3ZO8A

Wild-type chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zo8A00
3K12A 3M4SA 2OTMA 2CW4A 1PF5A 1X25A 3KJKA 1JD1A 3L7QA 3MQWA 1FNKA 3VCZA 3ZP7A 1J7HA 2CHTA 3I3FA 2UYNB 2UYNA 2UYPA 2IG8A 3LMEA 2UYJA 2CHSA 3M1XA 3GTZA 3QUWA 4NWOB 2DYYA 3ZO8A 3K0TA 2CWJA 1DBFA 1UFYA 3R0PA 3KJJA 2CVLA 3D01A 5HP7A 1COMA 3I7TA 2B33A 1XHOA 2UYKA 1ODEA 1NQ3A 1UI9A 1QD9A 3ZP4A 1FNJA 3ZOPA 3LYBA 1QU9A 5HP8A 1XRGA 3V4DA 1QAHA 2EWCA 4ZK7A 1ONIA 2CSLA
chains in the Genus database with same CATH superfamily
3S03A 2VGNA 2OTJF 5JH7A 5JQGA 4IIJB 3MDOA 3HJWC 3S0HA 3V3TA 4NQ3A 4X1IB 5IJ0A 3WGMA 1E7KA 2JNBA 3ZO8A 4O2AB 3P10A 4EB6A 3IKEA 2YXZA 5GINC 3WGJA 3Q8HA 5LA6B 3VOAA 3VYTC 4WBNB 1Z5WA 3OBWA 3HKDB 4BT5A 3CCQF 3N2KB 4ZK7A 2AMTA 2OTMA 4X1KB 4TV9B 3S06A 3BYQA 3M84A 3N2GB 1TVKA 1YJ9F 1JFFB 4O4HB 3P0ZA 3F0FA 1KC8H 5IYZA 4B62A 2HP0B 4O4IA 2OZBA 4NWOB 5LOVB 4TV8A 1K73H 5DCVA 1VHAA 3CG6A 2CVLA 4TUYA 3TD3A 1T0AA 2UYKA 4I55B 3CYPB 4C8IA 3C9UA 1W581 4I50B 2HX0A 5J2UB 2EWCA 2CSLA 4F6RB 4BVQA 1X52A 1K8AH 1X25A 4G4YA 2GLZA 5KMGB 4LNUB 3IMPA 3CCEF 2L26A 5LP6A 5GAPK 1FFXA 2QI2A 1IV2A 3S02A 1YIJF 2HRYA 3FD5A 3LWQC 1VQ5F 3J7AR 5KX5A 3TD4A 2HS3A 2BTQB 1DT9A 5HP7A 2QA4F 1CK2A 1W42A 3CCMF 2UZHA 3GHZA 4ZOLB 4U3JA 3RYIA 5CA1A 1NMUB 3LWOC 1IV3A 5EZYB 4BT7A 4LCKA 1VQ4F 1U3LA 4X1YB 3MBMA 1W5EA 2Z1UA 3RE3A 3NVKE 3LMEA 4G4ZA 4HNAA 3F0EA 3C8LA 1JJ2F 3JALA 5MN6A 1W5FA 1TUBA 5JCOC 1JY8A 4O2BA 5LXTA 2B33A 3ON1A 3NVIB 1VQ9F 1GZ0A 4EI9A 4EI8A 2LBXA 4O4JA 2ZODA 4ZHWA 3JAWB 5G4UC 3JAKB 4B45A 1SA0B 1XBIA 5FNVB 3MQWA 1J7HA 4IIJA 2LBWA 2CHTA 3JAMM 1Q7YH 1SDSA 3NK6A 4G88A 3QTYA 2HP3A 1VQ8F 3HKCA 2P6YA 2VGMA 1QVFF 3R0PA 3CC2F 3JARB 3WGLA 2BTUA 4ZHVA 5HWEA 3WJPA 1VQ7F 4YJ2A 2CZWA 3ZP4A 3JATA 2QTPA 3HKDA 3ZOPA 1CN7A 5EYPB 1QAHA 5J2TA 3K12A 2F9ZC 4X1KA 5FJ4C 1VQOF 1PXWA 1QVGF 3HKEB 3WXMB 1Q81H 4YJ3A 1H7MA 3QHDA 1X7PA 3K0TA 1YHQF 2Z1EA 4KWEA 2I6DA 1Q86H 4BVRA 3G6EF 4X3LA 1W2BF 4X20A 1W3EX 1IV4A 2V9YA 3TD5A 4G4XA 5J2UA 3AGKA 3VOBA 3VTIC 5EO3A 1RLGA 1NJIH 1PF5A 3ESJA 4ZHQB 3FPIA 3IKFA 5LYJA 1VQKF 5GONA 2UYNA 2IG8A 5C8YA 5ITZA 5HXUA 2LCAA 4DXDA 2OHWA 5CA0B 5BMVB 3VO8A 3V7EA 5FLXM 1VQMF 2ZAUA 2RHLA 4ZOLA 1H47A 2H8EA 1RQ7A 1XRGA 3F0GA 5GANK 2OTLF 4ERHA 4TZZA 2BO1A 1IPAA 1YI2F 3RYHA 1VQPF 5JQGB 3G71F 2G9IA 3I3FA 4ZI7A 5EB0A 5GIPC 3F6MA 2YYEA 4O4LA 5IJ0B 4IHJA 3E20B 5EIBD 5JVDA 3CCLF 4EB6B 2RB9A 1YJWF 3S0WA 3C9RA 3D01A 3LWPC 4E6EA 2PMPA 4M8IA 3C9TA 1W55A 3JASA 2PHNA 1N8RH 3CPQA 1TVKB 2I6RA 5FNVA 4C4WC 5IYZB 3WGNA 4B5CA 2Q1XA 3B6NA 4O4IB 4DRXA 3M1XA 2HRUA 3QUWA 3LWRC 4TV8B 3RYCB 3UT5A 4NUTA 1YQNA 4TUYB 3JARA 1U3PA 4PWTA 5LP6C 1COMA 5EAZA 2H8CA 5MN5A 1QD9A 3RYFA 1FNJA 2AIFA 5HXZA 5EYPA 3FFMA 4FFBB 2MQEA 2FGYA 2AIZP 4X3MA 1OFUA 1VQ6F 3E22B 2ZF8A 1VQNF 3HAXD 2UYPA 2HQSC 3DC2A 3HKBB 5LP6B 4XCQA 1FFXB 1W40A 3WPXA 2NMUA 4X1IA 4C8GA 5KX5B 2CWJA 4O2AA 2Z1FA 3CC4F 3VYUC 1RLUA 3V7QA 1XHOA 3RYIB 4U3JB 5CA1B 3T80A 3F0DA 5LA6A 4I4TB 4WBNA 3LYBA 1W59A 4C82A 5HY0A 1M90H 2H6LA 3ZP7A 3N2KA 3D54A 4TV9A 1KNKA 3N2GA 3VI6A 1JFFA 4O4HA 1KD1H 4R40B 4BVTA 4HNAB 4BY9D 2HP0A 3JALB 5A2QM 3VYSC 4U39A 2RHOA 2DYYA 3MCQA 5CB4B 1TUBB 4BT4A 5LOVA 4G4VA 4O2BB 3OBYA 1VK3A 3LFOA 1NQ3A 4I55A 1Q8RA 2ALEA 4O4JB 5AVMA 4I50A 3EORA 3WPWA 4ZHYB 4F6RA 3VCZA 3GYQA 2RHJA 1W5BA 2GZLA 4RQOA 5KMGA 1ZWZA 4LNUA 3CYQA 2KGWA 3GTZA 3HKCB 3IR9A 1T0KB 3WJQA 3MCAB 2ZVZA 3LDTA 3NMUC 1W57A 4YJ2B 3JATB 2W8BC 2ZOVA 3KIZA 3P4EA 3VIUA 3C9SA 3FBAA 3I55F 3CCVF 3CB2A 5IJ9B 5EZYA 1VQLF 1W41A 3J81M 5J2TB 3CXCF 2CW4A 4X1YA 5JH7B 1FSZA 3HTNA 5HY2A 4YJ3B 2UYJA 4EI7A 2LBTA 3N4ZA 3CCUF 1SZQA 4BW0B 3RYCA 4BT2A 5B8FA 1DBFA 3J80M 3KJJA 3K2XA 2HS4A 1GO1A 4X20B 3HWUA 3D00A 2QEXF 1Q82H 1ODEA 3RA5A 2IAFA 3CPWF 2VAPA 3IEQA 3ERNA 3KHNA 3JAWA 4FFBA 2IQQA 3JAKA 1U43A 1ONIA 3O85A 2GVIA 5EIBC 2N48A 1SA0A 3E22A 5LYJB 3PAFA 3L7QA 1FNKA 2RHHA 5GONB 2HS0A 2UYNB 5JCOA 5C8YB 3HKBA 5ITZB 5MN4A 3PLAC 3OW2F 1VH8A 2KG4A 5G4VC 3CCRF 1UFYA 1YJNF 1KNJA 1R1MA 5HY4A 1RA4A 3CD6F 1UI9A 2VAWA 4I4TA 3E1YA 2R6R1 3WGKA 4BVSA 1JN1A 3M4SA 3RYHB 3ELCA 1U40A 5IT9M 2K1SA 4ZI7B 1VQVA 3HKEA 2Z1TA 4O4LB 3SIVA 4IHJB 5JVDB 2Z01A 5CB4A 5EWRA 1H48A 4BT6A 3CC7F 3SIUA 3CMEF 3CCSF 3VMFB 3CMAF 3LWVC 1M1KH 3K14A 1S72F 1RQ2A 2ZVYA 2Q1YA 4RHAA 3JASB 4C81A 1QU9A 1CLIA 3N4YA 3WJRA 2DT4A 3V4DA 3RA6A 3CCJF 1KQSF 1OAPA 3KE1A 3U0OA 1GO0A 4C8EA 3KJKA 4G4WA 4BT3A 4ZHQA 1JD1A 3NK7A 1W5AA 1YGYA 4DRXB 2CHSA 1IV1A 5HY1A 4B46A 2BTOA 2KTUA 2R751 5CA0A 1Z5VA 3DDNA 3IEWA 3UT5B 5BMVA 3S0YA 2VXYA 2VAMA 1YITF 3I7TA 2FC3A 2WALA 5LXTB 3G4SF 3FD6A 5EB1B 3JVHA 1K9MH 3RYFB 3OONA 2KTVA 2HVYD 1XV2A 5HP8A 5IJ9A 5GIOC 3I56F 1GX1A 3JCMM 1X7OA
chains in the Genus database with same CATH topology
3K12A 3M4SA 2OTMA 2CW4A 1PF5A 1X25A 3KJKA 1JD1A 3L7QA 3MQWA 1FNKA 3VCZA 3ZP7A 1J7HA 2CHTA 3I3FA 2UYNB 2UYNA 2UYPA 2IG8A 3LMEA 2UYJA 2CHSA 3M1XA 3GTZA 3QUWA 4NWOB 2DYYA 3ZO8A 3K0TA 2CWJA 1DBFA 1UFYA 3R0PA 3KJJA 2CVLA 3D01A 5HP7A 1COMA 3I7TA 2B33A 1XHOA 2UYKA 1ODEA 1NQ3A 1UI9A 1QD9A 3ZP4A 1FNJA 3ZOPA 3LYBA 1QU9A 5HP8A 1XRGA 3V4DA 1QAHA 2EWCA 4ZK7A 1ONIA 2CSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K12 A;  3M4S A;  2OTM A;  2CW4 A;  1PF5 A;  1X25 A;  3KJK A;  1JD1 A;  3L7Q A;  3MQW A;  1FNK A;  3VCZ A;  3ZP7 A;  1J7H A;  2CHT A;  3I3F A;  2UYN B;  2UYN A;  2UYP A;  2IG8 A;  3LME A;  2UYJ A;  2CHS A;  3M1X A;  3GTZ A;  3QUW A;  4NWO B;  2DYY A;  3ZO8 A;  3K0T A;  2CWJ A;  1DBF A;  1UFY A;  3R0P A;  3KJJ A;  2CVL A;  3D01 A;  5HP7 A;  1COM A;  3I7T A;  2B33 A;  1XHO A;  2UYK A;  1ODE A;  1NQ3 A;  1UI9 A;  1QD9 A;  3ZP4 A;  1FNJ A;  3ZOP A;  3LYB A;  1QU9 A;  5HP8 A;  1XRG A;  3V4D A;  1QAH A;  2EWC A;  4ZK7 A;  1ONI A;  2CSL A; 
#chains in the Genus database with same CATH topology
 3S03 A;  2VGN A;  2OTJ F;  5JH7 A;  5JQG A;  4IIJ B;  3MDO A;  3HJW C;  3S0H A;  3V3T A;  4NQ3 A;  4X1I B;  5IJ0 A;  3WGM A;  1E7K A;  2JNB A;  3ZO8 A;  4O2A B;  3P10 A;  4EB6 A;  3IKE A;  2YXZ A;  5GIN C;  3WGJ A;  3Q8H A;  5LA6 B;  3VOA A;  3VYT C;  4WBN B;  1Z5W A;  3OBW A;  3HKD B;  4BT5 A;  3CCQ F;  3N2K B;  4ZK7 A;  2AMT A;  2OTM A;  4X1K B;  4TV9 B;  3S06 A;  3BYQ A;  3M84 A;  3N2G B;  1TVK A;  1YJ9 F;  1JFF B;  4O4H B;  3P0Z A;  3F0F A;  1KC8 H;  5IYZ A;  4B62 A;  2HP0 B;  4O4I A;  2OZB A;  4NWO B;  5LOV B;  4TV8 A;  1K73 H;  5DCV A;  1VHA A;  3CG6 A;  2CVL A;  4TUY A;  3TD3 A;  1T0A A;  2UYK A;  4I55 B;  3CYP B;  4C8I A;  3C9U A;  1W58 1;  4I50 B;  2HX0 A;  5J2U B;  2EWC A;  2CSL A;  4F6R B;  4BVQ A;  1X52 A;  1K8A H;  1X25 A;  4G4Y A;  2GLZ A;  5KMG B;  4LNU B;  3IMP A;  3CCE F;  2L26 A;  5LP6 A;  5GAP K;  1FFX A;  2QI2 A;  1IV2 A;  3S02 A;  1YIJ F;  2HRY A;  3FD5 A;  3LWQ C;  1VQ5 F;  3J7A R;  5KX5 A;  3TD4 A;  2HS3 A;  2BTQ B;  1DT9 A;  5HP7 A;  2QA4 F;  1CK2 A;  1W42 A;  3CCM F;  2UZH A;  3GHZ A;  4ZOL B;  4U3J A;  3RYI A;  5CA1 A;  1NMU B;  3LWO C;  1IV3 A;  5EZY B;  4BT7 A;  4LCK A;  1VQ4 F;  1U3L A;  4X1Y B;  3MBM A;  1W5E A;  2Z1U A;  3RE3 A;  3NVK E;  3LME A;  4G4Z A;  4HNA A;  3F0E A;  3C8L A;  1JJ2 F;  3JAL A;  5MN6 A;  1W5F A;  1TUB A;  5JCO C;  1JY8 A;  4O2B A;  5LXT A;  2B33 A;  3ON1 A;  3NVI B;  1VQ9 F;  1GZ0 A;  4EI9 A;  4EI8 A;  2LBX A;  4O4J A;  2ZOD A;  4ZHW A;  3JAW B;  5G4U C;  3JAK B;  4B45 A;  1SA0 B;  1XBI A;  5FNV B;  3MQW A;  1J7H A;  4IIJ A;  2LBW A;  2CHT A;  3JAM M;  1Q7Y H;  1SDS A;  3NK6 A;  4G88 A;  3QTY A;  2HP3 A;  1VQ8 F;  3HKC A;  2P6Y A;  2VGM A;  1QVF F;  3R0P A;  3CC2 F;  3JAR B;  3WGL A;  2BTU A;  4ZHV A;  5HWE A;  3WJP A;  1VQ7 F;  4YJ2 A;  2CZW A;  3ZP4 A;  3JAT A;  2QTP A;  3HKD A;  3ZOP A;  1CN7 A;  5EYP B;  1QAH A;  5J2T A;  3K12 A;  2F9Z C;  4X1K A;  5FJ4 C;  1VQO F;  1PXW A;  1QVG F;  3HKE B;  3WXM B;  1Q81 H;  4YJ3 A;  1H7M A;  3QHD A;  1X7P A;  3K0T A;  1YHQ F;  2Z1E A;  4KWE A;  2I6D A;  1Q86 H;  4BVR A;  3G6E F;  4X3L A;  1W2B F;  4X20 A;  1W3E X;  1IV4 A;  2V9Y A;  3TD5 A;  4G4X A;  5J2U A;  3AGK A;  3VOB A;  3VTI C;  5EO3 A;  1RLG A;  1NJI H;  1PF5 A;  3ESJ A;  4ZHQ B;  3FPI A;  3IKF A;  5LYJ A;  1VQK F;  5GON A;  2UYN A;  2IG8 A;  5C8Y A;  5ITZ A;  5HXU A;  2LCA A;  4DXD A;  2OHW A;  5CA0 B;  5BMV B;  3VO8 A;  3V7E A;  5FLX M;  1VQM F;  2ZAU A;  2RHL A;  4ZOL A;  1H47 A;  2H8E A;  1RQ7 A;  1XRG A;  3F0G A;  5GAN K;  2OTL F;  4ERH A;  4TZZ A;  2BO1 A;  1IPA A;  1YI2 F;  3RYH A;  1VQP F;  5JQG B;  3G71 F;  2G9I A;  3I3F A;  4ZI7 A;  5EB0 A;  5GIP C;  3F6M A;  2YYE A;  4O4L A;  5IJ0 B;  4IHJ A;  3E20 B;  5EIB D;  5JVD A;  3CCL F;  4EB6 B;  2RB9 A;  1YJW F;  3S0W A;  3C9R A;  3D01 A;  3LWP C;  4E6E A;  2PMP A;  4M8I A;  3C9T A;  1W55 A;  3JAS A;  2PHN A;  1N8R H;  3CPQ A;  1TVK B;  2I6R A;  5FNV A;  4C4W C;  5IYZ B;  3WGN A;  4B5C A;  2Q1X A;  3B6N A;  4O4I B;  4DRX A;  3M1X A;  2HRU A;  3QUW A;  3LWR C;  4TV8 B;  3RYC B;  3UT5 A;  4NUT A;  1YQN A;  4TUY B;  3JAR A;  1U3P A;  4PWT A;  5LP6 C;  1COM A;  5EAZ A;  2H8C A;  5MN5 A;  1QD9 A;  3RYF A;  1FNJ A;  2AIF A;  5HXZ A;  5EYP A;  3FFM A;  4FFB B;  2MQE A;  2FGY A;  2AIZ P;  4X3M A;  1OFU A;  1VQ6 F;  3E22 B;  2ZF8 A;  1VQN F;  3HAX D;  2UYP A;  2HQS C;  3DC2 A;  3HKB B;  5LP6 B;  4XCQ A;  1FFX B;  1W40 A;  3WPX A;  2NMU A;  4X1I A;  4C8G A;  5KX5 B;  2CWJ A;  4O2A A;  2Z1F A;  3CC4 F;  3VYU C;  1RLU A;  3V7Q A;  1XHO A;  3RYI B;  4U3J B;  5CA1 B;  3T80 A;  3F0D A;  5LA6 A;  4I4T B;  4WBN A;  3LYB A;  1W59 A;  4C82 A;  5HY0 A;  1M90 H;  2H6L A;  3ZP7 A;  3N2K A;  3D54 A;  4TV9 A;  1KNK A;  3N2G A;  3VI6 A;  1JFF A;  4O4H A;  1KD1 H;  4R40 B;  4BVT A;  4HNA B;  4BY9 D;  2HP0 A;  3JAL B;  5A2Q M;  3VYS C;  4U39 A;  2RHO A;  2DYY A;  3MCQ A;  5CB4 B;  1TUB B;  4BT4 A;  5LOV A;  4G4V A;  4O2B B;  3OBY A;  1VK3 A;  3LFO A;  1NQ3 A;  4I55 A;  1Q8R A;  2ALE A;  4O4J B;  5AVM A;  4I50 A;  3EOR A;  3WPW A;  4ZHY B;  4F6R A;  3VCZ A;  3GYQ A;  2RHJ A;  1W5B A;  2GZL A;  4RQO A;  5KMG A;  1ZWZ A;  4LNU A;  3CYQ A;  2KGW A;  3GTZ A;  3HKC B;  3IR9 A;  1T0K B;  3WJQ A;  3MCA B;  2ZVZ A;  3LDT A;  3NMU C;  1W57 A;  4YJ2 B;  3JAT B;  2W8B C;  2ZOV A;  3KIZ A;  3P4E A;  3VIU A;  3C9S A;  3FBA A;  3I55 F;  3CCV F;  3CB2 A;  5IJ9 B;  5EZY A;  1VQL F;  1W41 A;  3J81 M;  5J2T B;  3CXC F;  2CW4 A;  4X1Y A;  5JH7 B;  1FSZ A;  3HTN A;  5HY2 A;  4YJ3 B;  2UYJ A;  4EI7 A;  2LBT A;  3N4Z A;  3CCU F;  1SZQ A;  4BW0 B;  3RYC A;  4BT2 A;  5B8F A;  1DBF A;  3J80 M;  3KJJ A;  3K2X A;  2HS4 A;  1GO1 A;  4X20 B;  3HWU A;  3D00 A;  2QEX F;  1Q82 H;  1ODE A;  3RA5 A;  2IAF A;  3CPW F;  2VAP A;  3IEQ A;  3ERN A;  3KHN A;  3JAW A;  4FFB A;  2IQQ A;  3JAK A;  1U43 A;  1ONI A;  3O85 A;  2GVI A;  5EIB C;  2N48 A;  1SA0 A;  3E22 A;  5LYJ B;  3PAF A;  3L7Q A;  1FNK A;  2RHH A;  5GON B;  2HS0 A;  2UYN B;  5JCO A;  5C8Y B;  3HKB A;  5ITZ B;  5MN4 A;  3PLA C;  3OW2 F;  1VH8 A;  2KG4 A;  5G4V C;  3CCR F;  1UFY A;  1YJN F;  1KNJ A;  1R1M A;  5HY4 A;  1RA4 A;  3CD6 F;  1UI9 A;  2VAW A;  4I4T A;  3E1Y A;  2R6R 1;  3WGK A;  4BVS A;  1JN1 A;  3M4S A;  3RYH B;  3ELC A;  1U40 A;  5IT9 M;  2K1S A;  4ZI7 B;  1VQV A;  3HKE A;  2Z1T A;  4O4L B;  3SIV A;  4IHJ B;  5JVD B;  2Z01 A;  5CB4 A;  5EWR A;  1H48 A;  4BT6 A;  3CC7 F;  3SIU A;  3CME F;  3CCS F;  3VMF B;  3CMA F;  3LWV C;  1M1K H;  3K14 A;  1S72 F;  1RQ2 A;  2ZVY A;  2Q1Y A;  4RHA A;  3JAS B;  4C81 A;  1QU9 A;  1CLI A;  3N4Y A;  3WJR A;  2DT4 A;  3V4D A;  3RA6 A;  3CCJ F;  1KQS F;  1OAP A;  3KE1 A;  3U0O A;  1GO0 A;  4C8E A;  3KJK A;  4G4W A;  4BT3 A;  4ZHQ A;  1JD1 A;  3NK7 A;  1W5A A;  1YGY A;  4DRX B;  2CHS A;  1IV1 A;  5HY1 A;  4B46 A;  2BTO A;  2KTU A;  2R75 1;  5CA0 A;  1Z5V A;  3DDN A;  3IEW A;  3UT5 B;  5BMV A;  3S0Y A;  2VXY A;  2VAM A;  1YIT F;  3I7T A;  2FC3 A;  2WAL A;  5LXT B;  3G4S F;  3FD6 A;  5EB1 B;  3JVH A;  1K9M H;  3RYF B;  3OON A;  2KTV A;  2HVY D;  1XV2 A;  5HP8 A;  5IJ9 A;  5GIO C;  3I56 F;  1GX1 A;  3JCM M;  1X7O A; 
#chains in the Genus database with same CATH homology
 3K12 A;  3M4S A;  2OTM A;  2CW4 A;  1PF5 A;  1X25 A;  3KJK A;  1JD1 A;  3L7Q A;  3MQW A;  1FNK A;  3VCZ A;  3ZP7 A;  1J7H A;  2CHT A;  3I3F A;  2UYN B;  2UYN A;  2UYP A;  2IG8 A;  3LME A;  2UYJ A;  2CHS A;  3M1X A;  3GTZ A;  3QUW A;  4NWO B;  2DYY A;  3ZO8 A;  3K0T A;  2CWJ A;  1DBF A;  1UFY A;  3R0P A;  3KJJ A;  2CVL A;  3D01 A;  5HP7 A;  1COM A;  3I7T A;  2B33 A;  1XHO A;  2UYK A;  1ODE A;  1NQ3 A;  1UI9 A;  1QD9 A;  3ZP4 A;  1FNJ A;  3ZOP A;  3LYB A;  1QU9 A;  5HP8 A;  1XRG A;  3V4D A;  1QAH A;  2EWC A;  4ZK7 A;  1ONI A;  2CSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...