3ZO8A

Wild-type chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
b'MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zo8A00
1QU9A 3I3FA 1UI9A 2UYNB 5HP7A 3LYBA 2IG8A 2CSLA 3ZOPA 2CW4A 1XHOA 1QD9A 2CHTA 1X25A 2CWJA 3VCZA 1ONIA 5HP8A 3I7TA 2UYNA 2OTMA 1QAHA 4ZK7A 3MQWA 2UYPA 1ODEA 1FNJA 3GTZA 1UFYA 1XRGA 3LMEA 1J7HA 2DYYA 1JD1A 1PF5A 2B33A 2CVLA 3L7QA 3M4SA 3V4DA 4NWOB 1NQ3A 3M1XA 2UYKA 3K12A 3KJJA 3R0PA 3D01A 3ZP4A 3ZP7A 1FNKA 2UYJA 3KJKA 3ZO8A 2EWCA 3K0TA 2CHSA 1DBFA 3QUWA 1COMA
chains in the Genus database with same CATH superfamily
3HKEA 3WPXA 1W5BA 1UI9A 3UT5B 3CCRF 3OONA 3LWRC 3EORA 5KX5A 2R6R1 3HKCA 3WJQA 2Z1TA 2VGNA 2OTJF 2IQQA 2DYYA 4X1YA 3VTIC 3I56F 1E7KA 3B6NA 1NQ3A 3RE3A 2VAMA 3CYQA 5C8YA 1SDSA 3K12A 3E20B 3S03A 3P0ZA 5MN6A 3ZP4A 3CPQA 3Q8HA 3CMAF 3CPWF 3MBMA 4WBNB 2CSLA 2AIZP 1DT9A 5CA1B 1IV1A 4O2AB 4KWEA 1RLUA 2OTMA 4TV8B 5LYJA 1YJNF 5HY0A 3PAFA 4O2AA 3TD4A 1Q82H 1JFFA 1JY8A 4G4WA 2DT4A 2CVLA 4C81A 2LCAA 1OAPA 3HTNA 3CC2F 2Q1XA 2GVIA 2HQSC 4BVRA 3VYSC 1K73H 2VAWA 3CCMF 3PLAC 2EWCA 3FD5A 5LP6C 2K1SA 1VQ4F 4DXDA 1YHQF 3ESJA 5JCOC 3F0FA 3I55F 1XV2A 5EZYA 2FGYA 4O4LB 5EAZA 5EWRA 2GZLA 1KQSF 2VGMA 2OTLF 3MDOA 3JARB 4U3JB 4F6RB 5HP8A 2ALEA 3KIZA 3AGKA 1GO0A 3JARA 4U3JA 5DCVA 4C8GA 3CCSF 3C9UA 1PF5A 4X1KA 5MN5A 1SZQA 1VQPF 4B5CA 3JATB 3VYUC 3K14A 5CB4A 2MQEA 3HKDB 5MN4A 3G4SF 2I6DA 5IYZB 1H48A 2BO1A 3IR9A 3JATA 3RYCA 3CCJF 1W5AA 2ZVZA 3OBWA 5LOVB 3DC2A 1TVKB 1W581 5LP6B 4YJ2B 2BTUA 3MCAB 2BTQB 4BW0B 5LOVA 3CCLF 5HY1A 4ZK7A 4C82A 1ZWZA 3DDNA 4YJ2A 3GTZA 3LMEA 5IJ0A 2OZBA 5CA0A 4B62A 2KTUA 2HRYA 3V7QA 3M1XA 2YXZA 3R0PA 3BYQA 4IIJB 3WGKA 1U3PA 4I50B 5HY4A 4EB6B 4I55A 2VAPA 4IIJA 1VQVA 5HP7A 4TV9A 1N8RH 3N4YA 1ONIA 3CXCF 4FFBB 4TUYA 1W2BF 1SA0A 1JD1A 4FFBA 4NQ3A 3CYPB 1OFUA 3OBYA 3IEWA 3KJJA 3NK6A 3JAWB 1KD1H 5ITZB 5GAPK 3KJKA 1Q8RA 4EI9A 3JAWA 5ITZA 1Q81H 3RYIA 2HVYD 1QU9A 3SIVA 4ZHYB 2BTOA 3JASB 3IMPA 4TZZA 3P4EA 1VQ6F 2KGWA 1VQLF 1CK2A 3UT5A 2NMUA 1K8AH 3C9SA 3CD6F 1Z5VA 1H47A 3VOAA 1PXWA 1X7PA 3M4SA 4LCKA 2HX0A 2QTPA 1VQMF 1W55A 3S0YA 5A2QM 3FD6A 2CHSA 3WGNA 3LWVC 3LFOA 3GHZA 3F0EA 2CW4A 2ZF8A 1QD9A 1VQKF 2GLZA 4ZOLB 1GO1A 4WBNA 4BT2A 3G71F 5CA1A 1VQ9F 4C8EA 1W42A 1W59A 3C8LA 1FSZA 4X3LA 4TV8A 2VXYA 1Q7YH 3T80A 4M8IA 2QEXF 3N4ZA 4EI8A 1U43A 5BMVB 2AMTA 2QA4F 1COMA 2G9IA 4O4JB 3QHDA 3JCMM 1X25A 1U40A 4X1IB 5GIOC 4O4JA 3LWOC 5EO3A 4O4LA 3IEQA 1ODEA 1RA4A 2PMPA 4G88A 4F6RA 3FBAA 3CCQF 4PWTA 5GINC 2H8EA 3CG6A 3LWQC 3JAMM 4BT7A 2UZHA 3LWPC 3CMEF 2HS4A 3F0GA 3KHNA 4ZI7B 3WGMA 1YGYA 5GIPC 3QTYA 3QUWA 5JVDB 5J2UB 3S06A 5HY2A 1Q86H 2UYNB 3NVKE 3HKDA 4ZI7A 1JN1A 2ZODA 4O2BB 5IYZA 1RQ7A 1XHOA 2CHTA 5JVDA 5JH7B 2RHLA 2CZWA 1IV3A 1TVKA 2KTVA 1VQ7F 1CN7A 5LP6A 5EB0A 5JH7A 5JCOA 5LA6B 1VQNF 1UFYA 3CB2A 5IJ9B 5FJ4C 3FPIA 3HJWC 1W40A 1VQ8F 4ERHA 2N48A 5IJ9A 3WGJA 1VK3A 3ERNA 5FLXM 1GZ0A 2UYJA 2RHJA 4ZHWA 1W5FA 1XBIA 3WJRA 1RLGA 4BT6A 1KC8H 3CCUF 4I50A 3J80M 4EB6A 2CWJA 3HKBB 5EB1B 3VCZA 4BVSA 2IAFA 4X20B 3TD5A 3U0OA 3GYQA 5J2TB 3M84A 3E1YA 4X20A 3MCQA 1M90H 2ZOVA 2Z1EA 3C9TA 4HNAB 5J2TA 2ZAUA 5LXTB 2HP3A 4C4WC 2UYKA 2Z1UA 2HS3A 3RYHB 1KNKA 1YQNA 3K0TA 3VYTC 4O4HB 5GONB 3WJPA 3RYHA 3ZOPA 5EYPB 1Z5WA 5KMGB 1YJWF 4G4VA 3F6MA 5EYPA 3J81M 3JASA 4XCQA 3CCVF 3RA5A 1W41A 2FC3A 3V4DA 3NMUC 2QI2A 2F9ZC 1VH8A 3V7EA 1FFXB 5KX5B 3HKCB 3P10A 4R40B 2Q1YA 3D00A 4O4IB 3HWUA 4RHAA 1FFXA 4ZHQB 2Z1FA 4O4IA 2I6RA 4X1YB 3OW2F 2H8CA 3VIUA 3N2KB 3LDTA 3S0HA 2LBWA 4ZHQA 5C8YB 5JQGB 3IKFA 1S72F 2HS0A 3N2GB 1JJ2F 3SIUA 3CC7F 4ZOLA 3N2KA 4RQOA 4NWOB 5JQGA 3N2GA 1QVGF 1W5EA 3G6EF 1X52A 1VQOF 1W3EX 3WXMB 2IG8A 5LYJB 5BMVA 2RB9A 1YJ9F 1JFFB 3JALB 1VQ5F 5EIBD 4I4TB 2LBTA 3NVIB 1FNJA 5HWEA 1XRGA 3JALA 5FNVB 4EI7A 4X1IA 5EIBC 5AVMA 4I4TA 4BVQA 4U39A 1R1MA 1K9MH 3WGLA 3K2XA 5FNVA 4NUTA 3CC4F 3E22B 1FNKA 5EZYB 2LBXA 5HXUA 3VMFB 4BY9D 5GANK 4B46A 3E22A 2H6LA 1T0KB 3ON1A 3LYBA 2AIFA 4DRXB 4C8IA 5J2UA 2P6YA 2R751 2UYNA 4X1KB 4DRXA 1QAHA 4BVTA 3MQWA 2UYPA 4O2BA 4YJ3B 2HRUA 2KG4A 1QVFF 3RA6A 2YYEA 1J7HA 4B45A 5CB4B 5B8FA 1YIJF 4YJ3A 3RYCB 1T0AA 1TUBB 1GX1A 3D01A 5LA6A 1YITF 1M1KH 2PHNA 5G4VC 4ZHVA 1NJIH 3KE1A 3NK7A 1TUBA 1DBFA 4G4ZA 3I3FA 3IKEA 3JAKB 3VI6A 2Z01A 2WALA 5G4UC 1W57A 3JAKA 5IJ0B 5CA0B 1H7MA 4G4XA 1CLIA 4BT5A 1IPAA 4LNUB 3HKBA 2OHWA 4G4YA 2B33A 3FFMA 3L7QA 1VHAA 3TD3A 1IV2A 3S0WA 4BT3A 4I55B 3O85A 4LNUA 3V3TA 4BT4A 1NMUB 2RHOA 3ZP7A 4TV9B 3ZO8A 4HNAA 5LXTA 2HP0B 2W8BC 1RQ2A 3VOBA 4E6EA 2HP0A 2V9YA 4TUYB 3J7AR 4X3MA 3C9RA 3JVHA 1SA0B 4O4HA 5GONA 3I7TA 3F0DA 2ZVYA 3D54A 5IT9M 3ELCA 5KMGA 2RHHA 1X7OA 3RYFB 4IHJB 3S02A 1IV4A 3RYIB 1YI2F 2JNBA 3WPWA 3RYFA 3HKEB 4IHJA 3VO8A 5HXZA 1KNJA 1U3LA 2L26A 3HAXD 3CCEF
chains in the Genus database with same CATH topology
1QU9A 3I3FA 1UI9A 2UYNB 5HP7A 3LYBA 2IG8A 2CSLA 3ZOPA 2CW4A 1XHOA 1QD9A 2CHTA 1X25A 2CWJA 3VCZA 1ONIA 5HP8A 3I7TA 2UYNA 2OTMA 1QAHA 4ZK7A 3MQWA 2UYPA 1ODEA 1FNJA 3GTZA 1UFYA 1XRGA 3LMEA 1J7HA 2DYYA 1JD1A 1PF5A 2B33A 2CVLA 3L7QA 3M4SA 3V4DA 4NWOB 1NQ3A 3M1XA 2UYKA 3K12A 3KJJA 3R0PA 3D01A 3ZP4A 3ZP7A 1FNKA 2UYJA 3KJKA 3ZO8A 2EWCA 3K0TA 2CHSA 1DBFA 3QUWA 1COMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  3I3F A;  1UI9 A;  2UYN B;  5HP7 A;  3LYB A;  2IG8 A;  2CSL A;  3ZOP A;  2CW4 A;  1XHO A;  1QD9 A;  2CHT A;  1X25 A;  2CWJ A;  3VCZ A;  1ONI A;  5HP8 A;  3I7T A;  2UYN A;  2OTM A;  1QAH A;  4ZK7 A;  3MQW A;  2UYP A;  1ODE A;  1FNJ A;  3GTZ A;  1UFY A;  1XRG A;  3LME A;  1J7H A;  2DYY A;  1JD1 A;  1PF5 A;  2B33 A;  2CVL A;  3L7Q A;  3M4S A;  3V4D A;  4NWO B;  1NQ3 A;  3M1X A;  2UYK A;  3K12 A;  3KJJ A;  3R0P A;  3D01 A;  3ZP4 A;  3ZP7 A;  1FNK A;  2UYJ A;  3KJK A;  3ZO8 A;  2EWC A;  3K0T A;  2CHS A;  1DBF A;  3QUW A;  1COM A; 
#chains in the Genus database with same CATH topology
 3HKE A;  3WPX A;  1W5B A;  1UI9 A;  3UT5 B;  3CCR F;  3OON A;  3LWR C;  3EOR A;  5KX5 A;  2R6R 1;  3HKC A;  3WJQ A;  2Z1T A;  2VGN A;  2OTJ F;  2IQQ A;  2DYY A;  4X1Y A;  3VTI C;  3I56 F;  1E7K A;  3B6N A;  1NQ3 A;  3RE3 A;  2VAM A;  3CYQ A;  5C8Y A;  1SDS A;  3K12 A;  3E20 B;  3S03 A;  3P0Z A;  5MN6 A;  3ZP4 A;  3CPQ A;  3Q8H A;  3CMA F;  3CPW F;  3MBM A;  4WBN B;  2CSL A;  2AIZ P;  1DT9 A;  5CA1 B;  1IV1 A;  4O2A B;  4KWE A;  1RLU A;  2OTM A;  4TV8 B;  5LYJ A;  1YJN F;  5HY0 A;  3PAF A;  4O2A A;  3TD4 A;  1Q82 H;  1JFF A;  1JY8 A;  4G4W A;  2DT4 A;  2CVL A;  4C81 A;  2LCA A;  1OAP A;  3HTN A;  3CC2 F;  2Q1X A;  2GVI A;  2HQS C;  4BVR A;  3VYS C;  1K73 H;  2VAW A;  3CCM F;  3PLA C;  2EWC A;  3FD5 A;  5LP6 C;  2K1S A;  1VQ4 F;  4DXD A;  1YHQ F;  3ESJ A;  5JCO C;  3F0F A;  3I55 F;  1XV2 A;  5EZY A;  2FGY A;  4O4L B;  5EAZ A;  5EWR A;  2GZL A;  1KQS F;  2VGM A;  2OTL F;  3MDO A;  3JAR B;  4U3J B;  4F6R B;  5HP8 A;  2ALE A;  3KIZ A;  3AGK A;  1GO0 A;  3JAR A;  4U3J A;  5DCV A;  4C8G A;  3CCS F;  3C9U A;  1PF5 A;  4X1K A;  5MN5 A;  1SZQ A;  1VQP F;  4B5C A;  3JAT B;  3VYU C;  3K14 A;  5CB4 A;  2MQE A;  3HKD B;  5MN4 A;  3G4S F;  2I6D A;  5IYZ B;  1H48 A;  2BO1 A;  3IR9 A;  3JAT A;  3RYC A;  3CCJ F;  1W5A A;  2ZVZ A;  3OBW A;  5LOV B;  3DC2 A;  1TVK B;  1W58 1;  5LP6 B;  4YJ2 B;  2BTU A;  3MCA B;  2BTQ B;  4BW0 B;  5LOV A;  3CCL F;  5HY1 A;  4ZK7 A;  4C82 A;  1ZWZ A;  3DDN A;  4YJ2 A;  3GTZ A;  3LME A;  5IJ0 A;  2OZB A;  5CA0 A;  4B62 A;  2KTU A;  2HRY A;  3V7Q A;  3M1X A;  2YXZ A;  3R0P A;  3BYQ A;  4IIJ B;  3WGK A;  1U3P A;  4I50 B;  5HY4 A;  4EB6 B;  4I55 A;  2VAP A;  4IIJ A;  1VQV A;  5HP7 A;  4TV9 A;  1N8R H;  3N4Y A;  1ONI A;  3CXC F;  4FFB B;  4TUY A;  1W2B F;  1SA0 A;  1JD1 A;  4FFB A;  4NQ3 A;  3CYP B;  1OFU A;  3OBY A;  3IEW A;  3KJJ A;  3NK6 A;  3JAW B;  1KD1 H;  5ITZ B;  5GAP K;  3KJK A;  1Q8R A;  4EI9 A;  3JAW A;  5ITZ A;  1Q81 H;  3RYI A;  2HVY D;  1QU9 A;  3SIV A;  4ZHY B;  2BTO A;  3JAS B;  3IMP A;  4TZZ A;  3P4E A;  1VQ6 F;  2KGW A;  1VQL F;  1CK2 A;  3UT5 A;  2NMU A;  1K8A H;  3C9S A;  3CD6 F;  1Z5V A;  1H47 A;  3VOA A;  1PXW A;  1X7P A;  3M4S A;  4LCK A;  2HX0 A;  2QTP A;  1VQM F;  1W55 A;  3S0Y A;  5A2Q M;  3FD6 A;  2CHS A;  3WGN A;  3LWV C;  3LFO A;  3GHZ A;  3F0E A;  2CW4 A;  2ZF8 A;  1QD9 A;  1VQK F;  2GLZ A;  4ZOL B;  1GO1 A;  4WBN A;  4BT2 A;  3G71 F;  5CA1 A;  1VQ9 F;  4C8E A;  1W42 A;  1W59 A;  3C8L A;  1FSZ A;  4X3L A;  4TV8 A;  2VXY A;  1Q7Y H;  3T80 A;  4M8I A;  2QEX F;  3N4Z A;  4EI8 A;  1U43 A;  5BMV B;  2AMT A;  2QA4 F;  1COM A;  2G9I A;  4O4J B;  3QHD A;  3JCM M;  1X25 A;  1U40 A;  4X1I B;  5GIO C;  4O4J A;  3LWO C;  5EO3 A;  4O4L A;  3IEQ A;  1ODE A;  1RA4 A;  2PMP A;  4G88 A;  4F6R A;  3FBA A;  3CCQ F;  4PWT A;  5GIN C;  2H8E A;  3CG6 A;  3LWQ C;  3JAM M;  4BT7 A;  2UZH A;  3LWP C;  3CME F;  2HS4 A;  3F0G A;  3KHN A;  4ZI7 B;  3WGM A;  1YGY A;  5GIP C;  3QTY A;  3QUW A;  5JVD B;  5J2U B;  3S06 A;  5HY2 A;  1Q86 H;  2UYN B;  3NVK E;  3HKD A;  4ZI7 A;  1JN1 A;  2ZOD A;  4O2B B;  5IYZ A;  1RQ7 A;  1XHO A;  2CHT A;  5JVD A;  5JH7 B;  2RHL A;  2CZW A;  1IV3 A;  1TVK A;  2KTV A;  1VQ7 F;  1CN7 A;  5LP6 A;  5EB0 A;  5JH7 A;  5JCO A;  5LA6 B;  1VQN F;  1UFY A;  3CB2 A;  5IJ9 B;  5FJ4 C;  3FPI A;  3HJW C;  1W40 A;  1VQ8 F;  4ERH A;  2N48 A;  5IJ9 A;  3WGJ A;  1VK3 A;  3ERN A;  5FLX M;  1GZ0 A;  2UYJ A;  2RHJ A;  4ZHW A;  1W5F A;  1XBI A;  3WJR A;  1RLG A;  4BT6 A;  1KC8 H;  3CCU F;  4I50 A;  3J80 M;  4EB6 A;  2CWJ A;  3HKB B;  5EB1 B;  3VCZ A;  4BVS A;  2IAF A;  4X20 B;  3TD5 A;  3U0O A;  3GYQ A;  5J2T B;  3M84 A;  3E1Y A;  4X20 A;  3MCQ A;  1M90 H;  2ZOV A;  2Z1E A;  3C9T A;  4HNA B;  5J2T A;  2ZAU A;  5LXT B;  2HP3 A;  4C4W C;  2UYK A;  2Z1U A;  2HS3 A;  3RYH B;  1KNK A;  1YQN A;  3K0T A;  3VYT C;  4O4H B;  5GON B;  3WJP A;  3RYH A;  3ZOP A;  5EYP B;  1Z5W A;  5KMG B;  1YJW F;  4G4V A;  3F6M A;  5EYP A;  3J81 M;  3JAS A;  4XCQ A;  3CCV F;  3RA5 A;  1W41 A;  2FC3 A;  3V4D A;  3NMU C;  2QI2 A;  2F9Z C;  1VH8 A;  3V7E A;  1FFX B;  5KX5 B;  3HKC B;  3P10 A;  4R40 B;  2Q1Y A;  3D00 A;  4O4I B;  3HWU A;  4RHA A;  1FFX A;  4ZHQ B;  2Z1F A;  4O4I A;  2I6R A;  4X1Y B;  3OW2 F;  2H8C A;  3VIU A;  3N2K B;  3LDT A;  3S0H A;  2LBW A;  4ZHQ A;  5C8Y B;  5JQG B;  3IKF A;  1S72 F;  2HS0 A;  3N2G B;  1JJ2 F;  3SIU A;  3CC7 F;  4ZOL A;  3N2K A;  4RQO A;  4NWO B;  5JQG A;  3N2G A;  1QVG F;  1W5E A;  3G6E F;  1X52 A;  1VQO F;  1W3E X;  3WXM B;  2IG8 A;  5LYJ B;  5BMV A;  2RB9 A;  1YJ9 F;  1JFF B;  3JAL B;  1VQ5 F;  5EIB D;  4I4T B;  2LBT A;  3NVI B;  1FNJ A;  5HWE A;  1XRG A;  3JAL A;  5FNV B;  4EI7 A;  4X1I A;  5EIB C;  5AVM A;  4I4T A;  4BVQ A;  4U39 A;  1R1M A;  1K9M H;  3WGL A;  3K2X A;  5FNV A;  4NUT A;  3CC4 F;  3E22 B;  1FNK A;  5EZY B;  2LBX A;  5HXU A;  3VMF B;  4BY9 D;  5GAN K;  4B46 A;  3E22 A;  2H6L A;  1T0K B;  3ON1 A;  3LYB A;  2AIF A;  4DRX B;  4C8I A;  5J2U A;  2P6Y A;  2R75 1;  2UYN A;  4X1K B;  4DRX A;  1QAH A;  4BVT A;  3MQW A;  2UYP A;  4O2B A;  4YJ3 B;  2HRU A;  2KG4 A;  1QVF F;  3RA6 A;  2YYE A;  1J7H A;  4B45 A;  5CB4 B;  5B8F A;  1YIJ F;  4YJ3 A;  3RYC B;  1T0A A;  1TUB B;  1GX1 A;  3D01 A;  5LA6 A;  1YIT F;  1M1K H;  2PHN A;  5G4V C;  4ZHV A;  1NJI H;  3KE1 A;  3NK7 A;  1TUB A;  1DBF A;  4G4Z A;  3I3F A;  3IKE A;  3JAK B;  3VI6 A;  2Z01 A;  2WAL A;  5G4U C;  1W57 A;  3JAK A;  5IJ0 B;  5CA0 B;  1H7M A;  4G4X A;  1CLI A;  4BT5 A;  1IPA A;  4LNU B;  3HKB A;  2OHW A;  4G4Y A;  2B33 A;  3FFM A;  3L7Q A;  1VHA A;  3TD3 A;  1IV2 A;  3S0W A;  4BT3 A;  4I55 B;  3O85 A;  4LNU A;  3V3T A;  4BT4 A;  1NMU B;  2RHO A;  3ZP7 A;  4TV9 B;  3ZO8 A;  4HNA A;  5LXT A;  2HP0 B;  2W8B C;  1RQ2 A;  3VOB A;  4E6E A;  2HP0 A;  2V9Y A;  4TUY B;  3J7A R;  4X3M A;  3C9R A;  3JVH A;  1SA0 B;  4O4H A;  5GON A;  3I7T A;  3F0D A;  2ZVY A;  3D54 A;  5IT9 M;  3ELC A;  5KMG A;  2RHH A;  1X7O A;  3RYF B;  4IHJ B;  3S02 A;  1IV4 A;  3RYI B;  1YI2 F;  2JNB A;  3WPW A;  3RYF A;  3HKE B;  4IHJ A;  3VO8 A;  5HXZ A;  1KNJ A;  1U3L A;  2L26 A;  3HAX D;  3CCE F; 
#chains in the Genus database with same CATH homology
 1QU9 A;  3I3F A;  1UI9 A;  2UYN B;  5HP7 A;  3LYB A;  2IG8 A;  2CSL A;  3ZOP A;  2CW4 A;  1XHO A;  1QD9 A;  2CHT A;  1X25 A;  2CWJ A;  3VCZ A;  1ONI A;  5HP8 A;  3I7T A;  2UYN A;  2OTM A;  1QAH A;  4ZK7 A;  3MQW A;  2UYP A;  1ODE A;  1FNJ A;  3GTZ A;  1UFY A;  1XRG A;  3LME A;  1J7H A;  2DYY A;  1JD1 A;  1PF5 A;  2B33 A;  2CVL A;  3L7Q A;  3M4S A;  3V4D A;  4NWO B;  1NQ3 A;  3M1X A;  2UYK A;  3K12 A;  3KJJ A;  3R0P A;  3D01 A;  3ZP4 A;  3ZP7 A;  1FNK A;  2UYJ A;  3KJK A;  3ZO8 A;  2EWC A;  3K0T A;  2CHS A;  1DBF A;  3QUW A;  1COM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...