1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chorismate mutase
molecule keywords CHORISMATE MUTASE
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
2CHSA 2OTMA 1COMA 1QU9A 3VCZA 3ZP7A 3ZOPA 2CHTA 2UYPA 3QUWA 2CSLA 1JD1A 3M4SA 3ZO8A 1UFYA 3K12A 5HP8A 3V4DA 2CWJA 2EWCA 2UYNA 4NWOB 1QD9A 3D01A 1UI9A 3KJKA 4ZK7A 1FNKA 3I3FA 1PF5A 3R0PA 3L7QA 3I7TA 2CW4A 2UYJA 2CVLA 3K0TA 3ZP4A 1ONIA 3M1XA 1X25A 1J7HA 2UYNB 1NQ3A 1DBFA 5HP7A 1FNJA 1ODEA 3GTZA 2B33A 2DYYA 3LMEA 1QAHA 2IG8A 2UYKA 1XHOA 3LYBA 1XRGA 3MQWA 3KJJA
chains in the Genus database with same CATH superfamily
3MCQA 3LWVC 2OTMA 5CA1A 5HY0A 1GZ0A 2HP3A 1FFXB 4NUTA 4FFBA 4RQOA 3HAXD 5MN5A 5BMVA 3C9SA 5LA6B 5LOVA 2EWCA 4TV8A 3CXCF 4WBNA 2VGMA 3WGKA 3M1XA 2OZBA 3N4ZA 5HY4A 4HNAB 3GTZA 3JASA 1Q82H 4B62A 2LBTA 5G4UC 3NK6A 2IAFA 5G4VC 1RQ7A 4ZHQA 1IV4A 1K9MH 2R751 3V4DA 3HKCB 3E1YA 4G4ZA 3WPXA 4BT2A 5HXZA 2Z1UA 5IYZB 2GVIA 3D54A 3L7QA 3N2KB 3IKFA 3TD4A 3RYCB 3CPWF 1NJIH 5J2UB 3FBAA 4O2BB 2FGYA 1VQ7F 3FPIA 1VQ8F 2AMTA 2RHJA 5CA0B 4O4IA 2UYKA 5JCOC 2ZF8A 3ZP7A 2HP0B 1W581 4DXDA 2RHLA 4I4TB 4X3MA 5JVDA 3P10A 5GONB 4G4VA 2NMUA 5KMGA 1K8AH 4O4JB 5JQGB 3JAWB 2BO1A 3ELCA 3CCJF 4X1IA 3CYPB 1RQ2A 3TD3A 1W5AA 2P6YA 1VQ4F 3MDOA 4BVRA 1GO0A 3ON1A 3C8LA 3GYQA 3CCSF 4O2AA 1Z5VA 2V9YA 3IKEA 1QAHA 3PAFA 5ITZB 5EIBC 1M1KH 5HP7A 1IPAA 4YJ3B 3N2GA 4O4LB 1VQNF 1W2BF 2RB9A 2VAMA 4LNUB 4BVQA 4X1IB 4U39A 2YXZA 1YQNA 1H7MA 3JARA 4ZI7A 2QEXF 3JATA 3NVIB 4BT5A 4NWOB 1X7PA 3V7QA 3KJKA 3CCVF 1T0KB 4BT7A 2CW4A 2UYJA 1W5FA 3S0WA 3RYFB 4EI9A 2DT4A 3K0TA 3VI6A 3WJQA 5C8YA 5CB4B 3WJRA 1NQ3A 4BT4A 4F6RB 4EI7A 5GONA 3J80M 3HWUA 4C4WC 3ESJA 1VQVA 2HP0A 3G4SF 3IR9A 5EO3A 3LDTA 3RYHA 1QU9A 3VCZA 5GANK 3CCRF 1VH8A 1KQSF 1W59A 3JVHA 1IV2A 3WGNA 4ZHQB 3IMPA 4EB6A 1QVFF 3CPQA 1VQMF 5EAZA 3Q8HA 5J2UA 3LWPC 1NMUB 4B45A 4TV9B 4C8EA 4ZK7A 1YJWF 1W5BA 4X3LA 4G4XA 5J2TA 5HY1A 5LYJB 1VQ5F 1DT9A 2VGNA 2WALA 2PMPA 1DBFA 1U43A 3VYUC 3JARB 4ZI7B 4M8IA 4IHJA 1VQKF 3P4EA 1SDSA 3V3TA 3WGLA 2ZVZA 3FFMA 4I50B 3VMFB 3CC2F 1X7OA 5HWEA 4G88A 4DRXA 1SA0B 4KWEA 1JD1A 1T0AA 2BTUA 2JNBA 3LWOC 3UT5A 2G9IA 4HNAA 3WJPA 4ZHWA 4E6EA 1XV2A 2OTLF 2CZWA 1TVKB 3CCMF 3R0PA 4O4IB 4RHAA 1RLGA 4BT3A 5JQGA 3CCQF 2ZOVA 2K1SA 2Z1FA 3ERNA 5BMVB 1ODEA 1W42A 3VOAA 4C81A 4TUYA 3LMEA 3KJJA 2UYPA 2RHOA 3F0EA 3CD6F 2KTVA 3DC2A 1Q7YH 1JFFA 2GZLA 4I55B 3RYIA 1OFUA 3F0DA 3OBYA 4G4YA 4ZHVA 3RYCA 5HXUA 5IJ9B 1JJ2F 3JATB 4IIJB 4ZHYB 5FLXM 1VQOF 5LP6C 2BTOA 3B6NA 4X1KA 5AVMA 3JAKA 2PHNA 4BW0B 3PLAC 1KNJA 4O4LA 5IJ9A 2HS3A 1XHOA 1IV1A 3S0YA 3NK7A 1U3LA 5LA6A 3QUWA 5FJ4C 3J7AR 2IQQA 3JAKB 3K14A 5FNVA 4R40B 3K2XA 3CC7F 3JCMM 3HKDB 4TV8B 5LOVB 3T80A 3LFOA 2Q1YA 3VO8A 3V7EA 1XRGA 3MQWA 3CC4F 4BVTA 2QTPA 1CLIA 5HP8A 4XCQA 1M90H 2UYNA 1TUBB 2N48A 3SIVA 4X20A 5DCVA 3OONA 3JAMM 4U3JA 3OBWA 3CYQA 2KTUA 3D00A 4EI8A 2H6LA 5EYPB 5KX5A 4B46A 1FNJA 3WGMA 1VQPF 5LXTA 3S03A 1YITF 2Q1XA 3VTIC 3J81M 1Q81H 4O4HA 5IJ0A 3E22A 3HKEB 2I6DA 1H48A 3KHNA 2OTJF 4IIJA 3MBMA 1PXWA 1W57A 3QHDA 4I4TA 1GX1A 5J2TB 1JN1A 1W40A 3RYHB 3CCUF 4TV9A 2VXYA 5GIPC 1ONIA 5JH7A 1U40A 4EB6B 5CA0A 3F0GA 1VQ6F 3NVKE 2R6R1 2I6RA 1SZQA 3M84A 3HKBA 3VIUA 3CG6A 4NQ3A 1Q86H 4B5CA 3S06A 1VQ9F 1YJNF 3FD5A 1N8RH 1R1MA 1UFYA 1SA0A 3HKDA 2HQSC 4LNUA 5JCOA 2HS0A 1VHAA 2Z1EA 5A2QM 3KIZA 5EZYA 3GHZA 4X1YA 4IHJB 2QA4F 2CVLA 2FC3A 3N2GB 4O2AB 5HY2A 3G6EF 2HRYA 5EB1B 5LXTB 2BTQB 4BT6A 1VQLF 1FSZA 3UT5B 1CK2A 5EYPA 3CCLF 2Z01A 2ALEA 3C9RA 4BY9D 2CHSA 3VYTC 5KMGB 4YJ3A 3ZOPA 3O85A 3IEQA 2CSLA 3JAWA 4X1KB 5IT9M 2LCAA 3HJWC 3K12A 4C8IA 3S02A 2AIZP 3E20B 3MCAB 5JVDB 4BVSA 1UI9A 1RLUA 5LYJA 1H47A 2ZODA 1JFFB 2HX0A 4I55A 3CCEF 5CA1B 2VAWA 3AGKA 3WPWA 1J7HA 1Z5WA 3HKBB 1X25A 3U0OA 3CMEF 1Q8RA 4YJ2A 3I7TA 3LYBA 1YJ9F 3JALA 3CB2A 5IYZA 3C9UA 1KC8H 2YYEA 4F6RA 2CHTA 2HS4A 2QI2A 1GO1A 5C8YB 5B8FA 1YIJF 5MN4A 1QD9A 1JY8A 4ERHA 5IJ0B 3FD6A 1PF5A 2L26A 3HTNA 2GLZA 4O4HB 3DDNA 4G4WA 5KX5B 5EB0A 3BYQA 2W8BC 2HRUA 4ZOLA 2B33A 4I50A 2IG8A 5LP6B 5LP6A 3HKEA 4U3JB 2RHHA 4WBNB 5EWRA 2VAPA 1KD1H 2AIFA 3S0HA 3JASB 3M4SA 3RYIB 3VYSC 1IV3A 3F0FA 4X1YB 3RA6A 2ZAUA 5EIBD 4FFBB 5EZYB 3I3FA 4O4JA 1VK3A 5MN6A 2F9ZC 3WGJA 1S72F 4O2BA 2UYNB 5JH7B 4TZZA 4TUYB 3RA5A 1YI2F 2DYYA 3JALB 3I56F 1W3EX 4C8GA 3VOBA 2HVYD 1COMA 4PWTA 2KG4A 1K73H 5CB4A 3SIUA 3ZO8A 1OAPA 1CN7A 2CWJA 5GINC 3P0ZA 3E22B 3D01A 3IEWA 4DRXB 1YGYA 3N2KA 1E7KA 1XBIA 3HKCA 3G71F 3KE1A 2Z1TA 5FNVB 2ZVYA 3ZP4A 4ZOLB 1U3PA 2LBWA 3TD5A 5GAPK 3F6MA 5ITZA 1TUBA 1YHQF 5GIOC 4C82A 1W41A 1W55A 2MQEA 2LBXA 1FNKA 3OW2F 3CMAF 1X52A 3I55F 2H8EA 2OHWA 3LWRC 1ZWZA 4X20B 3QTYA 2UZHA 1RA4A 3C9TA 4YJ2B 1FFXA 2H8CA 1KNKA 1W5EA 3RE3A 3LWQC 3WXMB 1QVGF 3EORA 4LCKA 2KGWA 1TVKA 3RYFA 3N4YA 3NMUC
chains in the Genus database with same CATH topology
2CHSA 2OTMA 1COMA 1QU9A 3VCZA 3ZP7A 3ZOPA 2CHTA 2UYPA 3QUWA 2CSLA 1JD1A 3M4SA 3ZO8A 1UFYA 3K12A 5HP8A 3V4DA 2CWJA 2EWCA 2UYNA 4NWOB 1QD9A 3D01A 1UI9A 3KJKA 4ZK7A 1FNKA 3I3FA 1PF5A 3R0PA 3L7QA 3I7TA 2CW4A 2UYJA 2CVLA 3K0TA 3ZP4A 1ONIA 3M1XA 1X25A 1J7HA 2UYNB 1NQ3A 1DBFA 5HP7A 1FNJA 1ODEA 3GTZA 2B33A 2DYYA 3LMEA 1QAHA 2IG8A 2UYKA 1XHOA 3LYBA 1XRGA 3MQWA 3KJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHS A;  2OTM A;  1COM A;  1QU9 A;  3VCZ A;  3ZP7 A;  3ZOP A;  2CHT A;  2UYP A;  3QUW A;  2CSL A;  1JD1 A;  3M4S A;  3ZO8 A;  1UFY A;  3K12 A;  5HP8 A;  3V4D A;  2CWJ A;  2EWC A;  2UYN A;  4NWO B;  1QD9 A;  3D01 A;  1UI9 A;  3KJK A;  4ZK7 A;  1FNK A;  3I3F A;  1PF5 A;  3R0P A;  3L7Q A;  3I7T A;  2CW4 A;  2UYJ A;  2CVL A;  3K0T A;  3ZP4 A;  1ONI A;  3M1X A;  1X25 A;  1J7H A;  2UYN B;  1NQ3 A;  1DBF A;  5HP7 A;  1FNJ A;  1ODE A;  3GTZ A;  2B33 A;  2DYY A;  3LME A;  1QAH A;  2IG8 A;  2UYK A;  1XHO A;  3LYB A;  1XRG A;  3MQW A;  3KJJ A; 
#chains in the Genus database with same CATH topology
 3MCQ A;  3LWV C;  2OTM A;  5CA1 A;  5HY0 A;  1GZ0 A;  2HP3 A;  1FFX B;  4NUT A;  4FFB A;  4RQO A;  3HAX D;  5MN5 A;  5BMV A;  3C9S A;  5LA6 B;  5LOV A;  2EWC A;  4TV8 A;  3CXC F;  4WBN A;  2VGM A;  3WGK A;  3M1X A;  2OZB A;  3N4Z A;  5HY4 A;  4HNA B;  3GTZ A;  3JAS A;  1Q82 H;  4B62 A;  2LBT A;  5G4U C;  3NK6 A;  2IAF A;  5G4V C;  1RQ7 A;  4ZHQ A;  1IV4 A;  1K9M H;  2R75 1;  3V4D A;  3HKC B;  3E1Y A;  4G4Z A;  3WPX A;  4BT2 A;  5HXZ A;  2Z1U A;  5IYZ B;  2GVI A;  3D54 A;  3L7Q A;  3N2K B;  3IKF A;  3TD4 A;  3RYC B;  3CPW F;  1NJI H;  5J2U B;  3FBA A;  4O2B B;  2FGY A;  1VQ7 F;  3FPI A;  1VQ8 F;  2AMT A;  2RHJ A;  5CA0 B;  4O4I A;  2UYK A;  5JCO C;  2ZF8 A;  3ZP7 A;  2HP0 B;  1W58 1;  4DXD A;  2RHL A;  4I4T B;  4X3M A;  5JVD A;  3P10 A;  5GON B;  4G4V A;  2NMU A;  5KMG A;  1K8A H;  4O4J B;  5JQG B;  3JAW B;  2BO1 A;  3ELC A;  3CCJ F;  4X1I A;  3CYP B;  1RQ2 A;  3TD3 A;  1W5A A;  2P6Y A;  1VQ4 F;  3MDO A;  4BVR A;  1GO0 A;  3ON1 A;  3C8L A;  3GYQ A;  3CCS F;  4O2A A;  1Z5V A;  2V9Y A;  3IKE A;  1QAH A;  3PAF A;  5ITZ B;  5EIB C;  1M1K H;  5HP7 A;  1IPA A;  4YJ3 B;  3N2G A;  4O4L B;  1VQN F;  1W2B F;  2RB9 A;  2VAM A;  4LNU B;  4BVQ A;  4X1I B;  4U39 A;  2YXZ A;  1YQN A;  1H7M A;  3JAR A;  4ZI7 A;  2QEX F;  3JAT A;  3NVI B;  4BT5 A;  4NWO B;  1X7P A;  3V7Q A;  3KJK A;  3CCV F;  1T0K B;  4BT7 A;  2CW4 A;  2UYJ A;  1W5F A;  3S0W A;  3RYF B;  4EI9 A;  2DT4 A;  3K0T A;  3VI6 A;  3WJQ A;  5C8Y A;  5CB4 B;  3WJR A;  1NQ3 A;  4BT4 A;  4F6R B;  4EI7 A;  5GON A;  3J80 M;  3HWU A;  4C4W C;  3ESJ A;  1VQV A;  2HP0 A;  3G4S F;  3IR9 A;  5EO3 A;  3LDT A;  3RYH A;  1QU9 A;  3VCZ A;  5GAN K;  3CCR F;  1VH8 A;  1KQS F;  1W59 A;  3JVH A;  1IV2 A;  3WGN A;  4ZHQ B;  3IMP A;  4EB6 A;  1QVF F;  3CPQ A;  1VQM F;  5EAZ A;  3Q8H A;  5J2U A;  3LWP C;  1NMU B;  4B45 A;  4TV9 B;  4C8E A;  4ZK7 A;  1YJW F;  1W5B A;  4X3L A;  4G4X A;  5J2T A;  5HY1 A;  5LYJ B;  1VQ5 F;  1DT9 A;  2VGN A;  2WAL A;  2PMP A;  1DBF A;  1U43 A;  3VYU C;  3JAR B;  4ZI7 B;  4M8I A;  4IHJ A;  1VQK F;  3P4E A;  1SDS A;  3V3T A;  3WGL A;  2ZVZ A;  3FFM A;  4I50 B;  3VMF B;  3CC2 F;  1X7O A;  5HWE A;  4G88 A;  4DRX A;  1SA0 B;  4KWE A;  1JD1 A;  1T0A A;  2BTU A;  2JNB A;  3LWO C;  3UT5 A;  2G9I A;  4HNA A;  3WJP A;  4ZHW A;  4E6E A;  1XV2 A;  2OTL F;  2CZW A;  1TVK B;  3CCM F;  3R0P A;  4O4I B;  4RHA A;  1RLG A;  4BT3 A;  5JQG A;  3CCQ F;  2ZOV A;  2K1S A;  2Z1F A;  3ERN A;  5BMV B;  1ODE A;  1W42 A;  3VOA A;  4C81 A;  4TUY A;  3LME A;  3KJJ A;  2UYP A;  2RHO A;  3F0E A;  3CD6 F;  2KTV A;  3DC2 A;  1Q7Y H;  1JFF A;  2GZL A;  4I55 B;  3RYI A;  1OFU A;  3F0D A;  3OBY A;  4G4Y A;  4ZHV A;  3RYC A;  5HXU A;  5IJ9 B;  1JJ2 F;  3JAT B;  4IIJ B;  4ZHY B;  5FLX M;  1VQO F;  5LP6 C;  2BTO A;  3B6N A;  4X1K A;  5AVM A;  3JAK A;  2PHN A;  4BW0 B;  3PLA C;  1KNJ A;  4O4L A;  5IJ9 A;  2HS3 A;  1XHO A;  1IV1 A;  3S0Y A;  3NK7 A;  1U3L A;  5LA6 A;  3QUW A;  5FJ4 C;  3J7A R;  2IQQ A;  3JAK B;  3K14 A;  5FNV A;  4R40 B;  3K2X A;  3CC7 F;  3JCM M;  3HKD B;  4TV8 B;  5LOV B;  3T80 A;  3LFO A;  2Q1Y A;  3VO8 A;  3V7E A;  1XRG A;  3MQW A;  3CC4 F;  4BVT A;  2QTP A;  1CLI A;  5HP8 A;  4XCQ A;  1M90 H;  2UYN A;  1TUB B;  2N48 A;  3SIV A;  4X20 A;  5DCV A;  3OON A;  3JAM M;  4U3J A;  3OBW A;  3CYQ A;  2KTU A;  3D00 A;  4EI8 A;  2H6L A;  5EYP B;  5KX5 A;  4B46 A;  1FNJ A;  3WGM A;  1VQP F;  5LXT A;  3S03 A;  1YIT F;  2Q1X A;  3VTI C;  3J81 M;  1Q81 H;  4O4H A;  5IJ0 A;  3E22 A;  3HKE B;  2I6D A;  1H48 A;  3KHN A;  2OTJ F;  4IIJ A;  3MBM A;  1PXW A;  1W57 A;  3QHD A;  4I4T A;  1GX1 A;  5J2T B;  1JN1 A;  1W40 A;  3RYH B;  3CCU F;  4TV9 A;  2VXY A;  5GIP C;  1ONI A;  5JH7 A;  1U40 A;  4EB6 B;  5CA0 A;  3F0G A;  1VQ6 F;  3NVK E;  2R6R 1;  2I6R A;  1SZQ A;  3M84 A;  3HKB A;  3VIU A;  3CG6 A;  4NQ3 A;  1Q86 H;  4B5C A;  3S06 A;  1VQ9 F;  1YJN F;  3FD5 A;  1N8R H;  1R1M A;  1UFY A;  1SA0 A;  3HKD A;  2HQS C;  4LNU A;  5JCO A;  2HS0 A;  1VHA A;  2Z1E A;  5A2Q M;  3KIZ A;  5EZY A;  3GHZ A;  4X1Y A;  4IHJ B;  2QA4 F;  2CVL A;  2FC3 A;  3N2G B;  4O2A B;  5HY2 A;  3G6E F;  2HRY A;  5EB1 B;  5LXT B;  2BTQ B;  4BT6 A;  1VQL F;  1FSZ A;  3UT5 B;  1CK2 A;  5EYP A;  3CCL F;  2Z01 A;  2ALE A;  3C9R A;  4BY9 D;  2CHS A;  3VYT C;  5KMG B;  4YJ3 A;  3ZOP A;  3O85 A;  3IEQ A;  2CSL A;  3JAW A;  4X1K B;  5IT9 M;  2LCA A;  3HJW C;  3K12 A;  4C8I A;  3S02 A;  2AIZ P;  3E20 B;  3MCA B;  5JVD B;  4BVS A;  1UI9 A;  1RLU A;  5LYJ A;  1H47 A;  2ZOD A;  1JFF B;  2HX0 A;  4I55 A;  3CCE F;  5CA1 B;  2VAW A;  3AGK A;  3WPW A;  1J7H A;  1Z5W A;  3HKB B;  1X25 A;  3U0O A;  3CME F;  1Q8R A;  4YJ2 A;  3I7T A;  3LYB A;  1YJ9 F;  3JAL A;  3CB2 A;  5IYZ A;  3C9U A;  1KC8 H;  2YYE A;  4F6R A;  2CHT A;  2HS4 A;  2QI2 A;  1GO1 A;  5C8Y B;  5B8F A;  1YIJ F;  5MN4 A;  1QD9 A;  1JY8 A;  4ERH A;  5IJ0 B;  3FD6 A;  1PF5 A;  2L26 A;  3HTN A;  2GLZ A;  4O4H B;  3DDN A;  4G4W A;  5KX5 B;  5EB0 A;  3BYQ A;  2W8B C;  2HRU A;  4ZOL A;  2B33 A;  4I50 A;  2IG8 A;  5LP6 B;  5LP6 A;  3HKE A;  4U3J B;  2RHH A;  4WBN B;  5EWR A;  2VAP A;  1KD1 H;  2AIF A;  3S0H A;  3JAS B;  3M4S A;  3RYI B;  3VYS C;  1IV3 A;  3F0F A;  4X1Y B;  3RA6 A;  2ZAU A;  5EIB D;  4FFB B;  5EZY B;  3I3F A;  4O4J A;  1VK3 A;  5MN6 A;  2F9Z C;  3WGJ A;  1S72 F;  4O2B A;  2UYN B;  5JH7 B;  4TZZ A;  4TUY B;  3RA5 A;  1YI2 F;  2DYY A;  3JAL B;  3I56 F;  1W3E X;  4C8G A;  3VOB A;  2HVY D;  1COM A;  4PWT A;  2KG4 A;  1K73 H;  5CB4 A;  3SIU A;  3ZO8 A;  1OAP A;  1CN7 A;  2CWJ A;  5GIN C;  3P0Z A;  3E22 B;  3D01 A;  3IEW A;  4DRX B;  1YGY A;  3N2K A;  1E7K A;  1XBI A;  3HKC A;  3G71 F;  3KE1 A;  2Z1T A;  5FNV B;  2ZVY A;  3ZP4 A;  4ZOL B;  1U3P A;  2LBW A;  3TD5 A;  5GAP K;  3F6M A;  5ITZ A;  1TUB A;  1YHQ F;  5GIO C;  4C82 A;  1W41 A;  1W55 A;  2MQE A;  2LBX A;  1FNK A;  3OW2 F;  3CMA F;  1X52 A;  3I55 F;  2H8E A;  2OHW A;  3LWR C;  1ZWZ A;  4X20 B;  3QTY A;  2UZH A;  1RA4 A;  3C9T A;  4YJ2 B;  1FFX A;  2H8C A;  1KNK A;  1W5E A;  3RE3 A;  3LWQ C;  3WXM B;  1QVG F;  3EOR A;  4LCK A;  2KGW A;  1TVK A;  3RYF A;  3N4Y A;  3NMU C; 
#chains in the Genus database with same CATH homology
 2CHS A;  2OTM A;  1COM A;  1QU9 A;  3VCZ A;  3ZP7 A;  3ZOP A;  2CHT A;  2UYP A;  3QUW A;  2CSL A;  1JD1 A;  3M4S A;  3ZO8 A;  1UFY A;  3K12 A;  5HP8 A;  3V4D A;  2CWJ A;  2EWC A;  2UYN A;  4NWO B;  1QD9 A;  3D01 A;  1UI9 A;  3KJK A;  4ZK7 A;  1FNK A;  3I3F A;  1PF5 A;  3R0P A;  3L7Q A;  3I7T A;  2CW4 A;  2UYJ A;  2CVL A;  3K0T A;  3ZP4 A;  1ONI A;  3M1X A;  1X25 A;  1J7H A;  2UYN B;  1NQ3 A;  1DBF A;  5HP7 A;  1FNJ A;  1ODE A;  3GTZ A;  2B33 A;  2DYY A;  3LME A;  1QAH A;  2IG8 A;  2UYK A;  1XHO A;  3LYB A;  1XRG A;  3MQW A;  3KJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...