1YQN A;  3HKC B;  2KTV A;  4U3J B;  3Q8H A;  4ZHQ B;  3F6M A;  3HKC A;  4U3J A;  1VQP F;  2YYE A;  4ZHQ A;  3OW2 F;  1QVF F;  2VAM A;  3HAX D;  1NQ3 A;  1W42 A;  4X1K B;  3S02 A;  3TD4 A;  2NMU A;  1Q7Y H;  5G4V C;  3MBM A;  2BTO A;  4X1K A;  3VMF B;  3WGL A;  1RLU A;  1RA4 A;  1Q8R A;  1Q82 H;  1YIJ F;  1YHQ F;  4TV9 A;  5FJ4 C;  2FC3 A;  3CXC F;  5MN4 A;  1U3L A;  1H48 A;  3K0T A;  3IKE A;  2LBW A;  1X7O A;  2ZF8 A;  3RYI B;  5BMV B;  3J80 M;  3LDT A;  3ZOP A;  1W5E A;  5GAP K;  1CLI A;  1M90 H;  5EYP B;  5BMV A;  3LYB A;  3TD5 A;  1Z5W A;  4ZK7 A;  5LA6 B;  3N2K B;  3M4S A;  1JN1 A;  4I55 B;  1XHO A;  3FD5 A;  4XCQ A;  3N2K A;  5LA6 A;  4G4X A;  3OBW A;  3C8L A;  3QTY A;  2AMT A;  3VOA A;  1GO1 A;  4NWO B;  4I50 B;  1W55 A;  2KG4 A;  3LWO C;  5LOV B;  3P0Z A;  1DBF A;  4ZOL B;  2OZB A;  1E7K A;  5LOV A;  3CME F;  3BYQ A;  3FPI A;  3ON1 A;  4ZOL A;  1ODE A;  3UT5 B;  3F0F A;  1IV2 A;  3IEQ A;  5C8Y A;  5IJ9 A;  3N4Z A;  3HKB B;  1PF5 A;  2VXY A;  3VOB A;  1VQN F;  3HKB A;  5EIB D;  1W58 1;  2IQQ A;  3J81 M;  1CK2 A;  3CCE F;  2Z01 A;  3HKE B;  1OFU A;  4X1Y B;  4O4J B;  3U0O A;  4G4W A;  2HP3 A;  3HTN A;  3HKE A;  3V4D A;  3NK7 A;  4O4J A;  5ITZ B;  4O4I B;  2EWC A;  5ITZ A;  3E22 A;  3RYC B;  1FNK A;  4O4I A;  3RYC A;  2QA4 F;  5FNV B;  2L26 A;  1OAP A;  2V9Y A;  3PAF A;  3G4S F;  5FNV A;  5GIO C;  1YJ9 F;  1W57 A;  4ZHV A;  4PWT A;  3VYT C;  3JAR B;  5JVD A;  1M1K H;  3ZP7 A;  5HP8 A;  4ERH A;  5IJ0 B;  3RYH B;  1YJW F;  1H47 A;  1GZ0 A;  4KWE A;  3EOR A;  1VK3 A;  4U39 A;  5G4U C;  2RHJ A;  5IJ0 A;  3RYH A;  5GIP C;  1QU9 A;  3G6E F;  4HNA A;  4NQ3 A;  3VYU C;  2P6Y A;  3M1X A;  3NMU C;  1DT9 A;  3HJW C;  3P10 A;  2YXZ A;  4BVQ A;  4EI9 A;  1K73 H;  3LME A;  3E1Y A;  3I55 F;  2CVL A;  5J2T B;  1VHA A;  3CC2 F;  4G4Z A;  5J2T A;  1PXW A;  3GTZ A;  5JCO C;  3CG6 A;  4O2A B;  2Z1T A;  3P4E A;  5JH7 B;  1YI2 F;  4WBN B;  3G71 F;  4C8I A;  4O2A A;  4C4W C;  2AIF A;  4BT3 A;  5JH7 A;  1CN7 A;  1W59 A;  4WBN A;  2FGY A;  3E20 B;  3F0E A;  3K12 A;  4BT5 A;  1QD9 A;  2G9I A;  2ZVY A;  4TV9 B;  3KE1 A;  3GYQ A;  4IHJ B;  2CW4 A;  2Z1U A;  4IHJ A;  3CMA F;  4O4L A;  4YJ2 B;  3V3T A;  5EB1 B;  5FLX M;  2F9Z C;  1JJ2 F;  4YJ2 A;  1VQO F;  4BY9 D;  2K1S A;  2OTJ F;  5DCV A;  3WGN A;  2CWJ A;  3ERN A;  3F0D A;  1W3E X;  5J2U B;  3KJK A;  2ZAU A;  3V7Q A;  3S06 A;  3HKD B;  3MDO A;  1X7P A;  4BT4 A;  5J2U A;  3HKD A;  2IG8 A;  1FSZ A;  3MCQ A;  2GVI A;  3CPQ A;  2BO1 A;  1KQS F;  3CC4 F;  3JAK B;  1GX1 A;  2HQS C;  3C9R A;  3RA6 A;  3CCR F;  5C8Y B;  3JAK A;  5IJ9 B;  3M84 A;  2VAW A;  4BT2 A;  5B8F A;  1QVG F;  2PHN A;  4RHA A;  1RLG A;  2LBX A;  1YJN F;  4TUY B;  4B45 A;  3CYQ A;  1YIT F;  2MQE A;  1W5B A;  2GZL A;  4TUY A;  3OBY A;  2H6L A;  2CHS A;  4R40 B;  3CCJ F;  3N2G A;  3JAW B;  3WJQ A;  3JAS B;  5JQG B;  3WXM B;  3JAW A;  3E22 B;  1FFX B;  2UYK A;  3JAM M;  3JAS A;  5JQG A;  2QTP A;  4C8G A;  3LWQ C;  4G4Y A;  1RQ2 A;  1K8A H;  1FFX A;  5KX5 B;  2I6D A;  1UI9 A;  4B5C A;  3IR9 A;  5GIN C;  5KX5 A;  2ZOD A;  4TZZ A;  4O4H B;  3VI6 A;  4TV8 B;  1SA0 B;  3D54 A;  2LBT A;  3T80 A;  2I6R A;  1Z5V A;  3DC2 A;  5GON B;  5JVD B;  3VIU A;  3WGM A;  4EB6 B;  1W2B F;  4O4H A;  3I56 F;  4TV8 A;  3NK6 A;  3CB2 A;  1SA0 A;  3WPX A;  5LYJ A;  5GON A;  4X3L A;  4EB6 A;  2W8B C;  3ESJ A;  2B33 A;  4EI7 A;  3C9U A;  1U3P A;  4X3M A;  3CCU F;  4G88 A;  1NMU B;  3WJP A;  1IV1 A;  3J7A R;  4HNA B;  4X1I B;  5HWE A;  4RQO A;  2Z1F A;  3I7T A;  2HP0 B;  4LNU B;  3IKF A;  4X1I A;  5EAZ A;  1X52 A;  3LFO A;  2HP0 A;  3F0G A;  4LNU A;  2CZW A;  4YJ3 A;  3K14 A;  5MN5 A;  4I4T B;  2DT4 A;  1JD1 A;  3N4Y A;  1XV2 A;  3IEW A;  4I4T A;  5HY2 A;  5EIB C;  5EB0 A;  3MCA B;  4BVS A;  4DRX A;  4LCK A;  4IIJ B;  5HY1 A;  3S0W A;  3C9S A;  5LXT A;  1JY8 A;  2VGN A;  4IIJ A;  5EZY B;  2OHW A;  3GHZ A;  1J7H A;  4O2B B;  4B46 A;  1Q81 H;  1VQ9 F;  5EZY A;  3IMP A;  5HXZ A;  4C82 A;  5HY0 A;  2ALE A;  4O2B A;  1K9M H;  1W5A A;  3CD6 F;  1COM A;  3FFM A;  5KMG B;  3SIV A;  2VAP A;  4O4L B;  3O85 A;  5KMG A;  1IV4 A;  3RA5 A;  2OTM A;  4BVT A;  1VQ8 F;  3QUW A;  3L7Q A;  2UYP A;  3CCL F;  4G4V A;  4ZHW A;  4M8I A;  3RE3 A;  4E6E A;  5CB4 B;  3VO8 A;  1T0A A;  3ZP4 A;  4DXD A;  5CB4 A;  2UZH A;  5IYZ B;  3AGK A;  1TVK B;  3V7E A;  2ZOV A;  1X25 A;  3VCZ A;  5IYZ A;  1KD1 H;  2HS0 A;  3CCM F;  1TVK A;  2RHH A;  3K2X A;  3FBA A;  1FNJ A;  2JNB A;  1QAH A;  2Z1E A;  2GLZ A;  1UFY A;  2UYN B;  1U40 A;  3C9T A;  3RYI A;  3S0Y A;  2PMP A;  5HY4 A;  1NJI H;  1VQ6 F;  2QI2 A;  3ZO8 A;  2UYN A;  5GAN K;  1RQ7 A;  2DYY A;  3WPW A;  5EYP A;  3D01 A;  1VH8 A;  2Q1X A;  2RHO A;  3LWR C;  2N48 A;  1VQ7 F;  2AIZ P;  2KTU A;  3S0H A;  2H8E A;  1H7M A;  4I55 A;  1VQK F;  4F6R B;  3CCQ F;  3DDN A;  1KNK A;  2HVY D;  3N2G B;  4F6R A;  3CPW F;  3OON A;  3S03 A;  4I50 A;  2BTU A;  3LWV C;  3SIU A;  3CCV F;  1XBI A;  2VGM A;  1W5F A;  5MN6 A;  3I3F A;  3MQW A;  3R0P A;  1R1M A;  3VTI C;  3UT5 A;  3LWP C;  1XRG A;  3NVK E;  1VQ4 F;  4ZHY B;  4FFB B;  1T0K B;  1VQ5 F;  5AVM A;  4EI8 A;  1VQL F;  5LYJ B;  4FFB A;  3WGK A;  2HRU A;  3CYP B;  2LCA A;  5EO3 A;  2R75 1;  2UYJ A;  2OTL F;  3D00 A;  3NVI B;  1VQM F;  4X1Y A;  2HS4 A;  2R6R 1;  3KJJ A;  3KHN A;  3QHD A;  2RB9 A;  4C81 A;  3TD3 A;  5CA0 B;  3VYS C;  5A2Q M;  1N8R H;  4ZI7 B;  1KNJ A;  5CA0 A;  4YJ3 B;  2QEX F;  1VQV A;  4NUT A;  4ZI7 A;  4X20 B;  1JFF B;  3WJR A;  1TUB B;  3WGJ A;  4X20 A;  3JAT B;  1JFF A;  1IPA A;  2WAL A;  1TUB A;  4BT6 A;  3JAT A;  3JCM M;  4DRX B;  3JAR A;  5CA1 B;  5LXT B;  1SDS A;  1IV3 A;  3FD6 A;  4C8E A;  5CA1 A;  3KIZ A;  1ONI A;  2IAF A;  2HS3 A;  5LP6 B;  3PLA C;  1Q86 H; 
#chains in the Genus database with same CATH homology
 5EWR A;  3CC7 F;  1QVG F;  5HXU A;  2QA4 F;  1W41 A;  1RLG A;  3PAF A;  3G4S F;  1ZWZ A;  1KC8 H;  2LBX A;  3AGK A;  5GIO C;  1YJ9 F;  1YJN F;  3V7E A;  1KD1 H;  1YIT F;  5IT9 M;  4BVR A;  3CCM F;  3OBY A;  1GO0 A;  4BW0 B;  1M1K H;  1W40 A;  1S72 F;  3CCS F;  3CCJ F;  2JNB A;  1YJW F;  1GZ0 A;  5G4U C;  3WXM B;  2KTV A;  2GLZ A;  5GIP C;  3JAM M;  3CCR F;  3G6E F;  5HY4 A;  3LWQ C;  1VQP F;  4NQ3 A;  1NJI H;  2QI2 A;  3OW2 F;  1K8A H;  1VQ6 F;  1QVF F;  5GAN K;  2I6D A;  3HAX D;  3IR9 A;  1W42 A;  5GIN C;  4TZZ A;  3NMU C;  1DT9 A;  1Q7Y H;  1VQ7 F;  4EI9 A;  3LWR C;  4BVQ A;  5G4V C;  3HJW C;  1K73 H;  3VI6 A;  3VMF B;  2KTU A;  3E1Y A;  1W2B F;  1H7M A;  1VQK F;  1RA4 A;  3I56 F;  3I55 F;  3NK6 A;  3CCQ F;  1YIJ F;  1YHQ F;  1Q82 H;  5FJ4 C;  2HVY D;  2FC3 A;  4X3L A;  3CXC F;  3CC2 F;  3CPW F;  4EI7 A;  3CCU F;  1PXW A;  4X3M A;  1NMU B;  2LBW A;  3LWV C;  1X7O A;  3CG6 A;  3CCV F;  1XBI A;  2VGM A;  1YI2 F;  3SIU A;  3J7A R;  5HWE A;  3J80 M;  3G71 F;  4C4W C;  2AIF A;  5GAP K;  3LWP C;  1X52 A;  3LFO A;  1M90 H;  3NVK E;  1CN7 A;  2FGY A;  2CZW A;  3E20 B;  1VQ4 F;  1T0K B;  1VQ5 F;  4XCQ A;  4EI8 A;  1VQL F;  3N4Y A;  3OBW A;  5EO3 A;  5HY2 A;  3GYQ A;  3MCA B;  1GO1 A;  2OTL F;  3D00 A;  4BVS A;  2KG4 A;  3LWO C;  3NVI B;  1VQM F;  4LCK A;  5HY1 A;  3CMA F;  2OZB A;  1E7K A;  3V3T A;  2VGN A;  3CME F;  5FLX M;  2F9Z C;  3ON1 A;  1JJ2 F;  2OHW A;  1VQO F;  5A2Q M;  4BY9 D;  1N8R H;  2OTJ F;  3N4Z A;  5DCV A;  1Q81 H;  1VQ9 F;  2QEX F;  5HXZ A;  1VQN F;  5HY0 A;  4NUT A;  2ALE A;  1K9M H;  1W3E X;  3V7Q A;  1IPA A;  2WAL A;  1X7P A;  3J81 M;  3CD6 F;  1CK2 A;  3CCE F;  3FFM A;  3JCM M;  3SIV A;  3CPQ A;  1SDS A;  3O85 A;  3NK7 A;  3RA5 A;  4BVT A;  2BO1 A;  1KQS F;  1VQ8 F;  3CC4 F;  3CCL F;  3PLA C;  3RA6 A;  1Q86 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...