5GINC

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ginC00
2CZWA 3VI6A 4C4WC 3CCUF 2BO1A 3PAFA 3CCQF 1GO0A 5FLXM 1S72F 3LFOA 3PLAC 3JAMM 2JNBA 3LWVC 3OBYA 2LBXA 1SDSA 5GIPC 3CCSF 4LCKA 3J80M 5FJ4C 1IPAA 1W41A 1W2BF 3LWRC 1K73H 3I56F 1VQKF 3HJWC 3E20B 2QEXF 1YJWF 1Q81H 3G6EF 1YI2F 3V7QA 1RLGA 1T0KB 3SIVA 3LWOC 3CC2F 4BW0B 3J7AR 1VQMF 3CG6A 3CPWF 1VQNF 1YJ9F 1X7PA 3NVKE 2ALEA 5GINC 3CCLF 5G4UC 2AIFA 1VQ5F 1NMUB 1XBIA 3N4YA 1VQPF 1Q86H 5GIOC 1KC8H 2VGMA 1YITF 5GAPK 3LWQC 4X3MA 3CD6F 2LBWA 1CK2A 1CN7A 1W40A 3JCMM 3RA6A 1ZWZA 1GZ0A 3CMAF 1K8AH 4BY9D 3FFMA 3CCVF 2OZBA 3AGKA 3G71F 1H7MA 1E7KA 2KTUA 2OHWA 1YHQF 1DT9A 1RA4A 2FC3A 4X3LA 1VQ6F 3MCAB 1X52A 2OTLF 4NUTA 3O85A 5GANK 3LWPC 1QVGF 1VQ8F 1K9MH 1VQLF 1Q7YH 1VQ9F 5IT9M 3IR9A 3CCMF 3J81M 3WXMB 2VGNA 2QI2A 3CMEF 2KG4A 3CC7F 1KD1H 5EWRA 1GO1A 2I6DA 3SIUA 1VQOF 3OBWA 2OTJF 5A2QM 4TZZA 3NMUC 1M1KH 3GYQA 3N4ZA 3NK6A 5G4VC 1Q82H 5DCVA 3CCRF 3HAXD 2KTVA 3NK7A 1VQ7F 3VMFB 3CXCF 1N8RH 3I55F 1M90H 1QVFF 3RA5A 1W42A 3E1YA 1PXWA 1KQSF 1JJ2F 2QA4F 3G4SF 1YJNF 3CCJF 3CPQA 1X7OA 5EO3A 3CCEF 3OW2F 1VQ4F 1YIJF 2HVYD 3CC4F 2WALA 3V7EA 3NVIB 1W3EX 1NJIH 3ON1A
chains in the Genus database with same CATH superfamily
4O4JB 1W5BA 3CCUF 2F9ZC 3PAFA 3HKBB 5JVDA 4IHJB 3RYIB 5FLXM 3FD5A 2MQEA 2RHJA 4F6RB 3OBYA 3WGNA 4ZHYB 5JH7B 3B6NA 3J80M 1X25A 5IJ0A 2KGWA 3CB2A 3S03A 1W2BF 3M1XA 3LWRC 2G9IA 2HP0B 2RB9A 5LYJB 5EIBD 2Z1TA 2ZF8A 3TD5A 4C8GA 5LXTB 3HKDA 1H48A 2QEXF 1Q81H 2H8EA 3G6EF 1YI2F 1QU9A 4HNAA 3D01A 3KE1A 5HP8A 3LWOC 1Z5VA 1VQMF 3DDNA 3E22A 3GHZA 4NQ3A 5CA1A 3D00A 1SA0A 3IEWA 3CCLF 5G4UC 4X1KA 1VQPF 3MBMA 5ITZA 1YITF 2W8BC 2ZOVA 2HS0A 5GAPK 3LWQC 2QTPA 2VAPA 2N48A 2LBWA 3WGMA 1CN7A 1K8AH 1GZ0A 5JCOC 3UT5A 4YJ2B 5GONA 3AGKA 3G71F 5IJ9B 4I50B 1U3LA 4LNUA 3QUWA 4BVTA 1YGYA 4BVSA 4ZOLA 3V3TA 1VQ6F 4O2AB 3ZP4A 2UZHA 3MCAB 3F0DA 3BYQA 3WGLA 4NUTA 3O85A 3F0EA 4G4WA 3C9SA 2LCAA 3WXMB 3CC7F 2VGNA 5JVDB 1KD1H 5EWRA 2I6DA 3SIUA 2NMUA 1VQOF 5A2QM 2Z01A 4TZZA 2YYEA 1M1KH 5IJ0B 1VQ7F 3VMFB 3C8LA 1Z5WA 1W42A 3MCQA 1VH8A 3HKDB 1JN1A 3TD3A 3VIUA 2QA4F 3LDTA 4HNAB 5EO3A 3CCEF 2IQQA 1YIJF 3E22B 2HVYD 3CYPB 3FBAA 3P0ZA 2RHLA 5CA1B 2VAMA 4EI7A 5KX5A 3K14A 4X1KB 4BVRA 2K1SA 2H8CA 5ITZB 4G4XA 3LYBA 3WGKA 2BO1A 3IKFA 1GO0A 5LP6C 1DBFA 1QD9A 3UT5B 3JAMM 1SZQA 1SDSA 1TUBA 5EIBC 3HKEA 5GONB 3F0FA 3U0OA 3ZP7A 4E6EA 3TD4A 3WJPA 2FGYA 4LNUB 3HKCA 5JQGA 3S0YA 4ZOLB 5EYPA 5CB4A 1VQKF 4B62A 3E20B 4O2AA 5LOVA 4ERHA 2DT4A 3WJQA 3V7QA 5KMGA 3WGJA 3I7TA 2CHTA 4TUYA 3SIVA 4BW0B 2IAFA 3P10A 5HY2A 3CPWF 3NVKE 2HX0A 2L26A 4BT2A 2AIFA 4C82A 1VQ5F 1NMUB 1XBIA 2UYKA 2Z1UA 1Q86H 5GIOC 2ZVZA 3GTZA 5EB1B 3Q8HA 2AIZP 1UFYA 4X3MA 3KJKA 2Q1YA 3RA6A 1ZWZA 3IMPA 3CMAF 3RE3A 3CYQA 5FNVA 3C9RA 4WBNA 2OZBA 1H7MA 1E7KA 4BT3A 1W57A 4DRXA 3M84A 1DT9A 1RA4A 1FNJA 4ZHQA 3QTYA 3WPWA 3D54A 5KX5B 1X52A 1JD1A 3LWPC 3ESJA 5HY4A 4G4ZA 3VYUC 2HQSC 2BTUA 1Q7YH 1VQ9F 4U3JA 3CCMF 2Z1FA 2YXZA 4X1IA 3L7QA 2QI2A 3RYCA 1GO1A 2RHOA 3OBWA 3QHDA 1TUBB 3KHNA 3HKEB 3GYQA 4IIJB 1XRGA 3JASA 4C8IA 3CCRF 2KTVA 3NK7A 3CXCF 3HKCB 1VK3A 5JQGB 3I55F 2BTOA 5EZYA 3S02A 5EYPB 1GX1A 3E1YA 5CB4B 1FFXA 5B8FA 1KQSF 3KJJA 5LOVB 1JJ2F 3F0GA 4ZK7A 5KMGB 3G4SF 3IEQA 1TVKA 1X7OA 4TUYB 1ODEA 5IYZA 3NVIB 1COMA 3VOAA 4BVQA 4C8EA 3CCJF 2RHHA 4B45A 1W581 4I55A 1OAPA 3C9UA 3CCQF 1YQNA 1S72F 4O4HA 2H6LA 2V9YA 3LFOA 4NWOB 4RHAA 2Z1EA 3PLAC 4FFBA 5FNVB 4EB6A 2AMTA 4WBNB 3CCSF 1U43A 2CW4A 3N2KA 1IPAA 1W41A 4DRXB 4G88A 1JFFA 2Q1XA 5EAZA 4O4LA 4ZHQB 4TV9A 5MN4A 1K73H 3I56F 3HJWC 2BTQB 1T0KB 3T80A 3VTIC 4U3JB 4X1IB 3RYCB 3J7AR 5HXZA 2ZAUA 3R0PA 4PWTA 2IG8A 3CG6A 5J2UA 1YJ9F 3S0WA 4EI8A 5BMVA 5GINC 1R1MA 1U40A 3N4YA 3JASB 4I4TA 4IIJA 5EZYB 2PHNA 2CSLA 1FFXB 1CK2A 1KNKA 1W40A 3JCMM 5EB0A 1W55A 4X20A 4G4VA 4BT7A 3VO8A 3FFMA 4C81A 3EORA 3JALB 3CCVF 1RLUA 1TVKB 5AVMA 2HS4A 2OHWA 2VXYA 2FC3A 4X3LA 5IYZB 1T0AA 3P4EA 1J7HA 4O4IA 2GZLA 1W5AA 5GANK 3MQWA 1PF5A 1VQLF 4I55B 5MN5A 3MDOA 5IT9M 3IR9A 1IV2A 3CMEF 3I3FA 4O4HB 3JATA 3S0HA 4FFBB 4EB6B 5JCOA 2LBTA 1H47A 3JVHA 2OTJF 3K12A 3RYHA 3NMUC 3N4ZA 3N2KB 2ZODA 3JAKA 1JFFB 3K0TA 1FNKA 4O4LB 4TV9B 1QVFF 4TV8A 3IKEA 2UYNA 1PXWA 2CWJA 4B5CA 1IV4A 1YJNF 3CPQA 3DC2A 4X1YA 1VHAA 5LA6A 3CC4F 5J2UB 3V7EA 5BMVB 1FSZA 1NQ3A 4U39A 5HXUA 1U3PA 2HS3A 3N2GA 2CZWA 3VI6A 4C4WC 3RYFA 4G4YA 4I4TB 3FPIA 4BT6A 2GVIA 4O2BA 3M4SA 4ZI7A 2I6RA 1JY8A 2GLZA 3ERNA 2JNBA 4X20B 3LWVC 2LBXA 5GIPC 3WPXA 4LCKA 5CA0A 5FJ4C 3JALA 4RQOA 3F6MA 4XCQA 3VYTC 2PMPA 5HP7A 4O4IB 1XV2A 5J2TB 4B46A 1YJWF 4YJ3A 1RLGA 1W5FA 3JAWB 3CC2F 5LP6A 1RQ7A 3JATB 5MN6A 2R6R1 5C8YA 3S06A 1VQNF 1X7PA 2ALEA 3HTNA 3LMEA 3JARA 3RYHB 2UYPA 4O4JA 3JAKB 1KC8H 1UI9A 2VGMA 4BT5A 4TV8B 3VCZA 3HKBA 2B33A 4IHJA 3HWUA 2UYNB 3RYIA 3CD6F 2HRYA 2HP3A 4BY9D 1IV3A 4F6RA 5JH7A 4ZHVA 2R751 4X1YB 1XHOA 2KTUA 5LA6B 1YHQF 1RQ2A 2VAWA 3OONA 2HP0A 1CLIA 1VQVA 5LYJA 3VOBA 3ZOPA 1KNJA 2OTLF 5LXTA 4EI9A 1QVGF 3N2GB 1ONIA 3ELCA 1VQ8F 1K9MH 3RYFB 1W59A 3KIZA 3VYSC 4O2BB 3J81M 2CVLA 4ZI7B 2DYYA 2EWCA 2KG4A 3FD6A 3V4DA 1SA0B 1Q8RA 2CHSA 3NK6A 5CA0B 5G4VC 1Q82H 4R40B 4ZHWA 5HY0A 3HAXD 5DCVA 1N8RH 5HY1A 3C9TA 4BT4A 1M90H 1IV1A 3RA5A 3K2XA 2ZVYA 2P6YA 4DXDA 3WJRA 5HWEA 1QAHA 4KWEA 1W5EA 5J2TA 4M8IA 4YJ2A 4YJ3B 1OFUA 2OTMA 3OW2F 5IJ9A 4I50A 5LP6B 1VQ4F 3JAWA 2WALA 3ZO8A 5C8YB 1W3EX 2HRUA 1NJIH 2UYJA 3JARB 3ON1A
chains in the Genus database with same CATH topology
4BVRA 2CZWA 3VI6A 4C4WC 3CCUF 2F9ZC 2BO1A 3PAFA 3CCQF 1GO0A 5FLXM 1S72F 2GLZA 3LFOA 3PLAC 3JAMM 2JNBA 3LWVC 3OBYA 2LBXA 1SDSA 5GIPC 3CCSF 4LCKA 3J80M 5FJ4C 1IPAA 2FGYA 1W41A 1W2BF 3LWRC 4XCQA 1K73H 3I56F 1VQKF 3HJWC 3E20B 2QEXF 1YJWF 1Q81H 3G6EF 1YI2F 3V7QA 1RLGA 1T0KB 3SIVA 3LWOC 3CC2F 4BW0B 3J7AR 1VQMF 5HXZA 5HY2A 3CG6A 3CPWF 1VQNF 1YJ9F 1X7PA 4NQ3A 3NVKE 3D00A 4EI8A 2ALEA 5GINC 3CCLF 5G4UC 2AIFA 1VQ5F 1NMUB 1XBIA 3N4YA 1VQPF 1Q86H 5GIOC 1KC8H 2VGMA 1YITF 5GAPK 3LWQC 4X3MA 3CD6F 2LBWA 1CK2A 1CN7A 1W40A 3JCMM 3RA6A 1ZWZA 1GZ0A 3CMAF 1K8AH 4BY9D 3FFMA 3CCVF 2OZBA 3AGKA 3G71F 1H7MA 1E7KA 2KTUA 2OHWA 4BVTA 1YHQF 1DT9A 1RA4A 4BVSA 2FC3A 4X3LA 3V3TA 1VQ6F 3MCAB 1X52A 2OTLF 4EI9A 4NUTA 3O85A 5GANK 3LWPC 1QVGF 1VQ8F 5HY4A 1K9MH 1VQLF 1Q7YH 1VQ9F 5IT9M 3IR9A 3CCMF 3J81M 3WXMB 2VGNA 2QI2A 3CMEF 2KG4A 3CC7F 1KD1H 5EWRA 1GO1A 2I6DA 3SIUA 1VQOF 3OBWA 2OTJF 5A2QM 4TZZA 3NMUC 1M1KH 3GYQA 3N4ZA 3NK6A 5G4VC 1Q82H 5DCVA 3CCRF 5HY0A 3HAXD 2KTVA 3NK7A 1VQ7F 3VMFB 3CXCF 1N8RH 5HY1A 3I55F 1M90H 1QVFF 3RA5A 1W42A 3E1YA 1PXWA 1KQSF 5HWEA 1JJ2F 2QA4F 3G4SF 1YJNF 3CCJF 3CPQA 1X7OA 5EO3A 3CCEF 3OW2F 1VQ4F 1YIJF 2HVYD 3CC4F 2WALA 3V7EA 3NVIB 4EI7A 1W3EX 1NJIH 5HXUA 4BVQA 3ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZW A;  3VI6 A;  4C4W C;  3CCU F;  2BO1 A;  3PAF A;  3CCQ F;  1GO0 A;  5FLX M;  1S72 F;  3LFO A;  3PLA C;  3JAM M;  2JNB A;  3LWV C;  3OBY A;  2LBX A;  1SDS A;  5GIP C;  3CCS F;  4LCK A;  3J80 M;  5FJ4 C;  1IPA A;  1W41 A;  1W2B F;  3LWR C;  1K73 H;  3I56 F;  1VQK F;  3HJW C;  3E20 B;  2QEX F;  1YJW F;  1Q81 H;  3G6E F;  1YI2 F;  3V7Q A;  1RLG A;  1T0K B;  3SIV A;  3LWO C;  3CC2 F;  4BW0 B;  3J7A R;  1VQM F;  3CG6 A;  3CPW F;  1VQN F;  1YJ9 F;  1X7P A;  3NVK E;  2ALE A;  5GIN C;  3CCL F;  5G4U C;  2AIF A;  1VQ5 F;  1NMU B;  1XBI A;  3N4Y A;  1VQP F;  1Q86 H;  5GIO C;  1KC8 H;  2VGM A;  1YIT F;  5GAP K;  3LWQ C;  4X3M A;  3CD6 F;  2LBW A;  1CK2 A;  1CN7 A;  1W40 A;  3JCM M;  3RA6 A;  1ZWZ A;  1GZ0 A;  3CMA F;  1K8A H;  4BY9 D;  3FFM A;  3CCV F;  2OZB A;  3AGK A;  3G71 F;  1H7M A;  1E7K A;  2KTU A;  2OHW A;  1YHQ F;  1DT9 A;  1RA4 A;  2FC3 A;  4X3L A;  1VQ6 F;  3MCA B;  1X52 A;  2OTL F;  4NUT A;  3O85 A;  5GAN K;  3LWP C;  1QVG F;  1VQ8 F;  1K9M H;  1VQL F;  1Q7Y H;  1VQ9 F;  5IT9 M;  3IR9 A;  3CCM F;  3J81 M;  3WXM B;  2VGN A;  2QI2 A;  3CME F;  2KG4 A;  3CC7 F;  1KD1 H;  5EWR A;  1GO1 A;  2I6D A;  3SIU A;  1VQO F;  3OBW A;  2OTJ F;  5A2Q M;  4TZZ A;  3NMU C;  1M1K H;  3GYQ A;  3N4Z A;  3NK6 A;  5G4V C;  1Q82 H;  5DCV A;  3CCR F;  3HAX D;  2KTV A;  3NK7 A;  1VQ7 F;  3VMF B;  3CXC F;  1N8R H;  3I55 F;  1M90 H;  1QVF F;  3RA5 A;  1W42 A;  3E1Y A;  1PXW A;  1KQS F;  1JJ2 F;  2QA4 F;  3G4S F;  1YJN F;  3CCJ F;  3CPQ A;  1X7O A;  5EO3 A;  3CCE F;  3OW2 F;  1VQ4 F;  1YIJ F;  2HVY D;  3CC4 F;  2WAL A;  3V7E A;  3NVI B;  1W3E X;  1NJI H;  3ON1 A; 
#chains in the Genus database with same CATH topology
 4O4J B;  1W5B A;  3CCU F;  2F9Z C;  3PAF A;  3HKB B;  5JVD A;  4IHJ B;  3RYI B;  5FLX M;  3FD5 A;  2MQE A;  2RHJ A;  4F6R B;  3OBY A;  3WGN A;  4ZHY B;  5JH7 B;  3B6N A;  3J80 M;  1X25 A;  5IJ0 A;  2KGW A;  3CB2 A;  3S03 A;  1W2B F;  3M1X A;  3LWR C;  2G9I A;  2HP0 B;  2RB9 A;  5LYJ B;  5EIB D;  2Z1T A;  2ZF8 A;  3TD5 A;  4C8G A;  5LXT B;  3HKD A;  1H48 A;  2QEX F;  1Q81 H;  2H8E A;  3G6E F;  1YI2 F;  1QU9 A;  4HNA A;  3D01 A;  3KE1 A;  5HP8 A;  3LWO C;  1Z5V A;  1VQM F;  3DDN A;  3E22 A;  3GHZ A;  4NQ3 A;  5CA1 A;  3D00 A;  1SA0 A;  3IEW A;  3CCL F;  5G4U C;  4X1K A;  1VQP F;  3MBM A;  5ITZ A;  1YIT F;  2W8B C;  2ZOV A;  2HS0 A;  5GAP K;  3LWQ C;  2QTP A;  2VAP A;  2N48 A;  2LBW A;  3WGM A;  1CN7 A;  1K8A H;  1GZ0 A;  5JCO C;  3UT5 A;  4YJ2 B;  5GON A;  3AGK A;  3G71 F;  5IJ9 B;  4I50 B;  1U3L A;  4LNU A;  3QUW A;  4BVT A;  1YGY A;  4BVS A;  4ZOL A;  3V3T A;  1VQ6 F;  4O2A B;  3ZP4 A;  2UZH A;  3MCA B;  3F0D A;  3BYQ A;  3WGL A;  4NUT A;  3O85 A;  3F0E A;  4G4W A;  3C9S A;  2LCA A;  3WXM B;  3CC7 F;  2VGN A;  5JVD B;  1KD1 H;  5EWR A;  2I6D A;  3SIU A;  2NMU A;  1VQO F;  5A2Q M;  2Z01 A;  4TZZ A;  2YYE A;  1M1K H;  5IJ0 B;  1VQ7 F;  3VMF B;  3C8L A;  1Z5W A;  1W42 A;  3MCQ A;  1VH8 A;  3HKD B;  1JN1 A;  3TD3 A;  3VIU A;  2QA4 F;  3LDT A;  4HNA B;  5EO3 A;  3CCE F;  2IQQ A;  1YIJ F;  3E22 B;  2HVY D;  3CYP B;  3FBA A;  3P0Z A;  2RHL A;  5CA1 B;  2VAM A;  4EI7 A;  5KX5 A;  3K14 A;  4X1K B;  4BVR A;  2K1S A;  2H8C A;  5ITZ B;  4G4X A;  3LYB A;  3WGK A;  2BO1 A;  3IKF A;  1GO0 A;  5LP6 C;  1DBF A;  1QD9 A;  3UT5 B;  3JAM M;  1SZQ A;  1SDS A;  1TUB A;  5EIB C;  3HKE A;  5GON B;  3F0F A;  3U0O A;  3ZP7 A;  4E6E A;  3TD4 A;  3WJP A;  2FGY A;  4LNU B;  3HKC A;  5JQG A;  3S0Y A;  4ZOL B;  5EYP A;  5CB4 A;  1VQK F;  4B62 A;  3E20 B;  4O2A A;  5LOV A;  4ERH A;  2DT4 A;  3WJQ A;  3V7Q A;  5KMG A;  3WGJ A;  3I7T A;  2CHT A;  4TUY A;  3SIV A;  4BW0 B;  2IAF A;  3P10 A;  5HY2 A;  3CPW F;  3NVK E;  2HX0 A;  2L26 A;  4BT2 A;  2AIF A;  4C82 A;  1VQ5 F;  1NMU B;  1XBI A;  2UYK A;  2Z1U A;  1Q86 H;  5GIO C;  2ZVZ A;  3GTZ A;  5EB1 B;  3Q8H A;  2AIZ P;  1UFY A;  4X3M A;  3KJK A;  2Q1Y A;  3RA6 A;  1ZWZ A;  3IMP A;  3CMA F;  3RE3 A;  3CYQ A;  5FNV A;  3C9R A;  4WBN A;  2OZB A;  1H7M A;  1E7K A;  4BT3 A;  1W57 A;  4DRX A;  3M84 A;  1DT9 A;  1RA4 A;  1FNJ A;  4ZHQ A;  3QTY A;  3WPW A;  3D54 A;  5KX5 B;  1X52 A;  1JD1 A;  3LWP C;  3ESJ A;  5HY4 A;  4G4Z A;  3VYU C;  2HQS C;  2BTU A;  1Q7Y H;  1VQ9 F;  4U3J A;  3CCM F;  2Z1F A;  2YXZ A;  4X1I A;  3L7Q A;  2QI2 A;  3RYC A;  1GO1 A;  2RHO A;  3OBW A;  3QHD A;  1TUB B;  3KHN A;  3HKE B;  3GYQ A;  4IIJ B;  1XRG A;  3JAS A;  4C8I A;  3CCR F;  2KTV A;  3NK7 A;  3CXC F;  3HKC B;  1VK3 A;  5JQG B;  3I55 F;  2BTO A;  5EZY A;  3S02 A;  5EYP B;  1GX1 A;  3E1Y A;  5CB4 B;  1FFX A;  5B8F A;  1KQS F;  3KJJ A;  5LOV B;  1JJ2 F;  3F0G A;  4ZK7 A;  5KMG B;  3G4S F;  3IEQ A;  1TVK A;  1X7O A;  4TUY B;  1ODE A;  5IYZ A;  3NVI B;  1COM A;  3VOA A;  4BVQ A;  4C8E A;  3CCJ F;  2RHH A;  4B45 A;  1W58 1;  4I55 A;  1OAP A;  3C9U A;  3CCQ F;  1YQN A;  1S72 F;  4O4H A;  2H6L A;  2V9Y A;  3LFO A;  4NWO B;  4RHA A;  2Z1E A;  3PLA C;  4FFB A;  5FNV B;  4EB6 A;  2AMT A;  4WBN B;  3CCS F;  1U43 A;  2CW4 A;  3N2K A;  1IPA A;  1W41 A;  4DRX B;  4G88 A;  1JFF A;  2Q1X A;  5EAZ A;  4O4L A;  4ZHQ B;  4TV9 A;  5MN4 A;  1K73 H;  3I56 F;  3HJW C;  2BTQ B;  1T0K B;  3T80 A;  3VTI C;  4U3J B;  4X1I B;  3RYC B;  3J7A R;  5HXZ A;  2ZAU A;  3R0P A;  4PWT A;  2IG8 A;  3CG6 A;  5J2U A;  1YJ9 F;  3S0W A;  4EI8 A;  5BMV A;  5GIN C;  1R1M A;  1U40 A;  3N4Y A;  3JAS B;  4I4T A;  4IIJ A;  5EZY B;  2PHN A;  2CSL A;  1FFX B;  1CK2 A;  1KNK A;  1W40 A;  3JCM M;  5EB0 A;  1W55 A;  4X20 A;  4G4V A;  4BT7 A;  3VO8 A;  3FFM A;  4C81 A;  3EOR A;  3JAL B;  3CCV F;  1RLU A;  1TVK B;  5AVM A;  2HS4 A;  2OHW A;  2VXY A;  2FC3 A;  4X3L A;  5IYZ B;  1T0A A;  3P4E A;  1J7H A;  4O4I A;  2GZL A;  1W5A A;  5GAN K;  3MQW A;  1PF5 A;  1VQL F;  4I55 B;  5MN5 A;  3MDO A;  5IT9 M;  3IR9 A;  1IV2 A;  3CME F;  3I3F A;  4O4H B;  3JAT A;  3S0H A;  4FFB B;  4EB6 B;  5JCO A;  2LBT A;  1H47 A;  3JVH A;  2OTJ F;  3K12 A;  3RYH A;  3NMU C;  3N4Z A;  3N2K B;  2ZOD A;  3JAK A;  1JFF B;  3K0T A;  1FNK A;  4O4L B;  4TV9 B;  1QVF F;  4TV8 A;  3IKE A;  2UYN A;  1PXW A;  2CWJ A;  4B5C A;  1IV4 A;  1YJN F;  3CPQ A;  3DC2 A;  4X1Y A;  1VHA A;  5LA6 A;  3CC4 F;  5J2U B;  3V7E A;  5BMV B;  1FSZ A;  1NQ3 A;  4U39 A;  5HXU A;  1U3P A;  2HS3 A;  3N2G A;  2CZW A;  3VI6 A;  4C4W C;  3RYF A;  4G4Y A;  4I4T B;  3FPI A;  4BT6 A;  2GVI A;  4O2B A;  3M4S A;  4ZI7 A;  2I6R A;  1JY8 A;  2GLZ A;  3ERN A;  2JNB A;  4X20 B;  3LWV C;  2LBX A;  5GIP C;  3WPX A;  4LCK A;  5CA0 A;  5FJ4 C;  3JAL A;  4RQO A;  3F6M A;  4XCQ A;  3VYT C;  2PMP A;  5HP7 A;  4O4I B;  1XV2 A;  5J2T B;  4B46 A;  1YJW F;  4YJ3 A;  1RLG A;  1W5F A;  3JAW B;  3CC2 F;  5LP6 A;  1RQ7 A;  3JAT B;  5MN6 A;  2R6R 1;  5C8Y A;  3S06 A;  1VQN F;  1X7P A;  2ALE A;  3HTN A;  3LME A;  3JAR A;  3RYH B;  2UYP A;  4O4J A;  3JAK B;  1KC8 H;  1UI9 A;  2VGM A;  4BT5 A;  4TV8 B;  3VCZ A;  3HKB A;  2B33 A;  4IHJ A;  3HWU A;  2UYN B;  3RYI A;  3CD6 F;  2HRY A;  2HP3 A;  4BY9 D;  1IV3 A;  4F6R A;  5JH7 A;  4ZHV A;  2R75 1;  4X1Y B;  1XHO A;  2KTU A;  5LA6 B;  1YHQ F;  1RQ2 A;  2VAW A;  3OON A;  2HP0 A;  1CLI A;  1VQV A;  5LYJ A;  3VOB A;  3ZOP A;  1KNJ A;  2OTL F;  5LXT A;  4EI9 A;  1QVG F;  3N2G B;  1ONI A;  3ELC A;  1VQ8 F;  1K9M H;  3RYF B;  1W59 A;  3KIZ A;  3VYS C;  4O2B B;  3J81 M;  2CVL A;  4ZI7 B;  2DYY A;  2EWC A;  2KG4 A;  3FD6 A;  3V4D A;  1SA0 B;  1Q8R A;  2CHS A;  3NK6 A;  5CA0 B;  5G4V C;  1Q82 H;  4R40 B;  4ZHW A;  5HY0 A;  3HAX D;  5DCV A;  1N8R H;  5HY1 A;  3C9T A;  4BT4 A;  1M90 H;  1IV1 A;  3RA5 A;  3K2X A;  2ZVY A;  2P6Y A;  4DXD A;  3WJR A;  5HWE A;  1QAH A;  4KWE A;  1W5E A;  5J2T A;  4M8I A;  4YJ2 A;  4YJ3 B;  1OFU A;  2OTM A;  3OW2 F;  5IJ9 A;  4I50 A;  5LP6 B;  1VQ4 F;  3JAW A;  2WAL A;  3ZO8 A;  5C8Y B;  1W3E X;  2HRU A;  1NJI H;  2UYJ A;  3JAR B;  3ON1 A; 
#chains in the Genus database with same CATH homology
 4BVR A;  2CZW A;  3VI6 A;  4C4W C;  3CCU F;  2F9Z C;  2BO1 A;  3PAF A;  3CCQ F;  1GO0 A;  5FLX M;  1S72 F;  2GLZ A;  3LFO A;  3PLA C;  3JAM M;  2JNB A;  3LWV C;  3OBY A;  2LBX A;  1SDS A;  5GIP C;  3CCS F;  4LCK A;  3J80 M;  5FJ4 C;  1IPA A;  2FGY A;  1W41 A;  1W2B F;  3LWR C;  4XCQ A;  1K73 H;  3I56 F;  1VQK F;  3HJW C;  3E20 B;  2QEX F;  1YJW F;  1Q81 H;  3G6E F;  1YI2 F;  3V7Q A;  1RLG A;  1T0K B;  3SIV A;  3LWO C;  3CC2 F;  4BW0 B;  3J7A R;  1VQM F;  5HXZ A;  5HY2 A;  3CG6 A;  3CPW F;  1VQN F;  1YJ9 F;  1X7P A;  4NQ3 A;  3NVK E;  3D00 A;  4EI8 A;  2ALE A;  5GIN C;  3CCL F;  5G4U C;  2AIF A;  1VQ5 F;  1NMU B;  1XBI A;  3N4Y A;  1VQP F;  1Q86 H;  5GIO C;  1KC8 H;  2VGM A;  1YIT F;  5GAP K;  3LWQ C;  4X3M A;  3CD6 F;  2LBW A;  1CK2 A;  1CN7 A;  1W40 A;  3JCM M;  3RA6 A;  1ZWZ A;  1GZ0 A;  3CMA F;  1K8A H;  4BY9 D;  3FFM A;  3CCV F;  2OZB A;  3AGK A;  3G71 F;  1H7M A;  1E7K A;  2KTU A;  2OHW A;  4BVT A;  1YHQ F;  1DT9 A;  1RA4 A;  4BVS A;  2FC3 A;  4X3L A;  3V3T A;  1VQ6 F;  3MCA B;  1X52 A;  2OTL F;  4EI9 A;  4NUT A;  3O85 A;  5GAN K;  3LWP C;  1QVG F;  1VQ8 F;  5HY4 A;  1K9M H;  1VQL F;  1Q7Y H;  1VQ9 F;  5IT9 M;  3IR9 A;  3CCM F;  3J81 M;  3WXM B;  2VGN A;  2QI2 A;  3CME F;  2KG4 A;  3CC7 F;  1KD1 H;  5EWR A;  1GO1 A;  2I6D A;  3SIU A;  1VQO F;  3OBW A;  2OTJ F;  5A2Q M;  4TZZ A;  3NMU C;  1M1K H;  3GYQ A;  3N4Z A;  3NK6 A;  5G4V C;  1Q82 H;  5DCV A;  3CCR F;  5HY0 A;  3HAX D;  2KTV A;  3NK7 A;  1VQ7 F;  3VMF B;  3CXC F;  1N8R H;  5HY1 A;  3I55 F;  1M90 H;  1QVF F;  3RA5 A;  1W42 A;  3E1Y A;  1PXW A;  1KQS F;  5HWE A;  1JJ2 F;  2QA4 F;  3G4S F;  1YJN F;  3CCJ F;  3CPQ A;  1X7O A;  5EO3 A;  3CCE F;  3OW2 F;  1VQ4 F;  1YIJ F;  2HVY D;  3CC4 F;  2WAL A;  3V7E A;  3NVI B;  4EI7 A;  1W3E X;  1NJI H;  5HXU A;  4BVQ A;  3ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...