3ZO8A

Wild-type chorismate mutase of bacillus subtilis at 1.6 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
117
structure length
117
Chain Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE AROH
publication title Electrostatic Transition State Stabilization Rather Than Reactant Destabilization Provides the Chemical Basis for Efficient Chorismate Mutase Catalysis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 30
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3zo8A00
2DYYA 2CHSA 3ZP4A 3L7QA 1FNJA 4NWOB 3VCZA 5HP8A 1ODEA 3V4DA 2UYNA 3R0PA 1J7HA 3ZP7A 1COMA 2CVLA 2UYPA 2CHTA 2OTMA 1X25A 3M4SA 1QU9A 1QAHA 3LYBA 3K12A 2B33A 2CSLA 2EWCA 3I7TA 1XHOA 3I3FA 3KJJA 2UYJA 1JD1A 2CWJA 3K0TA 1FNKA 3KJKA 1UFYA 1NQ3A 2CW4A 1UI9A 3ZO8A 1QD9A 1ONIA 1DBFA 2IG8A 3ZOPA 3M1XA 2UYNB 4ZK7A 1XRGA 3LMEA 1PF5A 3D01A 3GTZA 3MQWA 5HP7A 3QUWA 2UYKA
chains in the Genus database with same CATH superfamily
1KC8H 1FFXB 1H7MA 5HWEA 4BVTA 3RYHA 1ODEA 1W55A 2RHOA 4TUYA 5J2UA 5EB0A 1NJIH 1Q7YH 3ZP7A 1OAPA 5LA6A 2HRYA 2K1SA 5CB4B 3GHZA 2DT4A 1YITF 3I7TA 3CCVF 2Z1TA 1FSZA 1W5AA 1TVKA 5GIOC 2YXZA 3S0WA 3CYQA 3CC7F 4U3JA 2OTJF 3ESJA 3C9SA 5LP6A 3CB2A 2UZHA 4X1YB 3QUWA 3U0OA 5HP7A 1VQLF 1SDSA 2AIFA 1W5FA 3WGKA 1VQVA 3N2GB 2Z1EA 2Q1YA 1GO1A 4I50B 4IHJB 3VTIC 1QU9A 4TV9B 5BMVB 1U43A 1VQ6F 3HKEA 2ZOVA 5JQGA 3KJJA 3E20B 3RYIB 3HWUA 4O2BA 3KJKA 3EORA 4I4TA 4O4HB 4BT2A 1QD9A 3DC2A 4PWTA 3KHNA 5FNVB 5ITZA 3FBAA 4WBNB 4G4WA 1T0KB 3F0DA 3V4DA 2BTQB 1W59A 2QTPA 4DXDA 3V7EA 3JAWB 1COMA 5HY4A 1U3PA 5HXUA 2RB9A 2WALA 3CMEF 1QAHA 4ZHYB 1K9MH 4EB6B 5EYPA 2UYJA 5IJ0A 1RLUA 1K73H 2VAPA 3LFOA 1UI9A 3NK6A 4YJ2B 1JFFB 3K14A 3MCQA 5A2QM 3OW2F 3F0GA 4F6RA 1KNKA 3WGMA 5EIBD 3LMEA 4HNAA 4TV8A 5J2TA 2PMPA 2BO1A 4BVRA 4IIJA 4O4JA 3JAKB 1IV3A 5EZYA 5IJ9A 3JALA 2LBTA 3ON1A 2OTMA 4ZHVA 3M4SA 2ZVYA 3P0ZA 1IV1A 3WGLA 2Z1FA 4X20B 2CWJA 3VO8A 3CCSF 3P4EA 3RYCA 4I55B 3VMFB 4X1IB 1DT9A 3IKFA 3JATB 4R40B 5LYJB 2HP0A 3NVKE 2H8CA 2H8EA 1DBFA 3G6EF 2I6RA 2KTUA 5FLXM 1VQ5F 3CC4F 1PF5A 1X52A 1KQSF 2ZF8A 1YIJF 1RA4A 1YGYA 2HQSC 1FNJA 5JVDB 4NWOB 1VQNF 3JAMM 4X3LA 3S0HA 1IPAA 3HJWC 3LWQC 5HY1A 3QHDA 5GAPK 4BT5A 1XV2A 3I3FA 5AVMA 3OBYA 1FNKA 3I56F 4EI8A 1E7KA 1GO0A 1XBIA 2P6YA 3JCMM 3ZO8A 5C8YB 4C82A 2RHJA 3VIUA 3WJQA 1VQ4F 1W57A 3D01A 1YJWF 1S72F 4X1KB 3ERNA 1VQ9F 3LWVC 1Q82H 3WJPA 2RHLA 5IYZA 3WGJA 5JH7A 3G4SF 2R6R1 4X1YA 2EWCA 2F9ZC 4O4LB 3FD5A 4RHAA 3N2GA 4DRXB 4ZHQB 4ZI7B 4BY9D 3JARA 1NQ3A 4I50A 4IHJA 1IV2A 1QVGF 3IEQA 3RA5A 1M1KH 3WPXA 3AGKA 5LOVB 5KMGB 4EI7A 1N8RH 1JN1A 5EB1B 1X7OA 3HKDA 4LCKA 3CG6A 3KE1A 1ZWZA 1CLIA 4ZHWA 4C81A 2KG4A 4YJ3B 3JASA 3K12A 1VQKF 1YHQF 1U40A 2BTOA 3FFMA 3RYHB 4B5CA 4TUYB 5J2UB 5LA6B 3MCAB 1PXWA 3RYFA 3DDNA 4B62A 3HKCA 3VOBA 3CYPB 3CCRF 1W5BA 2CHSA 3NK7A 3TD5A 3UT5A 3SIUA 1RLGA 4YJ2A 1JFFA 5GONA 5HP8A 3VCZA 3CMAF 1R1MA 1SA0B 3QTYA 4NUTA 1VQ7F 1VQOF 4G4XA 1SZQA 4O4IA 2HS3A 4ZOLB 2CSLA 5LP6B 3NVIB 4C8GA 3GYQA 3SIVA 2YYEA 4O2AB 1YJNF 3RE3A 1TUBB 3T80A 4B46A 3HKBB 3ZOPA 3C9TA 5CA1A 2Z01A 3WPWA 4X20A 3K2XA 4TZZA 4X1IA 4BVSA 1W581 4NQ3A 4I4TB 3FD6A 1J7HA 3F6MA 4RQOA 3LYBA 1XHOA 5DCVA 5JVDA 3JVHA 2LCAA 2HS0A 4FFBA 1W42A 2CW4A 3CXCF 2QI2A 5G4VC 2VGNA 1IV4A 1W2BF 3LWPC 4C8IA 3VI6A 2FGYA 3O85A 3HTNA 4BT4A 2NMUA 3E22B 5IJ0B 4M8IA 4LNUA 2KGWA 1YI2F 1VQMF 4ERHA 3CPQA 3IKEA 3WXMB 2QA4F 5MN6A 5JCOC 4TV8B 5CA0A 3VYTC 1FFXA 3KIZA 2RHHA 2VXYA 4IIJB 3VOAA 1JY8A 1U3LA 3N2KB 1Z5WA 3E1YA 3PLAC 5IJ9B 3JALB 3B6NA 4G88A 4BVQA 3S0YA 2ZVZA 2HX0A 2LBWA 5CB4A 5KX5B 3GTZA 4O4LA 3CD6F 5FJ4C 5LP6C 2W8BC 4ZHQA 4DRXA 4ZI7A 5MN5A 2AIZP 1KD1H 3OBWA 2Q1XA 4E6EA 1RQ7A 2HP0B 3J81M 2FC3A 2GZLA 3OONA 5EIBC 5EWRA 5LOVA 3CCQF 2HRUA 3CCLF 2ZAUA 5EO3A 2R751 1QVFF 3CPWF 3TD3A 3RA6A 3WGNA 4YJ3A 2UYNB 4TV9A 1X7PA 2OTLF 5BMVA 1VHAA 1H48A 3R0PA 2QEXF 1YQNA 3FPIA 3RYIA 1NMUB 2MQEA 3D00A 3J7AR 4O4HA 1Q86H 3MDOA 3CCMF 2CVLA 2UYPA 5FNVA 2CHTA 1GZ0A 3C9UA 5JCOA 5GINC 2VGMA 5LXTB 4WBNA 3C8LA 1K8AH 3NMUC 2V9YA 3G71F 3K0TA 1SA0A 2HS4A 1M90H 2HVYD 3JAWA 5IYZB 5JH7B 4XCQA 2LBXA 1CN7A 3M1XA 4ZOLA 2GLZA 3C9RA 4G4ZA 3N4ZA 4EB6A 4O2AA 3L7QA 1JJ2F 1TUBA 1TVKB 3HKBA 3S02A 3CCEF 3JARB 3TD4A 5GIPC 1VQPF 3CCUF 5G4UC 3BYQA 4U3JB 2OZBA 4C4WC 2Z1UA 3VYUC 3JAKA 4C8EA 3PAFA 3HKDB 5IT9M 1XRGA 2IAFA 3LWOC 3JASB 4G4YA 4BW0B 5B8FA 3ZP4A 3HKEB 5JQGB 4I55A 1VK3A 3N4YA 1T0AA 3Q8HA 1YJ9F 2ZODA 3JATA 4O2BB 5LYJA 1KNJA 4BT7A 3I55F 1W5EA 3RYFB 2B33A 5ITZB 2L26A 3E22A 3HKCB 4KWEA 1Q81H 3UT5B 3ELCA 1JD1A 3CCJF 3IR9A 5GONB 3M84A 1H47A 3S03A 1Q8RA 2GVIA 4O4IB 2KTVA 3V3TA 2DYYA 4X3MA 3N2KA 5EYPB 2HP3A 5GANK 3VYSC 5EAZA 4BT6A 1Z5VA 5C8YA 5KX5A 1GX1A 2PHNA 5CA1B 4F6RB 4X1KA 4HNAB 5J2TB 2JNBA 4O4JB 1W41A 3MBMA 3V7QA 2VAWA 2BTUA 1ONIA 5EZYB 2IG8A 3LWRC 3LDTA 3MQWA 2AMTA 2UYKA 2CZWA 3WJRA 1CK2A 5MN4A 3S06A 4FFBB 1RQ2A 2I6DA 4BT3A 2H6LA 3F0FA 3RYCB 3J80M 2IQQA 2UYNA 3P10A 1OFUA 1VQ8F 4G4VA 1X25A 2OHWA 4U39A 5KMGA 1VH8A 2N48A 4EI9A 3D54A 2VAMA 2ALEA 4LNUB 1UFYA 3HAXD 4B45A 5HXZA 3CC2F 1W3EX 3F0EA 4ZK7A 5HY0A 5LXTA 2G9IA 5HY2A 3IEWA 3IMPA 1W40A 5CA0B
chains in the Genus database with same CATH topology
2DYYA 2CHSA 3ZP4A 3L7QA 1FNJA 4NWOB 3VCZA 5HP8A 1ODEA 3V4DA 2UYNA 3R0PA 1J7HA 3ZP7A 1COMA 2CVLA 2UYPA 2CHTA 2OTMA 1X25A 3M4SA 1QU9A 1QAHA 3LYBA 3K12A 2B33A 2CSLA 2EWCA 3I7TA 1XHOA 3I3FA 3KJJA 2UYJA 1JD1A 2CWJA 3K0TA 1FNKA 3KJKA 1UFYA 1NQ3A 2CW4A 1UI9A 3ZO8A 1QD9A 1ONIA 1DBFA 2IG8A 3ZOPA 3M1XA 2UYNB 4ZK7A 1XRGA 3LMEA 1PF5A 3D01A 3GTZA 3MQWA 5HP7A 3QUWA 2UYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYY A;  2CHS A;  3ZP4 A;  3L7Q A;  1FNJ A;  4NWO B;  3VCZ A;  5HP8 A;  1ODE A;  3V4D A;  2UYN A;  3R0P A;  1J7H A;  3ZP7 A;  1COM A;  2CVL A;  2UYP A;  2CHT A;  2OTM A;  1X25 A;  3M4S A;  1QU9 A;  1QAH A;  3LYB A;  3K12 A;  2B33 A;  2CSL A;  2EWC A;  3I7T A;  1XHO A;  3I3F A;  3KJJ A;  2UYJ A;  1JD1 A;  2CWJ A;  3K0T A;  1FNK A;  3KJK A;  1UFY A;  1NQ3 A;  2CW4 A;  1UI9 A;  3ZO8 A;  1QD9 A;  1ONI A;  1DBF A;  2IG8 A;  3ZOP A;  3M1X A;  2UYN B;  4ZK7 A;  1XRG A;  3LME A;  1PF5 A;  3D01 A;  3GTZ A;  3MQW A;  5HP7 A;  3QUW A;  2UYK A; 
#chains in the Genus database with same CATH topology
 1KC8 H;  1FFX B;  1H7M A;  5HWE A;  4BVT A;  3RYH A;  1ODE A;  1W55 A;  2RHO A;  4TUY A;  5J2U A;  5EB0 A;  1NJI H;  1Q7Y H;  3ZP7 A;  1OAP A;  5LA6 A;  2HRY A;  2K1S A;  5CB4 B;  3GHZ A;  2DT4 A;  1YIT F;  3I7T A;  3CCV F;  2Z1T A;  1FSZ A;  1W5A A;  1TVK A;  5GIO C;  2YXZ A;  3S0W A;  3CYQ A;  3CC7 F;  4U3J A;  2OTJ F;  3ESJ A;  3C9S A;  5LP6 A;  3CB2 A;  2UZH A;  4X1Y B;  3QUW A;  3U0O A;  5HP7 A;  1VQL F;  1SDS A;  2AIF A;  1W5F A;  3WGK A;  1VQV A;  3N2G B;  2Z1E A;  2Q1Y A;  1GO1 A;  4I50 B;  4IHJ B;  3VTI C;  1QU9 A;  4TV9 B;  5BMV B;  1U43 A;  1VQ6 F;  3HKE A;  2ZOV A;  5JQG A;  3KJJ A;  3E20 B;  3RYI B;  3HWU A;  4O2B A;  3KJK A;  3EOR A;  4I4T A;  4O4H B;  4BT2 A;  1QD9 A;  3DC2 A;  4PWT A;  3KHN A;  5FNV B;  5ITZ A;  3FBA A;  4WBN B;  4G4W A;  1T0K B;  3F0D A;  3V4D A;  2BTQ B;  1W59 A;  2QTP A;  4DXD A;  3V7E A;  3JAW B;  1COM A;  5HY4 A;  1U3P A;  5HXU A;  2RB9 A;  2WAL A;  3CME F;  1QAH A;  4ZHY B;  1K9M H;  4EB6 B;  5EYP A;  2UYJ A;  5IJ0 A;  1RLU A;  1K73 H;  2VAP A;  3LFO A;  1UI9 A;  3NK6 A;  4YJ2 B;  1JFF B;  3K14 A;  3MCQ A;  5A2Q M;  3OW2 F;  3F0G A;  4F6R A;  1KNK A;  3WGM A;  5EIB D;  3LME A;  4HNA A;  4TV8 A;  5J2T A;  2PMP A;  2BO1 A;  4BVR A;  4IIJ A;  4O4J A;  3JAK B;  1IV3 A;  5EZY A;  5IJ9 A;  3JAL A;  2LBT A;  3ON1 A;  2OTM A;  4ZHV A;  3M4S A;  2ZVY A;  3P0Z A;  1IV1 A;  3WGL A;  2Z1F A;  4X20 B;  2CWJ A;  3VO8 A;  3CCS F;  3P4E A;  3RYC A;  4I55 B;  3VMF B;  4X1I B;  1DT9 A;  3IKF A;  3JAT B;  4R40 B;  5LYJ B;  2HP0 A;  3NVK E;  2H8C A;  2H8E A;  1DBF A;  3G6E F;  2I6R A;  2KTU A;  5FLX M;  1VQ5 F;  3CC4 F;  1PF5 A;  1X52 A;  1KQS F;  2ZF8 A;  1YIJ F;  1RA4 A;  1YGY A;  2HQS C;  1FNJ A;  5JVD B;  4NWO B;  1VQN F;  3JAM M;  4X3L A;  3S0H A;  1IPA A;  3HJW C;  3LWQ C;  5HY1 A;  3QHD A;  5GAP K;  4BT5 A;  1XV2 A;  3I3F A;  5AVM A;  3OBY A;  1FNK A;  3I56 F;  4EI8 A;  1E7K A;  1GO0 A;  1XBI A;  2P6Y A;  3JCM M;  3ZO8 A;  5C8Y B;  4C82 A;  2RHJ A;  3VIU A;  3WJQ A;  1VQ4 F;  1W57 A;  3D01 A;  1YJW F;  1S72 F;  4X1K B;  3ERN A;  1VQ9 F;  3LWV C;  1Q82 H;  3WJP A;  2RHL A;  5IYZ A;  3WGJ A;  5JH7 A;  3G4S F;  2R6R 1;  4X1Y A;  2EWC A;  2F9Z C;  4O4L B;  3FD5 A;  4RHA A;  3N2G A;  4DRX B;  4ZHQ B;  4ZI7 B;  4BY9 D;  3JAR A;  1NQ3 A;  4I50 A;  4IHJ A;  1IV2 A;  1QVG F;  3IEQ A;  3RA5 A;  1M1K H;  3WPX A;  3AGK A;  5LOV B;  5KMG B;  4EI7 A;  1N8R H;  1JN1 A;  5EB1 B;  1X7O A;  3HKD A;  4LCK A;  3CG6 A;  3KE1 A;  1ZWZ A;  1CLI A;  4ZHW A;  4C81 A;  2KG4 A;  4YJ3 B;  3JAS A;  3K12 A;  1VQK F;  1YHQ F;  1U40 A;  2BTO A;  3FFM A;  3RYH B;  4B5C A;  4TUY B;  5J2U B;  5LA6 B;  3MCA B;  1PXW A;  3RYF A;  3DDN A;  4B62 A;  3HKC A;  3VOB A;  3CYP B;  3CCR F;  1W5B A;  2CHS A;  3NK7 A;  3TD5 A;  3UT5 A;  3SIU A;  1RLG A;  4YJ2 A;  1JFF A;  5GON A;  5HP8 A;  3VCZ A;  3CMA F;  1R1M A;  1SA0 B;  3QTY A;  4NUT A;  1VQ7 F;  1VQO F;  4G4X A;  1SZQ A;  4O4I A;  2HS3 A;  4ZOL B;  2CSL A;  5LP6 B;  3NVI B;  4C8G A;  3GYQ A;  3SIV A;  2YYE A;  4O2A B;  1YJN F;  3RE3 A;  1TUB B;  3T80 A;  4B46 A;  3HKB B;  3ZOP A;  3C9T A;  5CA1 A;  2Z01 A;  3WPW A;  4X20 A;  3K2X A;  4TZZ A;  4X1I A;  4BVS A;  1W58 1;  4NQ3 A;  4I4T B;  3FD6 A;  1J7H A;  3F6M A;  4RQO A;  3LYB A;  1XHO A;  5DCV A;  5JVD A;  3JVH A;  2LCA A;  2HS0 A;  4FFB A;  1W42 A;  2CW4 A;  3CXC F;  2QI2 A;  5G4V C;  2VGN A;  1IV4 A;  1W2B F;  3LWP C;  4C8I A;  3VI6 A;  2FGY A;  3O85 A;  3HTN A;  4BT4 A;  2NMU A;  3E22 B;  5IJ0 B;  4M8I A;  4LNU A;  2KGW A;  1YI2 F;  1VQM F;  4ERH A;  3CPQ A;  3IKE A;  3WXM B;  2QA4 F;  5MN6 A;  5JCO C;  4TV8 B;  5CA0 A;  3VYT C;  1FFX A;  3KIZ A;  2RHH A;  2VXY A;  4IIJ B;  3VOA A;  1JY8 A;  1U3L A;  3N2K B;  1Z5W A;  3E1Y A;  3PLA C;  5IJ9 B;  3JAL B;  3B6N A;  4G88 A;  4BVQ A;  3S0Y A;  2ZVZ A;  2HX0 A;  2LBW A;  5CB4 A;  5KX5 B;  3GTZ A;  4O4L A;  3CD6 F;  5FJ4 C;  5LP6 C;  2W8B C;  4ZHQ A;  4DRX A;  4ZI7 A;  5MN5 A;  2AIZ P;  1KD1 H;  3OBW A;  2Q1X A;  4E6E A;  1RQ7 A;  2HP0 B;  3J81 M;  2FC3 A;  2GZL A;  3OON A;  5EIB C;  5EWR A;  5LOV A;  3CCQ F;  2HRU A;  3CCL F;  2ZAU A;  5EO3 A;  2R75 1;  1QVF F;  3CPW F;  3TD3 A;  3RA6 A;  3WGN A;  4YJ3 A;  2UYN B;  4TV9 A;  1X7P A;  2OTL F;  5BMV A;  1VHA A;  1H48 A;  3R0P A;  2QEX F;  1YQN A;  3FPI A;  3RYI A;  1NMU B;  2MQE A;  3D00 A;  3J7A R;  4O4H A;  1Q86 H;  3MDO A;  3CCM F;  2CVL A;  2UYP A;  5FNV A;  2CHT A;  1GZ0 A;  3C9U A;  5JCO A;  5GIN C;  2VGM A;  5LXT B;  4WBN A;  3C8L A;  1K8A H;  3NMU C;  2V9Y A;  3G71 F;  3K0T A;  1SA0 A;  2HS4 A;  1M90 H;  2HVY D;  3JAW A;  5IYZ B;  5JH7 B;  4XCQ A;  2LBX A;  1CN7 A;  3M1X A;  4ZOL A;  2GLZ A;  3C9R A;  4G4Z A;  3N4Z A;  4EB6 A;  4O2A A;  3L7Q A;  1JJ2 F;  1TUB A;  1TVK B;  3HKB A;  3S02 A;  3CCE F;  3JAR B;  3TD4 A;  5GIP C;  1VQP F;  3CCU F;  5G4U C;  3BYQ A;  4U3J B;  2OZB A;  4C4W C;  2Z1U A;  3VYU C;  3JAK A;  4C8E A;  3PAF A;  3HKD B;  5IT9 M;  1XRG A;  2IAF A;  3LWO C;  3JAS B;  4G4Y A;  4BW0 B;  5B8F A;  3ZP4 A;  3HKE B;  5JQG B;  4I55 A;  1VK3 A;  3N4Y A;  1T0A A;  3Q8H A;  1YJ9 F;  2ZOD A;  3JAT A;  4O2B B;  5LYJ A;  1KNJ A;  4BT7 A;  3I55 F;  1W5E A;  3RYF B;  2B33 A;  5ITZ B;  2L26 A;  3E22 A;  3HKC B;  4KWE A;  1Q81 H;  3UT5 B;  3ELC A;  1JD1 A;  3CCJ F;  3IR9 A;  5GON B;  3M84 A;  1H47 A;  3S03 A;  1Q8R A;  2GVI A;  4O4I B;  2KTV A;  3V3T A;  2DYY A;  4X3M A;  3N2K A;  5EYP B;  2HP3 A;  5GAN K;  3VYS C;  5EAZ A;  4BT6 A;  1Z5V A;  5C8Y A;  5KX5 A;  1GX1 A;  2PHN A;  5CA1 B;  4F6R B;  4X1K A;  4HNA B;  5J2T B;  2JNB A;  4O4J B;  1W41 A;  3MBM A;  3V7Q A;  2VAW A;  2BTU A;  1ONI A;  5EZY B;  2IG8 A;  3LWR C;  3LDT A;  3MQW A;  2AMT A;  2UYK A;  2CZW A;  3WJR A;  1CK2 A;  5MN4 A;  3S06 A;  4FFB B;  1RQ2 A;  2I6D A;  4BT3 A;  2H6L A;  3F0F A;  3RYC B;  3J80 M;  2IQQ A;  2UYN A;  3P10 A;  1OFU A;  1VQ8 F;  4G4V A;  1X25 A;  2OHW A;  4U39 A;  5KMG A;  1VH8 A;  2N48 A;  4EI9 A;  3D54 A;  2VAM A;  2ALE A;  4LNU B;  1UFY A;  3HAX D;  4B45 A;  5HXZ A;  3CC2 F;  1W3E X;  3F0E A;  4ZK7 A;  5HY0 A;  5LXT A;  2G9I A;  5HY2 A;  3IEW A;  3IMP A;  1W40 A;  5CA0 B; 
#chains in the Genus database with same CATH homology
 2DYY A;  2CHS A;  3ZP4 A;  3L7Q A;  1FNJ A;  4NWO B;  3VCZ A;  5HP8 A;  1ODE A;  3V4D A;  2UYN A;  3R0P A;  1J7H A;  3ZP7 A;  1COM A;  2CVL A;  2UYP A;  2CHT A;  2OTM A;  1X25 A;  3M4S A;  1QU9 A;  1QAH A;  3LYB A;  3K12 A;  2B33 A;  2CSL A;  2EWC A;  3I7T A;  1XHO A;  3I3F A;  3KJJ A;  2UYJ A;  1JD1 A;  2CWJ A;  3K0T A;  1FNK A;  3KJK A;  1UFY A;  1NQ3 A;  2CW4 A;  1UI9 A;  3ZO8 A;  1QD9 A;  1ONI A;  1DBF A;  2IG8 A;  3ZOP A;  3M1X A;  2UYN B;  4ZK7 A;  1XRG A;  3LME A;  1PF5 A;  3D01 A;  3GTZ A;  3MQW A;  5HP7 A;  3QUW A;  2UYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...