5GINC

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ginC00
1K73H 3V7QA 3CMAF 3J7AR 3NVKE 1Q81H 2FC3A 2AIFA 1M90H 3CC4F 2QI2A 3N4YA 1ZWZA 3G6EF 1GZ0A 1W41A 3CPWF 3OBYA 5EO3A 2OZBA 3O85A 3ON1A 1T0KB 5G4VC 5GIOC 3GYQA 2HVYD 3NVIB 3LWQC 3E20B 3JAMM 1W3EX 5FJ4C 3CCQF 1VQ5F 1VQMF 3LWOC 1SDSA 1VQNF 3AGKA 3I56F 4BW0B 2KG4A 3CCLF 1VQ7F 3I55F 3CMEF 1XBIA 1YJ9F 3MCAB 3WXMB 1JJ2F 1QVFF 3FFMA 4TZZA 1K9MH 1VQKF 3CCEF 5GIPC 5FLXM 1S72F 1E7KA 2WALA 1PXWA 1W42A 1VQLF 3CCRF 1GO0A 3G4SF 2LBXA 3N4ZA 1KD1H 3CCMF 2QA4F 5A2QM 1VQ4F 2VGNA 2OTLF 1Q7YH 3LWVC 1VQPF 1NJIH 2OHWA 1KC8H 1RLGA 3CD6F 2QEXF 5IT9M 1Q82H 3HAXD 3SIVA 3RA5A 3CPQA 1YITF 3LWRC 3E1YA 1W40A 3HJWC 3SIUA 5G4UC 3OW2F 4BY9D 3LFOA 4X3MA 2LBWA 1YIJF 4NUTA 3PLAC 1RA4A 3J80M 2BO1A 1VQ9F 3LWPC 3CC7F 1VQOF 4LCKA 3NK7A 1YHQF 2I6DA 1CN7A 3IR9A 1X52A 3G71F 3JCMM 1N8RH 3V7EA 1YJNF 1KQSF 1X7PA 3CC2F 1W2BF 4X3LA 1VQ6F 3VMFB 2CZWA 5EWRA 3VI6A 1DT9A 1CK2A 4C4WC 1YI2F 1GO1A 1M1KH 3CXCF 3NMUC 2KTVA 5GANK 3PAFA 1YJWF 1VQ8F 2ALEA 3CCSF 1K8AH 3OBWA 5DCVA 1NMUB 3CCVF 2JNBA 3NK6A 1Q86H 1IPAA 3RA6A 2KTUA 5GINC 3CCJF 2OTJF 3CG6A 3CCUF 1X7OA 2VGMA 1H7MA 5GAPK 3J81M 1QVGF
chains in the Genus database with same CATH superfamily
3I7TA 3UT5B 3CMAF 4U39A 2Z1UA 1FFXA 4DRXB 5LOVB 1M90H 4ERHA 4IIJB 1U3PA 3JATA 1GZ0A 3IKFA 3OBYA 5EO3A 3D54A 3ON1A 1T0KB 2IAFA 5GIOC 3NVIB 4BT4A 1KNKA 3WPXA 1VK3A 4NQ3A 5FJ4C 4C8EA 1H48A 3HKDA 4O4LA 3LWOC 4KWEA 1VQVA 3CB2A 3I55F 1IV4A 3B6NA 3MCAB 3L7QA 1VQKF 2AMTA 3K14A 3P10A 1GX1A 3JATB 3V3TA 3S0YA 3CCEF 1XV2A 2CHTA 4YJ3B 3JARA 3HKBB 2GZLA 3HKDB 2H8EA 2VGNA 3VIUA 4ZHVA 3E22A 1H47A 4ZHQA 1Q7YH 5HXZA 3LWVC 4BVSA 2OHWA 3ESJA 4EI7A 3RYHB 5FNVB 1RLGA 3KIZA 1Q82H 5LOVA 1JN1A 3CPQA 1YITF 3KHNA 2NMUA 4O4HB 4C8IA 3K2XA 2R6R1 2YXZA 1YIJF 2HQSC 3HKCB 2BO1A 5HXUA 4U3JB 5J2TA 4C81A 3V7EA 2VAPA 4B46A 1FNKA 1YJNF 1X7PA 5IJ9A 3CC2F 2EWCA 1W2BF 2BTUA 1VHAA 1TUBB 5LYJA 3HKBA 1DT9A 4BT7A 2UYNA 2GVIA 1GO1A 3IEQA 2F9ZC 4I55B 1W581 5EZYB 3NMUC 4DRXA 5KX5B 1XHOA 3CCSF 3F0FA 3HKEA 5IJ9B 5DCVA 4O2AB 3TD3A 3WGMA 3NK6A 2ZF8A 2UZHA 5LYJB 4LNUB 2VAMA 5CB4B 5IJ0A 3CCJF 3CG6A 3CCUF 2UYNB 5HP8A 3HTNA 3U0OA 2PHNA 5J2UB 4X1IA 5EZYA 2I6RA 1K73H 4TV8B 5HY0A 3J7AR 4RQOA 3S0WA 3LMEA 1UI9A 4G4VA 2N48A 5JH7B 3N4YA 3CPWF 1T0AA 2RHJA 1UFYA 4HNAB 2FGYA 2G9IA 3VOBA 4O4JB 3IMPA 2GLZA 3E20B 3JAMM 2RHLA 2Z1EA 3C9SA 3AGKA 3F0DA 5JCOC 2RHHA 1JD1A 4X1IB 1TVKB 4TV8A 3D00A 1OFUA 2HS3A 3WXMB 4I4TB 2UYJA 4TZZA 2HS4A 5CA1A 1Q8RA 2CW4A 5FLXM 5CA0B 3HKEB 4IHJB 1S72F 5EAZA 1E7KA 1W42A 3JVHA 1R1MA 2Q1YA 3CCRF 3VYUC 4BVQA 4O2AA 2ZVYA 1YGYA 2LBXA 2Z1FA 5IJ0B 3KE1A 1PF5A 3ZP7A 5HY2A 2LCAA 3F0GA 3HKCA 3R0PA 2B33A 1VQPF 3VTIC 3ZOPA 1U40A 4I4TA 2QEXF 3SIVA 5GONA 1DBFA 4RHAA 1OAPA 1W57A 3E1YA 3LWRC 3HJWC 3FD6A 4BT6A 5G4UC 4O2BA 3IEWA 4X3MA 1CLIA 3MCQA 4NUTA 2ZVZA 3PLAC 3IKEA 2Q1XA 3C9RA 3FD5A 3KJKA 4C8GA 3QHDA 2PMPA 1CN7A 3IR9A 1X52A 2Z1TA 2KGWA 3JCMM 5KX5A 2OTMA 5GONB 5JQGB 5CA1B 4X3LA 5CA0A 3VMFB 3QTYA 5EWRA 3JARB 4LNUA 5EB0A 4TUYB 4C4WC 2YYEA 2UYKA 4YJ2B 4EB6B 5C8YB 3CXCF 2L26A 5J2UA 2H8CA 2LBTA 2HX0A 3JASB 5AVMA 3RYFB 4ZK7A 2RHOA 5KMGB 3WGJA 2ALEA 5EYPB 1K8AH 5LA6A 4BT3A 2JNBA 4G4WA 3HWUA 4O4JA 5LP6C 2ZAUA 4TV9B 5HY4A 5GINC 3RE3A 2OTJF 4O4HA 3M84A 5EB1B 1JFFA 3VO8A 1X7OA 3OONA 4M8IA 1VH8A 1QVGF 1TVKA 1W5BA 3V7QA 3NVKE 4NWOB 5J2TB 2AIFA 3ZO8A 5KMGA 3CC4F 2QI2A 3G6EF 1W41A 3F6MA 1W55A 2CVLA 2HVYD 4ZOLA 4ZHYB 4X1YB 1W3EX 3KJJA 3WGLA 3CCQF 1TUBA 4BT2A 2V9YA 1SDSA 3I56F 4BW0B 3CCLF 1VQ7F 1ODEA 5B8FA 1YQNA 2QTPA 1XBIA 3CMEF 1YJ9F 3JAWA 4G4YA 3RYFA 3C9TA 2K1SA 3MDOA 5GIPC 3N2KB 4X20B 1PXWA 4O4IB 3LYBA 1IV1A 3G4SF 1GO0A 4O2BB 5JVDB 3N4ZA 5BMVB 3CCMF 2QA4F 4FFBA 1VQ4F 1IV3A 1JFFB 2OTLF 1U3LA 3FBAA 1RQ2A 3VOAA 2UYPA 3ERNA 2Z01A 3VYSC 3N2KA 1QAHA 5JQGA 3BYQA 3Q8HA 4HNAA 3V4DA 2HS0A 2AIZP 2MQEA 3K0TA 2VXYA 4ZOLB 3WJRA 2IG8A 2VAWA 1RA4A 4F6RA 3J80M 5C8YA 3I3FA 4YJ2A 3N2GB 1VQ9F 3NK7A 4XCQA 1YHQF 2I6DA 4IIJA 5LP6A 1SZQA 3G71F 1N8RH 3GTZA 4BVTA 5EYPA 1SA0B 1J7HA 5LA6B 2HRYA 3P0ZA 4IHJA 4C82A 4X20A 4X1KA 3VI6A 5BMVA 3WPWA 2DYYA 4FFBB 4I50A 3N2GA 3ELCA 2KTVA 5GANK 3PAFA 1YJWF 1QD9A 3K12A 1ONIA 3EORA 3OBWA 3T80A 5MN5A 1NMUB 5JCOA 4G4XA 2KTUA 1NQ3A 4BT5A 2H6LA 3VCZA 3J81M 3CYPB 4ZI7B 3WJQA 5FNVA 1Q81H 2FC3A 3WJPA 3WGKA 5MN6A 1ZWZA 5ITZB 4EI8A 3JALB 3M4SA 3O85A 2OZBA 2IQQA 5G4VC 3GYQA 3CYQA 3LWQC 5JVDA 1VQ5F 2CSLA 1VQMF 1VQNF 5LXTB 2KG4A 5JH7A 4TUYA 2P6YA 5HP7A 4ZHWA 4EB6A 3S03A 4I50B 3C9UA 1FNJA 1JJ2F 1QVFF 1COMA 3FFMA 3JASA 1K9MH 5EIBC 2BTOA 3C8LA 1Z5WA 1RLUA 3F0EA 2WALA 1FSZA 1VQLF 5HY1A 1W5AA 2ZODA 1KD1H 4TV9A 5A2QM 5MN4A 4E6EA 3MQWA 4BVRA 5LXTA 1KNJA 4G88A 4PWTA 4I55A 3MBMA 3RYIB 2CWJA 5EIBD 1NJIH 1KC8H 3CD6F 5LP6B 1RQ7A 2RB9A 5IT9M 4WBNA 3VYTC 2CHSA 4EI9A 3HAXD 1JY8A 3RYCB 3RA5A 1SA0A 1W59A 1W40A 2HP0A 3TD5A 3SIUA 3JALA 5CB4A 2R751 3OW2F 3DC2A 3LFOA 4BY9D 5IYZB 4X1KB 4X1YA 3TD4A 1W5EA 2ZOVA 3D01A 2LBWA 5HWEA 3E22B 3RYIA 3CC7F 3LWPC 1FFXB 1VQOF 4LCKA 3RYHA 3DDNA 1XRGA 4G4ZA 3JAWB 3QUWA 2BTQB 1KQSF 3S0HA 2HP0B 1VQ6F 2CZWA 5IYZA 4O4IA 2HP3A 3JAKA 4O4LB 1CK2A 4B45A 4B62A 1YI2F 1M1KH 4U3JA 4ZI7A 3UT5A 3WGNA 1VQ8F 3ZP4A 2DT4A 1IV2A 3GHZA 2W8BC 3S06A 3FPIA 2HRUA 3P4EA 4WBNB 1Z5VA 5ITZA 4YJ3A 3CCVF 3RYCA 1U43A 1X25A 1Q86H 1IPAA 3JAKB 3RA6A 4B5CA 4DXDA 3M1XA 2VGMA 1H7MA 1QU9A 1W5FA 4ZHQB 5GAPK 3LDTA 4R40B 4F6RB 3S02A
chains in the Genus database with same CATH topology
1K73H 3V7QA 5HY0A 3CMAF 3J7AR 1Q81H 3NVKE 2FC3A 2AIFA 1M90H 3CC4F 2QI2A 3N4YA 1ZWZA 3G6EF 1GZ0A 1W41A 3CPWF 3OBYA 5EO3A 4EI8A 2FGYA 2OZBA 3O85A 3ON1A 1T0KB 5G4VC 5GIOC 3GYQA 2HVYD 3NVIB 3LWQC 2GLZA 3E20B 4NQ3A 1W3EX 3JAMM 3CCQF 1VQ5F 5FJ4C 1VQMF 3LWOC 1SDSA 1VQNF 3AGKA 3I56F 4BW0B 2KG4A 3CCLF 1VQ7F 3I55F 3D00A 3CMEF 1XBIA 1YJ9F 3MCAB 3WXMB 1JJ2F 1QVFF 3FFMA 4TZZA 1K9MH 1VQKF 3CCEF 3V3TA 5GIPC 5FLXM 1S72F 1E7KA 2WALA 1PXWA 1W42A 1VQLF 5HY1A 3CCRF 4BVQA 1GO0A 3G4SF 2LBXA 3N4ZA 1KD1H 3CCMF 2QA4F 5A2QM 4BVRA 1VQ4F 2VGNA 5HY2A 2OTLF 1Q7YH 5HXZA 3LWVC 1VQPF 4BVSA 2OHWA 4EI7A 1NJIH 1KC8H 1RLGA 3CD6F 2QEXF 5IT9M 1Q82H 4EI9A 3HAXD 3SIVA 3RA5A 3CPQA 1YITF 3E1YA 3LWRC 1W40A 3HJWC 3SIUA 5G4UC 3OW2F 4BY9D 3LFOA 4X3MA 2LBWA 1YIJF 4NUTA 3PLAC 1RA4A 3J80M 5HWEA 2BO1A 5HXUA 1VQ9F 3LWPC 3CC7F 1VQOF 4LCKA 3NK7A 4XCQA 1YHQF 2I6DA 1CN7A 3IR9A 1X52A 3G71F 3JCMM 4BVTA 1N8RH 3V7EA 1YJNF 1KQSF 1X7PA 3CC2F 1W2BF 4X3LA 1VQ6F 3VMFB 2CZWA 5EWRA 3VI6A 1DT9A 1CK2A 4C4WC 1YI2F 1GO1A 1M1KH 2F9ZC 3CXCF 3NMUC 2KTVA 5GANK 3PAFA 1YJWF 1VQ8F 2ALEA 3CCSF 1K8AH 3OBWA 5DCVA 1NMUB 3CCVF 2JNBA 3NK6A 1Q86H 1IPAA 3RA6A 5HY4A 2KTUA 5GINC 3CCJF 2OTJF 3CG6A 3CCUF 1X7OA 2VGMA 1H7MA 5GAPK 3J81M 1QVGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 H;  3V7Q A;  3CMA F;  3J7A R;  3NVK E;  1Q81 H;  2FC3 A;  2AIF A;  1M90 H;  3CC4 F;  2QI2 A;  3N4Y A;  1ZWZ A;  3G6E F;  1GZ0 A;  1W41 A;  3CPW F;  3OBY A;  5EO3 A;  2OZB A;  3O85 A;  3ON1 A;  1T0K B;  5G4V C;  5GIO C;  3GYQ A;  2HVY D;  3NVI B;  3LWQ C;  3E20 B;  3JAM M;  1W3E X;  5FJ4 C;  3CCQ F;  1VQ5 F;  1VQM F;  3LWO C;  1SDS A;  1VQN F;  3AGK A;  3I56 F;  4BW0 B;  2KG4 A;  3CCL F;  1VQ7 F;  3I55 F;  3CME F;  1XBI A;  1YJ9 F;  3MCA B;  3WXM B;  1JJ2 F;  1QVF F;  3FFM A;  4TZZ A;  1K9M H;  1VQK F;  3CCE F;  5GIP C;  5FLX M;  1S72 F;  1E7K A;  2WAL A;  1PXW A;  1W42 A;  1VQL F;  3CCR F;  1GO0 A;  3G4S F;  2LBX A;  3N4Z A;  1KD1 H;  3CCM F;  2QA4 F;  5A2Q M;  1VQ4 F;  2VGN A;  2OTL F;  1Q7Y H;  3LWV C;  1VQP F;  1NJI H;  2OHW A;  1KC8 H;  1RLG A;  3CD6 F;  2QEX F;  5IT9 M;  1Q82 H;  3HAX D;  3SIV A;  3RA5 A;  3CPQ A;  1YIT F;  3LWR C;  3E1Y A;  1W40 A;  3HJW C;  3SIU A;  5G4U C;  3OW2 F;  4BY9 D;  3LFO A;  4X3M A;  2LBW A;  1YIJ F;  4NUT A;  3PLA C;  1RA4 A;  3J80 M;  2BO1 A;  1VQ9 F;  3LWP C;  3CC7 F;  1VQO F;  4LCK A;  3NK7 A;  1YHQ F;  2I6D A;  1CN7 A;  3IR9 A;  1X52 A;  3G71 F;  3JCM M;  1N8R H;  3V7E A;  1YJN F;  1KQS F;  1X7P A;  3CC2 F;  1W2B F;  4X3L A;  1VQ6 F;  3VMF B;  2CZW A;  5EWR A;  3VI6 A;  1DT9 A;  1CK2 A;  4C4W C;  1YI2 F;  1GO1 A;  1M1K H;  3CXC F;  3NMU C;  2KTV A;  5GAN K;  3PAF A;  1YJW F;  1VQ8 F;  2ALE A;  3CCS F;  1K8A H;  3OBW A;  5DCV A;  1NMU B;  3CCV F;  2JNB A;  3NK6 A;  1Q86 H;  1IPA A;  3RA6 A;  2KTU A;  5GIN C;  3CCJ F;  2OTJ F;  3CG6 A;  3CCU F;  1X7O A;  2VGM A;  1H7M A;  5GAP K;  3J81 M;  1QVG F; 
#chains in the Genus database with same CATH topology
 3I7T A;  3UT5 B;  3CMA F;  4U39 A;  2Z1U A;  1FFX A;  4DRX B;  5LOV B;  1M90 H;  4ERH A;  4IIJ B;  1U3P A;  3JAT A;  1GZ0 A;  3IKF A;  3OBY A;  5EO3 A;  3D54 A;  3ON1 A;  1T0K B;  2IAF A;  5GIO C;  3NVI B;  4BT4 A;  1KNK A;  3WPX A;  1VK3 A;  4NQ3 A;  5FJ4 C;  4C8E A;  1H48 A;  3HKD A;  4O4L A;  3LWO C;  4KWE A;  1VQV A;  3CB2 A;  3I55 F;  1IV4 A;  3B6N A;  3MCA B;  3L7Q A;  1VQK F;  2AMT A;  3K14 A;  3P10 A;  1GX1 A;  3JAT B;  3V3T A;  3S0Y A;  3CCE F;  1XV2 A;  2CHT A;  4YJ3 B;  3JAR A;  3HKB B;  2GZL A;  3HKD B;  2H8E A;  2VGN A;  3VIU A;  4ZHV A;  3E22 A;  1H47 A;  4ZHQ A;  1Q7Y H;  5HXZ A;  3LWV C;  4BVS A;  2OHW A;  3ESJ A;  4EI7 A;  3RYH B;  5FNV B;  1RLG A;  3KIZ A;  1Q82 H;  5LOV A;  1JN1 A;  3CPQ A;  1YIT F;  3KHN A;  2NMU A;  4O4H B;  4C8I A;  3K2X A;  2R6R 1;  2YXZ A;  1YIJ F;  2HQS C;  3HKC B;  2BO1 A;  5HXU A;  4U3J B;  5J2T A;  4C81 A;  3V7E A;  2VAP A;  4B46 A;  1FNK A;  1YJN F;  1X7P A;  5IJ9 A;  3CC2 F;  2EWC A;  1W2B F;  2BTU A;  1VHA A;  1TUB B;  5LYJ A;  3HKB A;  1DT9 A;  4BT7 A;  2UYN A;  2GVI A;  1GO1 A;  3IEQ A;  2F9Z C;  4I55 B;  1W58 1;  5EZY B;  3NMU C;  4DRX A;  5KX5 B;  1XHO A;  3CCS F;  3F0F A;  3HKE A;  5IJ9 B;  5DCV A;  4O2A B;  3TD3 A;  3WGM A;  3NK6 A;  2ZF8 A;  2UZH A;  5LYJ B;  4LNU B;  2VAM A;  5CB4 B;  5IJ0 A;  3CCJ F;  3CG6 A;  3CCU F;  2UYN B;  5HP8 A;  3HTN A;  3U0O A;  2PHN A;  5J2U B;  4X1I A;  5EZY A;  2I6R A;  1K73 H;  4TV8 B;  5HY0 A;  3J7A R;  4RQO A;  3S0W A;  3LME A;  1UI9 A;  4G4V A;  2N48 A;  5JH7 B;  3N4Y A;  3CPW F;  1T0A A;  2RHJ A;  1UFY A;  4HNA B;  2FGY A;  2G9I A;  3VOB A;  4O4J B;  3IMP A;  2GLZ A;  3E20 B;  3JAM M;  2RHL A;  2Z1E A;  3C9S A;  3AGK A;  3F0D A;  5JCO C;  2RHH A;  1JD1 A;  4X1I B;  1TVK B;  4TV8 A;  3D00 A;  1OFU A;  2HS3 A;  3WXM B;  4I4T B;  2UYJ A;  4TZZ A;  2HS4 A;  5CA1 A;  1Q8R A;  2CW4 A;  5FLX M;  5CA0 B;  3HKE B;  4IHJ B;  1S72 F;  5EAZ A;  1E7K A;  1W42 A;  3JVH A;  1R1M A;  2Q1Y A;  3CCR F;  3VYU C;  4BVQ A;  4O2A A;  2ZVY A;  1YGY A;  2LBX A;  2Z1F A;  5IJ0 B;  3KE1 A;  1PF5 A;  3ZP7 A;  5HY2 A;  2LCA A;  3F0G A;  3HKC A;  3R0P A;  2B33 A;  1VQP F;  3VTI C;  3ZOP A;  1U40 A;  4I4T A;  2QEX F;  3SIV A;  5GON A;  1DBF A;  4RHA A;  1OAP A;  1W57 A;  3E1Y A;  3LWR C;  3HJW C;  3FD6 A;  4BT6 A;  5G4U C;  4O2B A;  3IEW A;  4X3M A;  1CLI A;  3MCQ A;  4NUT A;  2ZVZ A;  3PLA C;  3IKE A;  2Q1X A;  3C9R A;  3FD5 A;  3KJK A;  4C8G A;  3QHD A;  2PMP A;  1CN7 A;  3IR9 A;  1X52 A;  2Z1T A;  2KGW A;  3JCM M;  5KX5 A;  2OTM A;  5GON B;  5JQG B;  5CA1 B;  4X3L A;  5CA0 A;  3VMF B;  3QTY A;  5EWR A;  3JAR B;  4LNU A;  5EB0 A;  4TUY B;  4C4W C;  2YYE A;  2UYK A;  4YJ2 B;  4EB6 B;  5C8Y B;  3CXC F;  2L26 A;  5J2U A;  2H8C A;  2LBT A;  2HX0 A;  3JAS B;  5AVM A;  3RYF B;  4ZK7 A;  2RHO A;  5KMG B;  3WGJ A;  2ALE A;  5EYP B;  1K8A H;  5LA6 A;  4BT3 A;  2JNB A;  4G4W A;  3HWU A;  4O4J A;  5LP6 C;  2ZAU A;  4TV9 B;  5HY4 A;  5GIN C;  3RE3 A;  2OTJ F;  4O4H A;  3M84 A;  5EB1 B;  1JFF A;  3VO8 A;  1X7O A;  3OON A;  4M8I A;  1VH8 A;  1QVG F;  1TVK A;  1W5B A;  3V7Q A;  3NVK E;  4NWO B;  5J2T B;  2AIF A;  3ZO8 A;  5KMG A;  3CC4 F;  2QI2 A;  3G6E F;  1W41 A;  3F6M A;  1W55 A;  2CVL A;  2HVY D;  4ZOL A;  4ZHY B;  4X1Y B;  1W3E X;  3KJJ A;  3WGL A;  3CCQ F;  1TUB A;  4BT2 A;  2V9Y A;  1SDS A;  3I56 F;  4BW0 B;  3CCL F;  1VQ7 F;  1ODE A;  5B8F A;  1YQN A;  2QTP A;  1XBI A;  3CME F;  1YJ9 F;  3JAW A;  4G4Y A;  3RYF A;  3C9T A;  2K1S A;  3MDO A;  5GIP C;  3N2K B;  4X20 B;  1PXW A;  4O4I B;  3LYB A;  1IV1 A;  3G4S F;  1GO0 A;  4O2B B;  5JVD B;  3N4Z A;  5BMV B;  3CCM F;  2QA4 F;  4FFB A;  1VQ4 F;  1IV3 A;  1JFF B;  2OTL F;  1U3L A;  3FBA A;  1RQ2 A;  3VOA A;  2UYP A;  3ERN A;  2Z01 A;  3VYS C;  3N2K A;  1QAH A;  5JQG A;  3BYQ A;  3Q8H A;  4HNA A;  3V4D A;  2HS0 A;  2AIZ P;  2MQE A;  3K0T A;  2VXY A;  4ZOL B;  3WJR A;  2IG8 A;  2VAW A;  1RA4 A;  4F6R A;  3J80 M;  5C8Y A;  3I3F A;  4YJ2 A;  3N2G B;  1VQ9 F;  3NK7 A;  4XCQ A;  1YHQ F;  2I6D A;  4IIJ A;  5LP6 A;  1SZQ A;  3G71 F;  1N8R H;  3GTZ A;  4BVT A;  5EYP A;  1SA0 B;  1J7H A;  5LA6 B;  2HRY A;  3P0Z A;  4IHJ A;  4C82 A;  4X20 A;  4X1K A;  3VI6 A;  5BMV A;  3WPW A;  2DYY A;  4FFB B;  4I50 A;  3N2G A;  3ELC A;  2KTV A;  5GAN K;  3PAF A;  1YJW F;  1QD9 A;  3K12 A;  1ONI A;  3EOR A;  3OBW A;  3T80 A;  5MN5 A;  1NMU B;  5JCO A;  4G4X A;  2KTU A;  1NQ3 A;  4BT5 A;  2H6L A;  3VCZ A;  3J81 M;  3CYP B;  4ZI7 B;  3WJQ A;  5FNV A;  1Q81 H;  2FC3 A;  3WJP A;  3WGK A;  5MN6 A;  1ZWZ A;  5ITZ B;  4EI8 A;  3JAL B;  3M4S A;  3O85 A;  2OZB A;  2IQQ A;  5G4V C;  3GYQ A;  3CYQ A;  3LWQ C;  5JVD A;  1VQ5 F;  2CSL A;  1VQM F;  1VQN F;  5LXT B;  2KG4 A;  5JH7 A;  4TUY A;  2P6Y A;  5HP7 A;  4ZHW A;  4EB6 A;  3S03 A;  4I50 B;  3C9U A;  1FNJ A;  1JJ2 F;  1QVF F;  1COM A;  3FFM A;  3JAS A;  1K9M H;  5EIB C;  2BTO A;  3C8L A;  1Z5W A;  1RLU A;  3F0E A;  2WAL A;  1FSZ A;  1VQL F;  5HY1 A;  1W5A A;  2ZOD A;  1KD1 H;  4TV9 A;  5A2Q M;  5MN4 A;  4E6E A;  3MQW A;  4BVR A;  5LXT A;  1KNJ A;  4G88 A;  4PWT A;  4I55 A;  3MBM A;  3RYI B;  2CWJ A;  5EIB D;  1NJI H;  1KC8 H;  3CD6 F;  5LP6 B;  1RQ7 A;  2RB9 A;  5IT9 M;  4WBN A;  3VYT C;  2CHS A;  4EI9 A;  3HAX D;  1JY8 A;  3RYC B;  3RA5 A;  1SA0 A;  1W59 A;  1W40 A;  2HP0 A;  3TD5 A;  3SIU A;  3JAL A;  5CB4 A;  2R75 1;  3OW2 F;  3DC2 A;  3LFO A;  4BY9 D;  5IYZ B;  4X1K B;  4X1Y A;  3TD4 A;  1W5E A;  2ZOV A;  3D01 A;  2LBW A;  5HWE A;  3E22 B;  3RYI A;  3CC7 F;  3LWP C;  1FFX B;  1VQO F;  4LCK A;  3RYH A;  3DDN A;  1XRG A;  4G4Z A;  3JAW B;  3QUW A;  2BTQ B;  1KQS F;  3S0H A;  2HP0 B;  1VQ6 F;  2CZW A;  5IYZ A;  4O4I A;  2HP3 A;  3JAK A;  4O4L B;  1CK2 A;  4B45 A;  4B62 A;  1YI2 F;  1M1K H;  4U3J A;  4ZI7 A;  3UT5 A;  3WGN A;  1VQ8 F;  3ZP4 A;  2DT4 A;  1IV2 A;  3GHZ A;  2W8B C;  3S06 A;  3FPI A;  2HRU A;  3P4E A;  4WBN B;  1Z5V A;  5ITZ A;  4YJ3 A;  3CCV F;  3RYC A;  1U43 A;  1X25 A;  1Q86 H;  1IPA A;  3JAK B;  3RA6 A;  4B5C A;  4DXD A;  3M1X A;  2VGM A;  1H7M A;  1QU9 A;  1W5F A;  4ZHQ B;  5GAP K;  3LDT A;  4R40 B;  4F6R B;  3S02 A; 
#chains in the Genus database with same CATH homology
 1K73 H;  3V7Q A;  5HY0 A;  3CMA F;  3J7A R;  1Q81 H;  3NVK E;  2FC3 A;  2AIF A;  1M90 H;  3CC4 F;  2QI2 A;  3N4Y A;  1ZWZ A;  3G6E F;  1GZ0 A;  1W41 A;  3CPW F;  3OBY A;  5EO3 A;  4EI8 A;  2FGY A;  2OZB A;  3O85 A;  3ON1 A;  1T0K B;  5G4V C;  5GIO C;  3GYQ A;  2HVY D;  3NVI B;  3LWQ C;  2GLZ A;  3E20 B;  4NQ3 A;  1W3E X;  3JAM M;  3CCQ F;  1VQ5 F;  5FJ4 C;  1VQM F;  3LWO C;  1SDS A;  1VQN F;  3AGK A;  3I56 F;  4BW0 B;  2KG4 A;  3CCL F;  1VQ7 F;  3I55 F;  3D00 A;  3CME F;  1XBI A;  1YJ9 F;  3MCA B;  3WXM B;  1JJ2 F;  1QVF F;  3FFM A;  4TZZ A;  1K9M H;  1VQK F;  3CCE F;  3V3T A;  5GIP C;  5FLX M;  1S72 F;  1E7K A;  2WAL A;  1PXW A;  1W42 A;  1VQL F;  5HY1 A;  3CCR F;  4BVQ A;  1GO0 A;  3G4S F;  2LBX A;  3N4Z A;  1KD1 H;  3CCM F;  2QA4 F;  5A2Q M;  4BVR A;  1VQ4 F;  2VGN A;  5HY2 A;  2OTL F;  1Q7Y H;  5HXZ A;  3LWV C;  1VQP F;  4BVS A;  2OHW A;  4EI7 A;  1NJI H;  1KC8 H;  1RLG A;  3CD6 F;  2QEX F;  5IT9 M;  1Q82 H;  4EI9 A;  3HAX D;  3SIV A;  3RA5 A;  3CPQ A;  1YIT F;  3E1Y A;  3LWR C;  1W40 A;  3HJW C;  3SIU A;  5G4U C;  3OW2 F;  4BY9 D;  3LFO A;  4X3M A;  2LBW A;  1YIJ F;  4NUT A;  3PLA C;  1RA4 A;  3J80 M;  5HWE A;  2BO1 A;  5HXU A;  1VQ9 F;  3LWP C;  3CC7 F;  1VQO F;  4LCK A;  3NK7 A;  4XCQ A;  1YHQ F;  2I6D A;  1CN7 A;  3IR9 A;  1X52 A;  3G71 F;  3JCM M;  4BVT A;  1N8R H;  3V7E A;  1YJN F;  1KQS F;  1X7P A;  3CC2 F;  1W2B F;  4X3L A;  1VQ6 F;  3VMF B;  2CZW A;  5EWR A;  3VI6 A;  1DT9 A;  1CK2 A;  4C4W C;  1YI2 F;  1GO1 A;  1M1K H;  2F9Z C;  3CXC F;  3NMU C;  2KTV A;  5GAN K;  3PAF A;  1YJW F;  1VQ8 F;  2ALE A;  3CCS F;  1K8A H;  3OBW A;  5DCV A;  1NMU B;  3CCV F;  2JNB A;  3NK6 A;  1Q86 H;  1IPA A;  3RA6 A;  5HY4 A;  2KTU A;  5GIN C;  3CCJ F;  2OTJ F;  3CG6 A;  3CCU F;  1X7O A;  2VGM A;  1H7M A;  5GAP K;  3J81 M;  1QVG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...