3ZO8A

Wild-type chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE AROH
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zo8A00
3MQWA 2UYNB 3ZP7A 1J7HA 3KJKA 3KJJA 1JD1A 1FNJA 2OTMA 4ZK7A 1DBFA 1ODEA 3LYBA 3M4SA 3V4DA 3K12A 3L7QA 3I3FA 3VCZA 1QU9A 2EWCA 3ZP4A 2IG8A 2UYJA 2CSLA 2UYPA 3LMEA 4NWOB 1NQ3A 2CVLA 3M1XA 1QAHA 3GTZA 3QUWA 3ZOPA 3K0TA 1QD9A 1COMA 1UI9A 2CHSA 1XHOA 3R0PA 2UYKA 2CWJA 1ONIA 2UYNA 1PF5A 5HP8A 1X25A 3I7TA 2CHTA 2B33A 1XRGA 5HP7A 3D01A 2DYYA 1FNKA 1UFYA 3ZO8A 2CW4A
chains in the Genus database with same CATH superfamily
3WJQA 1RLUA 2Q1YA 3CCJF 5LXTB 4I55A 1YJ9F 2H8EA 1FSZA 3P0ZA 5EB1B 3TD3A 1M90H 3JALA 3NK7A 3CCUF 4EB6B 3KHNA 3M1XA 5JQGB 1YJWF 1X7OA 2QA4F 3S06A 2HX0A 3J80M 1OFUA 3JASA 1TVKB 4FFBB 3RA5A 3LWPC 4TV8A 3C9RA 1X25A 3S0WA 2ZF8A 4O4LB 3G71F 1YGYA 2VXYA 1KNKA 2GZLA 5FLXM 1YHQF 1VQLF 4ZK7A 3HAXD 3VYSC 1RQ2A 3V4DA 2RHHA 3JATB 1GX1A 1PXWA 1QU9A 2LBWA 4O4IB 1U3PA 2UYPA 5LXTA 4O2BA 5EAZA 2BTOA 1Z5WA 4DRXA 1RQ7A 3GTZA 3ZOPA 3GYQA 4F6RB 1CLIA 3K0TA 5JVDA 2Z1FA 3HKCA 3JAWA 3N2GA 3JASB 2PHNA 3N2KB 3RYHB 3FD6A 3KIZA 4TV8B 2OTJF 1UFYA 3WGLA 4TV9B 2VGNA 3Q8HA 3G4SF 5JH7A 1JD1A 1JFFA 5LA6A 1U40A 2RHOA 2V9YA 1XBIA 2HQSC 4BT2A 3LMEA 4EB6A 1Q81H 2OTLF 4X1IA 2CVLA 4M8IA 4YJ2B 3JAKA 3NVKE 1X7PA 2K1SA 1CN7A 4O2BB 2RB9A 3MBMA 5EZYB 3CG6A 5HXZA 4LNUA 5JH7B 2HVYD 2R6R1 3HKDB 2CHTA 3HKEB 1SZQA 2JNBA 3OBYA 2DYYA 3ZO8A 3KJKA 3MQWA 5HWEA 3CCVF 2WALA 3JATA 3K2XA 4O4HA 2OHWA 1QVFF 4C81A 5KX5B 5AVMA 3LWOC 3CC4F 1W42A 1VQOF 2CSLA 4PWTA 5LP6B 1NMUB 5J2TA 5LOVA 1IPAA 3AGKA 4ZHQA 1VQMF 3OBWA 5B8FA 1QD9A 1COMA 2G9IA 2AIZP 5ITZB 1H47A 3CD6F 3HJWC 2UYNA 2FC3A 4KWEA 1SA0B 4G4ZA 3VYUC 2IQQA 3FBAA 3CCQF 2VAMA 2KGWA 2YYEA 3CMEF 5IJ9B 4BT7A 1XV2A 5DCVA 3C9UA 4ZOLA 4R40B 4BW0B 1OAPA 4IHJA 2P6YA 3C9SA 1UI9A 2DT4A 2CHSA 2ZVZA 3B6NA 2PMPA 3IMPA 2ZVYA 1VQVA 3CCLF 5JQGA 3S0HA 3GHZA 3JVHA 3C8LA 4BT3A 3QTYA 1W57A 3CB2A 5EIBD 2UYNB 1NJIH 1J7HA 2W8BC 3F0DA 1T0KB 2HS3A 2BO1A 4U39A 4X1YA 1W581 2KTVA 3MCQA 2HS0A 1W41A 4ZHQB 3CPQA 2LBXA 3ELCA 3CCSF 4ZOLB 4C8IA 2QI2A 1VQ9F 3VI6A 2RHLA 2UZHA 5LA6B 4G4XA 1JFFB 1VHAA 2B33A 2F9ZC 4BT6A 1SDSA 5HP7A 3DC2A 1Q86H 1T0AA 3QHDA 2BTUA 3ZP7A 2H8CA 4RQOA 1GO0A 3N2GB 2RHJA 4IIJA 3VO8A 2VGMA 3LWVC 3RYFB 4LNUB 2Q1XA 4TUYB 4EI9A 2HP0B 1Q7YH 3EORA 3ERNA 1K9MH 5LYJB 2ZOVA 3JAKB 3JAWB 4X1IB 1ONIA 4O2AB 2Z1EA 5GIOC 2ALEA 3N4YA 3CC2F 2QEXF 3KE1A 1KD1H 2HP3A 2ZODA 5IT9M 4O4LA 1VQ6F 3RYIB 3IR9A 3M4SA 3P4EA 2OZBA 2Z01A 3FPIA 4U3JB 2I6RA 1RA4A 5HY1A 1NQ3A 3VIUA 1U3LA 4TUYA 5JCOA 3CXCF 3E22A 2CWJA 3RYIA 5HY0A 3JARB 4C82A 5J2TB 1VQ4F 1Q8RA 1YITF 4BT5A 3IEWA 5EB0A 2YXZA 2BTQB 3BYQA 3D01A 5J2UB 3OONA 4O2AA 4O4HB 1K8AH 4ZHWA 3N4ZA 3VOBA 5BMVA 3LYBA 1VQ8F 1H7MA 5IYZB 5KMGA 2HP0A 2L26A 3G6EF 1W2BF 4DXDA 1QAHA 5IJ0B 5EWRA 5HY4A 5CB4B 5FNVB 5MN6A 4B5CA 3NMUC 5HXUA 4O4IA 3S03A 1IV1A 3NVIB 3PLAC 2ZAUA 3J7AR 4C4WC 4HNAA 5LP6C 1S72F 3ESJA 3IKFA 4O4JB 3JARA 3F0FA 3D00A 4BVQA 1U43A 1W59A 2I6DA 4I4TB 3RYCA 3HWUA 1RLGA 1TUBB 3HKBB 4BY9D 2KG4A 3IKEA 3I56F 4RHAA 2IG8A 3E1YA 4X1KA 3TD4A 5GONB 5BMVB 4WBNB 3QUWA 3CCRF 3HKEA 4ZHVA 5C8YA 4BT4A 1H48A 2UYKA 1VQ5F 1ZWZA 5FNVA 1XRGA 5MN5A 1FFXB 3V3TA 2Z1UA 4ZI7B 1W40A 3FD5A 3RYFA 1N8RH 3F6MA 4I55B 1W3EX 5GINC 3M84A 5LOVB 3K14A 3ON1A 4O4JA 5CA0B 3J81M 3I3FA 1JN1A 4B46A 3LDTA 5CB4A 4U3JA 4X20B 2H6LA 5CA1B 5IJ0A 3F0EA 1K73H 5A2QM 4FFBA 5GONA 3D54A 3LWRC 4BVSA 1IV3A 3WGNA 1E7KA 1XHOA 4TV9A 2QTPA 3UT5A 3E22B 5HY2A 3I7TA 5JCOC 4YJ3B 3VOAA 3LFOA 1VQKF 5EYPB 1Z5VA 3CMAF 3KJJA 4I50A 1DBFA 3WPWA 1X52A 1Q82H 3IEQA 3S0YA 5GAPK 4YJ2A 2AMTA 5EYPA 4ERHA 3CCMF 3SIUA 1YJNF 1GO1A 1PF5A 3CYQA 4B62A 4B45A 3UT5B 1FNKA 2Z1TA 3OW2F 5G4UC 1KNJA 3MCAB 4TZZA 1M1KH 4G4YA 3WGMA 1FNJA 5CA0A 1W5EA 4G4WA 3RYCB 2HRUA 3RE3A 3VCZA 2UYJA 5G4VC 4NWOB 4HNAB 1YIJF 3E20B 3VTIC 5EZYA 3O85A 1VQPF 1GZ0A 3P10A 3DDNA 4YJ3A 5C8YB 5GIPC 1DT9A 5J2UA 4NUTA 4IIJB 3VMFB 5IJ9A 2FGYA 1TVKA 3NK6A 1W55A 3V7EA 3V7QA 3TD5A 5JVDB 3RA6A 2R751 5LP6A 2HS4A 3JCMM 3HKCB 3WGJA 2GLZA 3CYPB 3S02A 4EI7A 5ITZA 4ZHYB 4E6EA 1YQNA 1SA0A 4X3LA 3C9TA 3HTNA 4DRXB 4X3MA 5HP8A 3LWQC 2AIFA 4X1YB 3HKDA 3CC7F 1JY8A 4C8GA 5MN4A 5EO3A 3MDOA 3WJPA 2CW4A 4EI8A 2VAPA 5CA1A 3SIVA 2OTMA 1KC8H 1ODEA 3L7QA 3JAMM 4IHJB 5IYZA 2EWCA 3ZP4A 2LBTA 1QVGF 2IAFA 4C8EA 3FFMA 5KMGB 3JALB 1W5BA 1VH8A 4G88A 4X20A 5FJ4C 2MQEA 3N2KA 3RYHA 1IV4A 4LCKA 4I50B 5EIBC 4XCQA 4ZI7A 3WGKA 1W5AA 3VYTC 3WJRA 3WPXA 1JJ2F 4BVTA 2KTUA 2HRYA 4NQ3A 2GVIA 2VAWA 2N48A 3K12A 1KQSF 1VK3A 1TUBA 3U0OA 3T80A 3F0GA 1IV2A 2NMUA 4X1KB 5KX5A 1W5FA 1R1MA 3PAFA 1VQ7F 4WBNA 3I55F 4F6RA 3R0PA 3WXMB 3CPWF 3CCEF 1CK2A 4G4VA 4I4TA 5LYJA 2CZWA 4BVRA 3HKBA 1VQNF 2LCAA 5GANK 1YI2F 1FFXA
chains in the Genus database with same CATH topology
3MQWA 2UYNB 3ZP7A 1J7HA 3KJKA 3KJJA 1JD1A 1FNJA 2OTMA 4ZK7A 1DBFA 1ODEA 3LYBA 3M4SA 3V4DA 3K12A 3L7QA 3I3FA 3VCZA 1QU9A 2EWCA 3ZP4A 2IG8A 2UYJA 2CSLA 2UYPA 3LMEA 4NWOB 1NQ3A 2CVLA 3M1XA 1QAHA 3GTZA 3QUWA 3ZOPA 3K0TA 1QD9A 1COMA 1UI9A 2CHSA 1XHOA 3R0PA 2UYKA 2CWJA 1ONIA 2UYNA 1PF5A 5HP8A 1X25A 3I7TA 2CHTA 2B33A 1XRGA 5HP7A 3D01A 2DYYA 1FNKA 1UFYA 3ZO8A 2CW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQW A;  2UYN B;  3ZP7 A;  1J7H A;  3KJK A;  3KJJ A;  1JD1 A;  1FNJ A;  2OTM A;  4ZK7 A;  1DBF A;  1ODE A;  3LYB A;  3M4S A;  3V4D A;  3K12 A;  3L7Q A;  3I3F A;  3VCZ A;  1QU9 A;  2EWC A;  3ZP4 A;  2IG8 A;  2UYJ A;  2CSL A;  2UYP A;  3LME A;  4NWO B;  1NQ3 A;  2CVL A;  3M1X A;  1QAH A;  3GTZ A;  3QUW A;  3ZOP A;  3K0T A;  1QD9 A;  1COM A;  1UI9 A;  2CHS A;  1XHO A;  3R0P A;  2UYK A;  2CWJ A;  1ONI A;  2UYN A;  1PF5 A;  5HP8 A;  1X25 A;  3I7T A;  2CHT A;  2B33 A;  1XRG A;  5HP7 A;  3D01 A;  2DYY A;  1FNK A;  1UFY A;  3ZO8 A;  2CW4 A; 
#chains in the Genus database with same CATH topology
 3WJQ A;  1RLU A;  2Q1Y A;  3CCJ F;  5LXT B;  4I55 A;  1YJ9 F;  2H8E A;  1FSZ A;  3P0Z A;  5EB1 B;  3TD3 A;  1M90 H;  3JAL A;  3NK7 A;  3CCU F;  4EB6 B;  3KHN A;  3M1X A;  5JQG B;  1YJW F;  1X7O A;  2QA4 F;  3S06 A;  2HX0 A;  3J80 M;  1OFU A;  3JAS A;  1TVK B;  4FFB B;  3RA5 A;  3LWP C;  4TV8 A;  3C9R A;  1X25 A;  3S0W A;  2ZF8 A;  4O4L B;  3G71 F;  1YGY A;  2VXY A;  1KNK A;  2GZL A;  5FLX M;  1YHQ F;  1VQL F;  4ZK7 A;  3HAX D;  3VYS C;  1RQ2 A;  3V4D A;  2RHH A;  3JAT B;  1GX1 A;  1PXW A;  1QU9 A;  2LBW A;  4O4I B;  1U3P A;  2UYP A;  5LXT A;  4O2B A;  5EAZ A;  2BTO A;  1Z5W A;  4DRX A;  1RQ7 A;  3GTZ A;  3ZOP A;  3GYQ A;  4F6R B;  1CLI A;  3K0T A;  5JVD A;  2Z1F A;  3HKC A;  3JAW A;  3N2G A;  3JAS B;  2PHN A;  3N2K B;  3RYH B;  3FD6 A;  3KIZ A;  4TV8 B;  2OTJ F;  1UFY A;  3WGL A;  4TV9 B;  2VGN A;  3Q8H A;  3G4S F;  5JH7 A;  1JD1 A;  1JFF A;  5LA6 A;  1U40 A;  2RHO A;  2V9Y A;  1XBI A;  2HQS C;  4BT2 A;  3LME A;  4EB6 A;  1Q81 H;  2OTL F;  4X1I A;  2CVL A;  4M8I A;  4YJ2 B;  3JAK A;  3NVK E;  1X7P A;  2K1S A;  1CN7 A;  4O2B B;  2RB9 A;  3MBM A;  5EZY B;  3CG6 A;  5HXZ A;  4LNU A;  5JH7 B;  2HVY D;  2R6R 1;  3HKD B;  2CHT A;  3HKE B;  1SZQ A;  2JNB A;  3OBY A;  2DYY A;  3ZO8 A;  3KJK A;  3MQW A;  5HWE A;  3CCV F;  2WAL A;  3JAT A;  3K2X A;  4O4H A;  2OHW A;  1QVF F;  4C81 A;  5KX5 B;  5AVM A;  3LWO C;  3CC4 F;  1W42 A;  1VQO F;  2CSL A;  4PWT A;  5LP6 B;  1NMU B;  5J2T A;  5LOV A;  1IPA A;  3AGK A;  4ZHQ A;  1VQM F;  3OBW A;  5B8F A;  1QD9 A;  1COM A;  2G9I A;  2AIZ P;  5ITZ B;  1H47 A;  3CD6 F;  3HJW C;  2UYN A;  2FC3 A;  4KWE A;  1SA0 B;  4G4Z A;  3VYU C;  2IQQ A;  3FBA A;  3CCQ F;  2VAM A;  2KGW A;  2YYE A;  3CME F;  5IJ9 B;  4BT7 A;  1XV2 A;  5DCV A;  3C9U A;  4ZOL A;  4R40 B;  4BW0 B;  1OAP A;  4IHJ A;  2P6Y A;  3C9S A;  1UI9 A;  2DT4 A;  2CHS A;  2ZVZ A;  3B6N A;  2PMP A;  3IMP A;  2ZVY A;  1VQV A;  3CCL F;  5JQG A;  3S0H A;  3GHZ A;  3JVH A;  3C8L A;  4BT3 A;  3QTY A;  1W57 A;  3CB2 A;  5EIB D;  2UYN B;  1NJI H;  1J7H A;  2W8B C;  3F0D A;  1T0K B;  2HS3 A;  2BO1 A;  4U39 A;  4X1Y A;  1W58 1;  2KTV A;  3MCQ A;  2HS0 A;  1W41 A;  4ZHQ B;  3CPQ A;  2LBX A;  3ELC A;  3CCS F;  4ZOL B;  4C8I A;  2QI2 A;  1VQ9 F;  3VI6 A;  2RHL A;  2UZH A;  5LA6 B;  4G4X A;  1JFF B;  1VHA A;  2B33 A;  2F9Z C;  4BT6 A;  1SDS A;  5HP7 A;  3DC2 A;  1Q86 H;  1T0A A;  3QHD A;  2BTU A;  3ZP7 A;  2H8C A;  4RQO A;  1GO0 A;  3N2G B;  2RHJ A;  4IIJ A;  3VO8 A;  2VGM A;  3LWV C;  3RYF B;  4LNU B;  2Q1X A;  4TUY B;  4EI9 A;  2HP0 B;  1Q7Y H;  3EOR A;  3ERN A;  1K9M H;  5LYJ B;  2ZOV A;  3JAK B;  3JAW B;  4X1I B;  1ONI A;  4O2A B;  2Z1E A;  5GIO C;  2ALE A;  3N4Y A;  3CC2 F;  2QEX F;  3KE1 A;  1KD1 H;  2HP3 A;  2ZOD A;  5IT9 M;  4O4L A;  1VQ6 F;  3RYI B;  3IR9 A;  3M4S A;  3P4E A;  2OZB A;  2Z01 A;  3FPI A;  4U3J B;  2I6R A;  1RA4 A;  5HY1 A;  1NQ3 A;  3VIU A;  1U3L A;  4TUY A;  5JCO A;  3CXC F;  3E22 A;  2CWJ A;  3RYI A;  5HY0 A;  3JAR B;  4C82 A;  5J2T B;  1VQ4 F;  1Q8R A;  1YIT F;  4BT5 A;  3IEW A;  5EB0 A;  2YXZ A;  2BTQ B;  3BYQ A;  3D01 A;  5J2U B;  3OON A;  4O2A A;  4O4H B;  1K8A H;  4ZHW A;  3N4Z A;  3VOB A;  5BMV A;  3LYB A;  1VQ8 F;  1H7M A;  5IYZ B;  5KMG A;  2HP0 A;  2L26 A;  3G6E F;  1W2B F;  4DXD A;  1QAH A;  5IJ0 B;  5EWR A;  5HY4 A;  5CB4 B;  5FNV B;  5MN6 A;  4B5C A;  3NMU C;  5HXU A;  4O4I A;  3S03 A;  1IV1 A;  3NVI B;  3PLA C;  2ZAU A;  3J7A R;  4C4W C;  4HNA A;  5LP6 C;  1S72 F;  3ESJ A;  3IKF A;  4O4J B;  3JAR A;  3F0F A;  3D00 A;  4BVQ A;  1U43 A;  1W59 A;  2I6D A;  4I4T B;  3RYC A;  3HWU A;  1RLG A;  1TUB B;  3HKB B;  4BY9 D;  2KG4 A;  3IKE A;  3I56 F;  4RHA A;  2IG8 A;  3E1Y A;  4X1K A;  3TD4 A;  5GON B;  5BMV B;  4WBN B;  3QUW A;  3CCR F;  3HKE A;  4ZHV A;  5C8Y A;  4BT4 A;  1H48 A;  2UYK A;  1VQ5 F;  1ZWZ A;  5FNV A;  1XRG A;  5MN5 A;  1FFX B;  3V3T A;  2Z1U A;  4ZI7 B;  1W40 A;  3FD5 A;  3RYF A;  1N8R H;  3F6M A;  4I55 B;  1W3E X;  5GIN C;  3M84 A;  5LOV B;  3K14 A;  3ON1 A;  4O4J A;  5CA0 B;  3J81 M;  3I3F A;  1JN1 A;  4B46 A;  3LDT A;  5CB4 A;  4U3J A;  4X20 B;  2H6L A;  5CA1 B;  5IJ0 A;  3F0E A;  1K73 H;  5A2Q M;  4FFB A;  5GON A;  3D54 A;  3LWR C;  4BVS A;  1IV3 A;  3WGN A;  1E7K A;  1XHO A;  4TV9 A;  2QTP A;  3UT5 A;  3E22 B;  5HY2 A;  3I7T A;  5JCO C;  4YJ3 B;  3VOA A;  3LFO A;  1VQK F;  5EYP B;  1Z5V A;  3CMA F;  3KJJ A;  4I50 A;  1DBF A;  3WPW A;  1X52 A;  1Q82 H;  3IEQ A;  3S0Y A;  5GAP K;  4YJ2 A;  2AMT A;  5EYP A;  4ERH A;  3CCM F;  3SIU A;  1YJN F;  1GO1 A;  1PF5 A;  3CYQ A;  4B62 A;  4B45 A;  3UT5 B;  1FNK A;  2Z1T A;  3OW2 F;  5G4U C;  1KNJ A;  3MCA B;  4TZZ A;  1M1K H;  4G4Y A;  3WGM A;  1FNJ A;  5CA0 A;  1W5E A;  4G4W A;  3RYC B;  2HRU A;  3RE3 A;  3VCZ A;  2UYJ A;  5G4V C;  4NWO B;  4HNA B;  1YIJ F;  3E20 B;  3VTI C;  5EZY A;  3O85 A;  1VQP F;  1GZ0 A;  3P10 A;  3DDN A;  4YJ3 A;  5C8Y B;  5GIP C;  1DT9 A;  5J2U A;  4NUT A;  4IIJ B;  3VMF B;  5IJ9 A;  2FGY A;  1TVK A;  3NK6 A;  1W55 A;  3V7E A;  3V7Q A;  3TD5 A;  5JVD B;  3RA6 A;  2R75 1;  5LP6 A;  2HS4 A;  3JCM M;  3HKC B;  3WGJ A;  2GLZ A;  3CYP B;  3S02 A;  4EI7 A;  5ITZ A;  4ZHY B;  4E6E A;  1YQN A;  1SA0 A;  4X3L A;  3C9T A;  3HTN A;  4DRX B;  4X3M A;  5HP8 A;  3LWQ C;  2AIF A;  4X1Y B;  3HKD A;  3CC7 F;  1JY8 A;  4C8G A;  5MN4 A;  5EO3 A;  3MDO A;  3WJP A;  2CW4 A;  4EI8 A;  2VAP A;  5CA1 A;  3SIV A;  2OTM A;  1KC8 H;  1ODE A;  3L7Q A;  3JAM M;  4IHJ B;  5IYZ A;  2EWC A;  3ZP4 A;  2LBT A;  1QVG F;  2IAF A;  4C8E A;  3FFM A;  5KMG B;  3JAL B;  1W5B A;  1VH8 A;  4G88 A;  4X20 A;  5FJ4 C;  2MQE A;  3N2K A;  3RYH A;  1IV4 A;  4LCK A;  4I50 B;  5EIB C;  4XCQ A;  4ZI7 A;  3WGK A;  1W5A A;  3VYT C;  3WJR A;  3WPX A;  1JJ2 F;  4BVT A;  2KTU A;  2HRY A;  4NQ3 A;  2GVI A;  2VAW A;  2N48 A;  3K12 A;  1KQS F;  1VK3 A;  1TUB A;  3U0O A;  3T80 A;  3F0G A;  1IV2 A;  2NMU A;  4X1K B;  5KX5 A;  1W5F A;  1R1M A;  3PAF A;  1VQ7 F;  4WBN A;  3I55 F;  4F6R A;  3R0P A;  3WXM B;  3CPW F;  3CCE F;  1CK2 A;  4G4V A;  4I4T A;  5LYJ A;  2CZW A;  4BVR A;  3HKB A;  1VQN F;  2LCA A;  5GAN K;  1YI2 F;  1FFX A; 
#chains in the Genus database with same CATH homology
 3MQW A;  2UYN B;  3ZP7 A;  1J7H A;  3KJK A;  3KJJ A;  1JD1 A;  1FNJ A;  2OTM A;  4ZK7 A;  1DBF A;  1ODE A;  3LYB A;  3M4S A;  3V4D A;  3K12 A;  3L7Q A;  3I3F A;  3VCZ A;  1QU9 A;  2EWC A;  3ZP4 A;  2IG8 A;  2UYJ A;  2CSL A;  2UYP A;  3LME A;  4NWO B;  1NQ3 A;  2CVL A;  3M1X A;  1QAH A;  3GTZ A;  3QUW A;  3ZOP A;  3K0T A;  1QD9 A;  1COM A;  1UI9 A;  2CHS A;  1XHO A;  3R0P A;  2UYK A;  2CWJ A;  1ONI A;  2UYN A;  1PF5 A;  5HP8 A;  1X25 A;  3I7T A;  2CHT A;  2B33 A;  1XRG A;  5HP7 A;  3D01 A;  2DYY A;  1FNK A;  1UFY A;  3ZO8 A;  2CW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...