1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chorismate mutase
molecule keywords CHORISMATE MUTASE
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
1XRGA 3D01A 2IG8A 2CHSA 3VCZA 4ZK7A 1XHOA 3QUWA 3ZO8A 3ZOPA 3V4DA 2CVLA 2OTMA 1QD9A 2CW4A 2UYNA 3K0TA 5HP8A 1FNKA 3ZP4A 2DYYA 3KJKA 1J7HA 3MQWA 2CSLA 3R0PA 2B33A 1FNJA 5HP7A 1COMA 2UYKA 3GTZA 1NQ3A 3L7QA 1QAHA 1UI9A 1X25A 1QU9A 3I7TA 3KJJA 2UYNB 1DBFA 3LMEA 3LYBA 3M4SA 1PF5A 1UFYA 3K12A 4NWOB 1ONIA 2CWJA 3ZP7A 2CHTA 2UYPA 1ODEA 3M1XA 2EWCA 3I3FA 1JD1A 2UYJA
chains in the Genus database with same CATH superfamily
4X1KB 3JAWB 5GIPC 1W5EA 2WALA 4G4YA 5EZYB 5J2UB 4BVTA 5HP8A 3S0HA 3ZP4A 4X1IA 4DRXB 2R6R1 1PXWA 3CCLF 1FFXB 1TVKA 1NQ3A 1H48A 3N2KA 4HNAA 2HS0A 1GO1A 3C9UA 1XV2A 3WPXA 3EORA 3M1XA 5CB4B 5FNVA 1M90H 3J81M 3OW2F 2Z01A 1VQ8F 3VYSC 3E1YA 1KQSF 2HX0A 4LNUA 3CCSF 1VQ4F 3TD3A 3CMEF 3ZO8A 1U3PA 3CYQA 4O2AA 3OBYA 2CW4A 3D54A 5LYJB 2YXZA 1VQ9F 5IJ9A 3NMUC 2OTJF 3UT5B 3F6MA 3AGKA 4G88A 1Q86H 2GVIA 1N8RH 5ITZA 2OZBA 2RHHA 4B62A 4EB6B 3O85A 3P10A 2HP0A 5EAZA 3CPQA 2HS4A 1W41A 4XCQA 1VQNF 2KTVA 2ZVYA 1YITF 2I6RA 4O4LA 4O4JA 1VQLF 2VAWA 3J7AR 3KJKA 2I6DA 1VQVA 3JVHA 1JJ2F 2B33A 5EYPB 5FJ4C 1U43A 3CXCF 3HKDB 3N2GA 5LOVB 3ERNA 5JQGA 2HVYD 3IEWA 3OBWA 4BT7A 1JFFB 5C8YB 3NK7A 3WXMB 5LXTA 3RA6A 5JCOA 3LYBA 3M4SA 3I3FA 4YJ3B 2UYJA 3RYHB 3C8LA 4C4WC 3RYCB 3LWVC 5CA0A 3HKBB 3CG6A 3CCQF 4O2BA 4X1YA 4ZHQA 5HY2A 3V4DA 5JH7B 2CVLA 3S03A 2AMTA 3CYPB 4TZZA 4ERHA 1GO0A 3HWUA 2K1SA 4O4IA 3VO8A 3HAXD 3B6NA 3MCAB 4KWEA 3LMEA 1IV3A 3FD5A 4TUYB 1Q81H 3K12A 1CLIA 2HRYA 3N4YA 1RLGA 3JASA 4I55B 1X52A 1KC8H 3HKEA 4F6RA 1W5AA 3VCZA 1RQ7A 3ON1A 5GONB 3V3TA 3C9TA 4I4TB 2MQEA 1IV4A 2LBTA 1J7HA 1GX1A 3VOBA 1IPAA 1TUBA 2QEXF 3C9RA 5BMVA 3LWRC 3IKEA 1X7PA 4X20A 1NJIH 1Q8RA 4O4HA 2ZF8A 4ZOLA 3WJPA 1DT9A 1W59A 2PHNA 3VIUA 4PWTA 2LBWA 4EI9A 5KMGA 2CZWA 4I50B 3LWQC 2ZVZA 5JVDA 4IHJB 3F0FA 2Z1EA 1E7KA 2BTUA 2IAFA 1IV2A 4X3LA 5J2TB 1YI2F 3F0DA 4BY9D 3CCJF 3CCRF 3K2XA 3G4SF 2HS3A 4BT5A 1XBIA 3ZP7A 3WGLA 1W3EX 4NUTA 1T0AA 2EWCA 3JATA 4ZI7B 4RQOA 3JARA 1M1KH 2VGMA 2CHSA 4G4VA 4BT3A 5HXUA 2OTMA 1QD9A 1SA0B 4TV9A 5LA6A 5GIOC 2RB9A 2AIFA 2BTQB 3RYFA 3F0GA 5HP7A 3P0ZA 3WJQA 2UYKA 3NK6A 1FSZA 4C81A 1Z5VA 4X1KA 3JAWA 4C8GA 1W2BF 1UI9A 2KTUA 2DT4A 5EZYA 5J2UA 3E22B 5EWRA 2CWJA 4DRXA 3WGMA 3CC4F 4NQ3A 2VAPA 4YJ2B 1XRGA 2RHOA 1FFXA 5KX5A 2KGWA 3V7EA 2OHWA 3K0TA 4TV8B 2DYYA 3VYUC 1VQ7F 3Q8HA 5CB4A 1COMA 3VTIC 4FFBB 4O2BB 4X1YB 1VQMF 3OONA 3G71F 3FPIA 3I7TA 2UYNB 1PF5A 3HKCB 3CD6F 5LYJA 3RA5A 2HQSC 4ZHWA 2CHTA 2FC3A 1RQ2A 1QVGF 4B46A 1JN1A 2G9IA 2ZAUA 3V7QA 3S0YA 1YHQF 5IJ0B 3GHZA 3QUWA 4BVRA 1CK2A 4X3MA 5MN4A 4EB6A 1VQ5F 1FNJA 2LCAA 3JALA 4IIJB 4C8EA 3IEQA 3JAKB 5HY0A 3CPWF 1H7MA 2ZOVA 4DXDA 1VK3A 3J80M 4NWOB 3CCUF 3HTNA 5A2QM 1Z5WA 3JCMM 3LWPC 1ODEA 2BO1A 5MN5A 5EYPA 4G4WA 5HXZA 1W40A 5G4VC 3HKDA 4B5CA 5CA1B 4WBNB 1YGYA 5LP6B 5HWEA 4ZOLB 3WGKA 3N4ZA 3F0EA 5C8YA 4EI8A 3RYIA 4BT6A 3FD6A 4YJ3A 1NMUB 3E20B 3RYHA 5EIBC 1K8AH 3RYCA 2QTPA 3HKBA 3KJJA 2F9ZC 3GYQA 4X1IB 5JH7A 5FLXM 4B45A 3S0WA 2H8EA 2NMUA 2RHJA 3D01A 1TVKB 2IG8A 5IYZA 3N2KB 4ZK7A 1QVFF 2P6YA 4HNAB 3P4EA 4TUYA 3WPWA 3ELCA 3MQWA 5FNVB 2QI2A 3JARB 3M84A 4LNUB 2VAMA 2RHLA 1H47A 4O2AB 4U3JA 3WGNA 1W55A 3RYFB 5GONA 2Q1YA 5IJ9B 3FBAA 2BTOA 2GZLA 1ONIA 4I4TA 4C82A 1OFUA 4BT4A 3SIUA 3CCMF 5ITZB 1VQ6F 2VXYA 1VQPF 2L26A 1FNKA 4R40B 1K9MH 5EB1B 4C8IA 3DDNA 1JY8A 1VHAA 3R0PA 2HP0B 2VGNA 4G4ZA 5KX5B 1RLUA 3QTYA 3CCVF 3GTZA 4O4LB 4BT2A 4E6EA 3CCEF 1VQKF 4O4JB 3LDTA 3WJRA 5HY1A 4EI7A 1DBFA 3G6EF 4I50A 1YQNA 4IHJA 3WGJA 3VMFB 1GZ0A 4BVQA 5J2TA 3N2GB 3VOAA 1XHOA 2ZODA 5JQGB 1T0KB 3D00A 2AIZP 2Z1UA 3I56F 5AVMA 4ZHVA 5LXTB 4BVSA 3MDOA 2IQQA 1SZQA 2JNBA 1U40A 1IV1A 2KG4A 4ZI7A 5CA0B 3MBMA 3IR9A 4ZHQB 5HY4A 1X25A 1CN7A 3I55F 3LFOA 3PLAC 5DCVA 2H8CA 1VH8A 3TD4A 1SA0A 3JALB 3KIZA 3DC2A 4M8IA 4O4IB 3UT5A 1W5BA 3ESJA 3NVIB 1W581 3CC2F 3NVKE 3TD5A 4LCKA 2N48A 2UZHA 3E22A 2HP3A 5JCOC 1K73H 1SDSA 2GLZA 2QA4F 3JASB 3PAFA 3VI6A 1Q82H 2CSLA 4BW0B 3RE3A 3BYQA 1KD1H 3HKEB 3MCQA 4YJ2A 4F6RB 1R1MA 2FGYA 3L7QA 1VQOF 2HRUA 3FFMA 5EB0A 5GAPK 2Q1XA 4TV8A 3RYIB 3HJWC 5GANK 1TUBB 2UYPA 2V9YA 3S06A 5EO3A 5IT9M 2W8BC 5BMVB 4G4XA 3CB2A 2Z1FA 5B8FA 4FFBA 1ZWZA 4X20B 5GINC 1KNJA 2UYNA 4O4HB 5LOVA 3HKCA 3SIVA 1S72F 1JFFA 2PMPA 1W42A 5IYZB 2R751 2OTLF 1QAHA 5KMGB 1QU9A 2YYEA 5IJ0A 1OAPA 5JVDB 1UFYA 1YIJF 3IMPA 1JD1A 3C9SA 1U3LA 4U3JB 3K14A 4IIJA 1W57A 1RA4A 3JAKA 3U0OA 5EIBD 1KNKA 3LWOC 2H6LA 5LP6C 3ZOPA 2LBXA 1YJWF 1YJNF 1YJ9F 3IKFA 3JATB 1X7OA 3T80A 1Q7YH 3KE1A 2ALEA 3KHNA 3CMAF 3CC7F 4I55A 3S02A 4ZHYB 5G4UC 1W5FA 5CA1A 4TV9B 4WBNA 2Z1TA 5LA6B 5LP6A 3JAMM 5MN6A 4U39A 4RHAA 3VYTC 3QHDA
chains in the Genus database with same CATH topology
1XRGA 3D01A 2IG8A 2CHSA 3VCZA 4ZK7A 1XHOA 3QUWA 3ZO8A 3ZOPA 3V4DA 2CVLA 2OTMA 1QD9A 2CW4A 2UYNA 3K0TA 5HP8A 1FNKA 3ZP4A 2DYYA 3KJKA 1J7HA 3MQWA 2CSLA 3R0PA 2B33A 1FNJA 5HP7A 1COMA 2UYKA 3GTZA 1NQ3A 3L7QA 1QAHA 1UI9A 1X25A 1QU9A 3I7TA 3KJJA 2UYNB 1DBFA 3LMEA 3LYBA 3M4SA 1PF5A 1UFYA 3K12A 4NWOB 1ONIA 2CWJA 3ZP7A 2CHTA 2UYPA 1ODEA 3M1XA 2EWCA 3I3FA 1JD1A 2UYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRG A;  3D01 A;  2IG8 A;  2CHS A;  3VCZ A;  4ZK7 A;  1XHO A;  3QUW A;  3ZO8 A;  3ZOP A;  3V4D A;  2CVL A;  2OTM A;  1QD9 A;  2CW4 A;  2UYN A;  3K0T A;  5HP8 A;  1FNK A;  3ZP4 A;  2DYY A;  3KJK A;  1J7H A;  3MQW A;  2CSL A;  3R0P A;  2B33 A;  1FNJ A;  5HP7 A;  1COM A;  2UYK A;  3GTZ A;  1NQ3 A;  3L7Q A;  1QAH A;  1UI9 A;  1X25 A;  1QU9 A;  3I7T A;  3KJJ A;  2UYN B;  1DBF A;  3LME A;  3LYB A;  3M4S A;  1PF5 A;  1UFY A;  3K12 A;  4NWO B;  1ONI A;  2CWJ A;  3ZP7 A;  2CHT A;  2UYP A;  1ODE A;  3M1X A;  2EWC A;  3I3F A;  1JD1 A;  2UYJ A; 
#chains in the Genus database with same CATH topology
 4X1K B;  3JAW B;  5GIP C;  1W5E A;  2WAL A;  4G4Y A;  5EZY B;  5J2U B;  4BVT A;  5HP8 A;  3S0H A;  3ZP4 A;  4X1I A;  4DRX B;  2R6R 1;  1PXW A;  3CCL F;  1FFX B;  1TVK A;  1NQ3 A;  1H48 A;  3N2K A;  4HNA A;  2HS0 A;  1GO1 A;  3C9U A;  1XV2 A;  3WPX A;  3EOR A;  3M1X A;  5CB4 B;  5FNV A;  1M90 H;  3J81 M;  3OW2 F;  2Z01 A;  1VQ8 F;  3VYS C;  3E1Y A;  1KQS F;  2HX0 A;  4LNU A;  3CCS F;  1VQ4 F;  3TD3 A;  3CME F;  3ZO8 A;  1U3P A;  3CYQ A;  4O2A A;  3OBY A;  2CW4 A;  3D54 A;  5LYJ B;  2YXZ A;  1VQ9 F;  5IJ9 A;  3NMU C;  2OTJ F;  3UT5 B;  3F6M A;  3AGK A;  4G88 A;  1Q86 H;  2GVI A;  1N8R H;  5ITZ A;  2OZB A;  2RHH A;  4B62 A;  4EB6 B;  3O85 A;  3P10 A;  2HP0 A;  5EAZ A;  3CPQ A;  2HS4 A;  1W41 A;  4XCQ A;  1VQN F;  2KTV A;  2ZVY A;  1YIT F;  2I6R A;  4O4L A;  4O4J A;  1VQL F;  2VAW A;  3J7A R;  3KJK A;  2I6D A;  1VQV A;  3JVH A;  1JJ2 F;  2B33 A;  5EYP B;  5FJ4 C;  1U43 A;  3CXC F;  3HKD B;  3N2G A;  5LOV B;  3ERN A;  5JQG A;  2HVY D;  3IEW A;  3OBW A;  4BT7 A;  1JFF B;  5C8Y B;  3NK7 A;  3WXM B;  5LXT A;  3RA6 A;  5JCO A;  3LYB A;  3M4S A;  3I3F A;  4YJ3 B;  2UYJ A;  3RYH B;  3C8L A;  4C4W C;  3RYC B;  3LWV C;  5CA0 A;  3HKB B;  3CG6 A;  3CCQ F;  4O2B A;  4X1Y A;  4ZHQ A;  5HY2 A;  3V4D A;  5JH7 B;  2CVL A;  3S03 A;  2AMT A;  3CYP B;  4TZZ A;  4ERH A;  1GO0 A;  3HWU A;  2K1S A;  4O4I A;  3VO8 A;  3HAX D;  3B6N A;  3MCA B;  4KWE A;  3LME A;  1IV3 A;  3FD5 A;  4TUY B;  1Q81 H;  3K12 A;  1CLI A;  2HRY A;  3N4Y A;  1RLG A;  3JAS A;  4I55 B;  1X52 A;  1KC8 H;  3HKE A;  4F6R A;  1W5A A;  3VCZ A;  1RQ7 A;  3ON1 A;  5GON B;  3V3T A;  3C9T A;  4I4T B;  2MQE A;  1IV4 A;  2LBT A;  1J7H A;  1GX1 A;  3VOB A;  1IPA A;  1TUB A;  2QEX F;  3C9R A;  5BMV A;  3LWR C;  3IKE A;  1X7P A;  4X20 A;  1NJI H;  1Q8R A;  4O4H A;  2ZF8 A;  4ZOL A;  3WJP A;  1DT9 A;  1W59 A;  2PHN A;  3VIU A;  4PWT A;  2LBW A;  4EI9 A;  5KMG A;  2CZW A;  4I50 B;  3LWQ C;  2ZVZ A;  5JVD A;  4IHJ B;  3F0F A;  2Z1E A;  1E7K A;  2BTU A;  2IAF A;  1IV2 A;  4X3L A;  5J2T B;  1YI2 F;  3F0D A;  4BY9 D;  3CCJ F;  3CCR F;  3K2X A;  3G4S F;  2HS3 A;  4BT5 A;  1XBI A;  3ZP7 A;  3WGL A;  1W3E X;  4NUT A;  1T0A A;  2EWC A;  3JAT A;  4ZI7 B;  4RQO A;  3JAR A;  1M1K H;  2VGM A;  2CHS A;  4G4V A;  4BT3 A;  5HXU A;  2OTM A;  1QD9 A;  1SA0 B;  4TV9 A;  5LA6 A;  5GIO C;  2RB9 A;  2AIF A;  2BTQ B;  3RYF A;  3F0G A;  5HP7 A;  3P0Z A;  3WJQ A;  2UYK A;  3NK6 A;  1FSZ A;  4C81 A;  1Z5V A;  4X1K A;  3JAW A;  4C8G A;  1W2B F;  1UI9 A;  2KTU A;  2DT4 A;  5EZY A;  5J2U A;  3E22 B;  5EWR A;  2CWJ A;  4DRX A;  3WGM A;  3CC4 F;  4NQ3 A;  2VAP A;  4YJ2 B;  1XRG A;  2RHO A;  1FFX A;  5KX5 A;  2KGW A;  3V7E A;  2OHW A;  3K0T A;  4TV8 B;  2DYY A;  3VYU C;  1VQ7 F;  3Q8H A;  5CB4 A;  1COM A;  3VTI C;  4FFB B;  4O2B B;  4X1Y B;  1VQM F;  3OON A;  3G71 F;  3FPI A;  3I7T A;  2UYN B;  1PF5 A;  3HKC B;  3CD6 F;  5LYJ A;  3RA5 A;  2HQS C;  4ZHW A;  2CHT A;  2FC3 A;  1RQ2 A;  1QVG F;  4B46 A;  1JN1 A;  2G9I A;  2ZAU A;  3V7Q A;  3S0Y A;  1YHQ F;  5IJ0 B;  3GHZ A;  3QUW A;  4BVR A;  1CK2 A;  4X3M A;  5MN4 A;  4EB6 A;  1VQ5 F;  1FNJ A;  2LCA A;  3JAL A;  4IIJ B;  4C8E A;  3IEQ A;  3JAK B;  5HY0 A;  3CPW F;  1H7M A;  2ZOV A;  4DXD A;  1VK3 A;  3J80 M;  4NWO B;  3CCU F;  3HTN A;  5A2Q M;  1Z5W A;  3JCM M;  3LWP C;  1ODE A;  2BO1 A;  5MN5 A;  5EYP A;  4G4W A;  5HXZ A;  1W40 A;  5G4V C;  3HKD A;  4B5C A;  5CA1 B;  4WBN B;  1YGY A;  5LP6 B;  5HWE A;  4ZOL B;  3WGK A;  3N4Z A;  3F0E A;  5C8Y A;  4EI8 A;  3RYI A;  4BT6 A;  3FD6 A;  4YJ3 A;  1NMU B;  3E20 B;  3RYH A;  5EIB C;  1K8A H;  3RYC A;  2QTP A;  3HKB A;  3KJJ A;  2F9Z C;  3GYQ A;  4X1I B;  5JH7 A;  5FLX M;  4B45 A;  3S0W A;  2H8E A;  2NMU A;  2RHJ A;  3D01 A;  1TVK B;  2IG8 A;  5IYZ A;  3N2K B;  4ZK7 A;  1QVF F;  2P6Y A;  4HNA B;  3P4E A;  4TUY A;  3WPW A;  3ELC A;  3MQW A;  5FNV B;  2QI2 A;  3JAR B;  3M84 A;  4LNU B;  2VAM A;  2RHL A;  1H47 A;  4O2A B;  4U3J A;  3WGN A;  1W55 A;  3RYF B;  5GON A;  2Q1Y A;  5IJ9 B;  3FBA A;  2BTO A;  2GZL A;  1ONI A;  4I4T A;  4C82 A;  1OFU A;  4BT4 A;  3SIU A;  3CCM F;  5ITZ B;  1VQ6 F;  2VXY A;  1VQP F;  2L26 A;  1FNK A;  4R40 B;  1K9M H;  5EB1 B;  4C8I A;  3DDN A;  1JY8 A;  1VHA A;  3R0P A;  2HP0 B;  2VGN A;  4G4Z A;  5KX5 B;  1RLU A;  3QTY A;  3CCV F;  3GTZ A;  4O4L B;  4BT2 A;  4E6E A;  3CCE F;  1VQK F;  4O4J B;  3LDT A;  3WJR A;  5HY1 A;  4EI7 A;  1DBF A;  3G6E F;  4I50 A;  1YQN A;  4IHJ A;  3WGJ A;  3VMF B;  1GZ0 A;  4BVQ A;  5J2T A;  3N2G B;  3VOA A;  1XHO A;  2ZOD A;  5JQG B;  1T0K B;  3D00 A;  2AIZ P;  2Z1U A;  3I56 F;  5AVM A;  4ZHV A;  5LXT B;  4BVS A;  3MDO A;  2IQQ A;  1SZQ A;  2JNB A;  1U40 A;  1IV1 A;  2KG4 A;  4ZI7 A;  5CA0 B;  3MBM A;  3IR9 A;  4ZHQ B;  5HY4 A;  1X25 A;  1CN7 A;  3I55 F;  3LFO A;  3PLA C;  5DCV A;  2H8C A;  1VH8 A;  3TD4 A;  1SA0 A;  3JAL B;  3KIZ A;  3DC2 A;  4M8I A;  4O4I B;  3UT5 A;  1W5B A;  3ESJ A;  3NVI B;  1W58 1;  3CC2 F;  3NVK E;  3TD5 A;  4LCK A;  2N48 A;  2UZH A;  3E22 A;  2HP3 A;  5JCO C;  1K73 H;  1SDS A;  2GLZ A;  2QA4 F;  3JAS B;  3PAF A;  3VI6 A;  1Q82 H;  2CSL A;  4BW0 B;  3RE3 A;  3BYQ A;  1KD1 H;  3HKE B;  3MCQ A;  4YJ2 A;  4F6R B;  1R1M A;  2FGY A;  3L7Q A;  1VQO F;  2HRU A;  3FFM A;  5EB0 A;  5GAP K;  2Q1X A;  4TV8 A;  3RYI B;  3HJW C;  5GAN K;  1TUB B;  2UYP A;  2V9Y A;  3S06 A;  5EO3 A;  5IT9 M;  2W8B C;  5BMV B;  4G4X A;  3CB2 A;  2Z1F A;  5B8F A;  4FFB A;  1ZWZ A;  4X20 B;  5GIN C;  1KNJ A;  2UYN A;  4O4H B;  5LOV A;  3HKC A;  3SIV A;  1S72 F;  1JFF A;  2PMP A;  1W42 A;  5IYZ B;  2R75 1;  2OTL F;  1QAH A;  5KMG B;  1QU9 A;  2YYE A;  5IJ0 A;  1OAP A;  5JVD B;  1UFY A;  1YIJ F;  3IMP A;  1JD1 A;  3C9S A;  1U3L A;  4U3J B;  3K14 A;  4IIJ A;  1W57 A;  1RA4 A;  3JAK A;  3U0O A;  5EIB D;  1KNK A;  3LWO C;  2H6L A;  5LP6 C;  3ZOP A;  2LBX A;  1YJW F;  1YJN F;  1YJ9 F;  3IKF A;  3JAT B;  1X7O A;  3T80 A;  1Q7Y H;  3KE1 A;  2ALE A;  3KHN A;  3CMA F;  3CC7 F;  4I55 A;  3S02 A;  4ZHY B;  5G4U C;  1W5F A;  5CA1 A;  4TV9 B;  4WBN A;  2Z1T A;  5LA6 B;  5LP6 A;  3JAM M;  5MN6 A;  4U39 A;  4RHA A;  3VYT C;  3QHD A; 
#chains in the Genus database with same CATH homology
 1XRG A;  3D01 A;  2IG8 A;  2CHS A;  3VCZ A;  4ZK7 A;  1XHO A;  3QUW A;  3ZO8 A;  3ZOP A;  3V4D A;  2CVL A;  2OTM A;  1QD9 A;  2CW4 A;  2UYN A;  3K0T A;  5HP8 A;  1FNK A;  3ZP4 A;  2DYY A;  3KJK A;  1J7H A;  3MQW A;  2CSL A;  3R0P A;  2B33 A;  1FNJ A;  5HP7 A;  1COM A;  2UYK A;  3GTZ A;  1NQ3 A;  3L7Q A;  1QAH A;  1UI9 A;  1X25 A;  1QU9 A;  3I7T A;  3KJJ A;  2UYN B;  1DBF A;  3LME A;  3LYB A;  3M4S A;  1PF5 A;  1UFY A;  3K12 A;  4NWO B;  1ONI A;  2CWJ A;  3ZP7 A;  2CHT A;  2UYP A;  1ODE A;  3M1X A;  2EWC A;  3I3F A;  1JD1 A;  2UYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...