1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chorismate mutase
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
2DYYA 3I3FA 4NWOB 2B33A 3M4SA 3VCZA 2UYJA 2CHTA 2UYPA 3R0PA 2IG8A 3I7TA 3MQWA 2UYNA 1UFYA 2EWCA 2CHSA 3D01A 2OTMA 1QU9A 1X25A 2CVLA 4ZK7A 3LYBA 1XHOA 1QAHA 3ZOPA 1QD9A 1ODEA 3ZP4A 1JD1A 1UI9A 3GTZA 1NQ3A 1J7HA 5HP7A 1XRGA 3KJKA 3ZP7A 2UYKA 3QUWA 1FNJA 3K0TA 3L7QA 3K12A 1COMA 1ONIA 3LMEA 1DBFA 2CW4A 1FNKA 3V4DA 2CWJA 3M1XA 3ZO8A 2CSLA 2UYNB 5HP8A 1PF5A 3KJJA
chains in the Genus database with same CATH superfamily
3AGKA 2HP3A 4F6RB 5LOVB 5B8FA 2QI2A 4ZHYB 3IKEA 3J80M 5EO3A 2K1SA 4I55B 4LNUA 3HKDB 1NJIH 5HWEA 3S0HA 3K2XA 3F0EA 4HNAB 3RA5A 1ODEA 2ZF8A 1H47A 1YJWF 2BO1A 1NMUB 5IJ9A 1JFFB 1TUBA 1VQ4F 5KX5A 3WGKA 4BT2A 1R1MA 4ERHA 3HJWC 3OONA 3P10A 3LFOA 2CZWA 4O2BA 5JCOC 1RA4A 3NVIB 2ZAUA 3WJRA 3N2KA 3I7TA 3KIZA 3KHNA 4TV9B 5GIOC 3HTNA 2VXYA 1W581 1T0KB 1W42A 1FFXA 2YXZA 3JALB 1YITF 1RQ2A 4ZOLA 1W55A 4DXDA 3JARB 1CLIA 3V7QA 5ITZB 4X1IA 4DRXB 2Z1UA 3VOAA 3JAKA 5EYPB 3M1XA 3HKCA 3WXMB 1X52A 5LP6B 2I6RA 1W5AA 5LYJA 5LXTA 1H7MA 3M4SA 3S06A 2VAMA 5EIBD 4XCQA 3CG6A 5JH7A 1U40A 4TV8A 2CVLA 4O2AA 3JATB 2FC3A 4I4TA 5G4UC 1JD1A 3GTZA 4PWTA 3S03A 1Z5WA 1COMA 5HXUA 3VI6A 2BTQB 4U39A 5GINC 2RHHA 2L26A 1JJ2F 1PF5A 4ZHWA 4IHJB 2HX0A 4EB6B 2OHWA 3VIUA 4YJ2A 5KMGB 3HKBA 1M90H 2HS4A 4R40B 1YQNA 3MCQA 3HAXD 3G6EF 3RYCB 4ZI7A 5C8YB 1UI9A 2KTUA 4NQ3A 2UZHA 4X1KB 2ALEA 4X3MA 4U3JA 4BVQA 1FNKA 1FSZA 4TUYB 3V4DA 1JN1A 2UYNB 4LCKA 2GZLA 4IIJA 2PMPA 1KNJA 3JAWB 5EAZA 5EZYB 4X1YA 3R0PA 3E20B 3MQWA 5HY1A 3CCVF 4BY9D 1YJ9F 3B6NA 3WGLA 1VQ7F 4G4XA 4YJ3B 5FNVA 3RYFB 1VQOF 3CC2F 2LCAA 1U3PA 1E7KA 1XHOA 3SIUA 4O4HB 1K9MH 2HP0A 2ZVZA 3GHZA 3C9TA 3G71F 3OBYA 1QVGF 3UT5B 1JY8A 2G9IA 1VQ5F 2H8EA 2Q1XA 4BVTA 1GO1A 4B46A 3CCRF 1W2BF 1KQSF 4M8IA 4BT4A 3E1YA 2H8CA 3JVHA 5CA0A 3CPQA 4WBNA 3RYIA 5MN4A 3NK7A 1VQKF 1X25A 5FLXM 3MCAB 4BT5A 4TV9A 4G4VA 2R6R1 5IYZA 1W5BA 3S02A 3JCMM 1SDSA 3FBAA 1XRGA 1PXWA 1IPAA 3CCQF 3LWPC 3LMEA 4KWEA 3HWUA 3JAMM 2H6LA 5ITZA 3P0ZA 1DT9A 4BT7A 2DYYA 3FD5A 2WALA 3KE1A 4G4YA 5EB1B 5EYPA 3VOBA 5LP6A 1XBIA 2KG4A 2OTMA 5EB0A 4EI8A 4O4IB 5GONB 4RQOA 1GO0A 3VYUC 5J2UB 3N4YA 1VQ6F 1H48A 3JATA 4ZHVA 1ONIA 1U3LA 4BT6A 2CW4A 2BTOA 2IQQA 3VYTC 4O4JB 1IV4A 3CCJF 3TD4A 5EWRA 4FFBA 2B33A 3VCZA 5JQGA 3CC4F 2N48A 3WJPA 3N2GA 3MBMA 5J2TA 3V3TA 5MN5A 3PAFA 3CPWF 1VQ8F 1TUBB 3ELCA 5KX5B 4G4ZA 2LBWA 5GANK 1XV2A 3RYHA 3ZOPA 5DCVA 1RLGA 2LBTA 3JASB 5KMGA 2MQEA 3F6MA 1KNKA 3NVKE 5IJ0B 2QEXF 3WGNA 3RYCA 4I50B 3J81M 3CCEF 1CK2A 5C8YA 3MDOA 3E22B 2CWJA 2NMUA 3OW2F 4C4WC 1IV2A 3WPWA 3CXCF 1FFXB 2OTLF 3CCMF 2P6YA 3I56F 3DC2A 1M1KH 1TVKA 4X1IB 5EZYA 1QVFF 4O4LA 3JAKB 2Z1FA 4C81A 1S72F 5HXZA 3ZP4A 3C8LA 3GYQA 3D54A 3CCLF 5LYJB 3K0TA 3I55F 3FPIA 3O85A 5JH7B 1VK3A 2DT4A 3UT5A 4TV8B 3WGJA 2CHTA 3LWVC 2IG8A 4I4TB 3C9RA 5A2QM 1GZ0A 3LWQC 2W8BC 1IV1A 3LWOC 2Z1TA 1SA0B 4F6RA 5LOVA 2LBXA 3IKFA 5CA1B 4B5CA 4X20B 3ON1A 4I55A 2GVIA 3CYPB 1ZWZA 1W3EX 3HKDA 3IR9A 4ZHQB 1X7OA 4HNAA 3ZO8A 4BVSA 4YJ2B 3J7AR 1JFFA 4EI7A 4NWOB 2Z01A 2ZOVA 5JVDB 1VQ9F 2QA4F 1K73H 2UYPA 5FJ4C 1OAPA 1VH8A 3VYSC 4ZI7B 3CCSF 4X3LA 3K14A 3HKEB 1VQNF 3F0GA 5LA6B 3QTYA 3CYQA 3CCUF 4U3JB 1QD9A 2BTUA 1VQVA 5G4VC 2UYKA 5GONA 5JCOA 4BT3A 2HQSC 4IIJB 3JALA 1Q82H 3VMFB 3JARA 3WGMA 5IT9M 2CSLA 5CB4B 2RHJA 4DRXA 1SZQA 4NUTA 5FNVB 4O4JA 3FFMA 1IV3A 2HP0B 3DDNA 4C8GA 2YYEA 2VAWA 3IEQA 3IEWA 2AMTA 3D01A 5HY4A 3S0WA 2HVYD 2HS0A 3RE3A 1YIJF 3TD3A 3ZP7A 1FNJA 3L7QA 5BMVB 3JASA 1Q81H 5CA0B 1Q8RA 1RQ7A 3F0DA 4WBNB 3RYIB 5IJ0A 4I50A 3SIVA 4LNUB 1CN7A 2AIZP 2HS3A 3E22A 5MN6A 5IYZB 1W41A 3NK6A 5GAPK 2HRUA 2VAPA 2HRYA 2PHNA 1UFYA 2EWCA 2I6DA 4IHJA 1KC8H 3BYQA 4ZK7A 5IJ9B 2V9YA 4EB6A 5LP6C 3G4SF 4B62A 1Q86H 3OBWA 4TZZA 3KJKA 2RB9A 4O2BB 2ZVYA 4BVRA 2GLZA 3P4EA 1K8AH 2RHLA 3N2KB 3Q8HA 4G88A 3RA6A 4X1KA 1U43A 1VHAA 2Z1EA 1GX1A 2UYJA 3T80A 4C8EA 1YHQF 4TUYA 3CMAF 2OTJF 2R751 2UYNA 1KD1H 3EORA 4ZOLB 4RHAA 2RHOA 3QHDA 3ESJA 5HY2A 3JAWA 2IAFA 1QU9A 1RLUA 2VGMA 3WPXA 3LYBA 2AIFA 3WJQA 4E6EA 3N4ZA 3HKCB 1SA0A 5HP7A 3QUWA 4YJ3A 3RYFA 2FGYA 1W40A 4FFBB 5EIBC 1DBFA 5JQGB 4O4HA 5LXTB 5CA1A 3C9SA 4X20A 2JNBA 3N2GB 5J2TB 2OZBA 3U0OA 1W5EA 4ZHQA 3KJJA 1Q7YH 2KGWA 4O2AB 1YGYA 3RYHB 1W57A 3IMPA 3LDTA 5JVDA 3FD6A 2F9ZC 3VO8A 4BW0B 2Q1YA 1YJNF 1VQMF 2VGNA 1T0AA 3V7EA 3C9UA 2ZODA 3HKEA 5LA6A 3TD5A 4C8IA 1NQ3A 1J7HA 3CMEF 3F0FA 3CD6F 5GIPC 3D00A 5HY0A 1W5FA 3PLAC 1Z5VA 3VTIC 1TVKB 1N8RH 3I3FA 3HKBB 4O4LB 1W59A 3LWRC 5CB4A 1YI2F 3CB2A 1VQLF 2CHSA 4G4WA 2KTVA 1QAHA 1VQPF 4C82A 3CC7F 2QTPA 3M84A 4O4IA 3K12A 3S0YA 3ERNA 5AVMA 4X1YB 4EI9A 1X7PA 4B45A 5J2UA 1OFUA 5HP8A 3NMUC 5BMVA
chains in the Genus database with same CATH topology
2DYYA 3I3FA 4NWOB 2B33A 3M4SA 3VCZA 2UYJA 2CHTA 2UYPA 3R0PA 2IG8A 3I7TA 3MQWA 2UYNA 1UFYA 2EWCA 2CHSA 3D01A 2OTMA 1QU9A 1X25A 2CVLA 4ZK7A 3LYBA 1XHOA 1QAHA 3ZOPA 1QD9A 1ODEA 3ZP4A 1JD1A 1UI9A 3GTZA 1NQ3A 1J7HA 5HP7A 1XRGA 3KJKA 3ZP7A 2UYKA 3QUWA 1FNJA 3K0TA 3L7QA 3K12A 1COMA 1ONIA 3LMEA 1DBFA 2CW4A 1FNKA 3V4DA 2CWJA 3M1XA 3ZO8A 2CSLA 2UYNB 5HP8A 1PF5A 3KJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYY A;  3I3F A;  4NWO B;  2B33 A;  3M4S A;  3VCZ A;  2UYJ A;  2CHT A;  2UYP A;  3R0P A;  2IG8 A;  3I7T A;  3MQW A;  2UYN A;  1UFY A;  2EWC A;  2CHS A;  3D01 A;  2OTM A;  1QU9 A;  1X25 A;  2CVL A;  4ZK7 A;  3LYB A;  1XHO A;  1QAH A;  3ZOP A;  1QD9 A;  1ODE A;  3ZP4 A;  1JD1 A;  1UI9 A;  3GTZ A;  1NQ3 A;  1J7H A;  5HP7 A;  1XRG A;  3KJK A;  3ZP7 A;  2UYK A;  3QUW A;  1FNJ A;  3K0T A;  3L7Q A;  3K12 A;  1COM A;  1ONI A;  3LME A;  1DBF A;  2CW4 A;  1FNK A;  3V4D A;  2CWJ A;  3M1X A;  3ZO8 A;  2CSL A;  2UYN B;  5HP8 A;  1PF5 A;  3KJJ A; 
#chains in the Genus database with same CATH topology
 3AGK A;  2HP3 A;  4F6R B;  5LOV B;  5B8F A;  2QI2 A;  4ZHY B;  3IKE A;  3J80 M;  5EO3 A;  2K1S A;  4I55 B;  4LNU A;  3HKD B;  1NJI H;  5HWE A;  3S0H A;  3K2X A;  3F0E A;  4HNA B;  3RA5 A;  1ODE A;  2ZF8 A;  1H47 A;  1YJW F;  2BO1 A;  1NMU B;  5IJ9 A;  1JFF B;  1TUB A;  1VQ4 F;  5KX5 A;  3WGK A;  4BT2 A;  1R1M A;  4ERH A;  3HJW C;  3OON A;  3P10 A;  3LFO A;  2CZW A;  4O2B A;  5JCO C;  1RA4 A;  3NVI B;  2ZAU A;  3WJR A;  3N2K A;  3I7T A;  3KIZ A;  3KHN A;  4TV9 B;  5GIO C;  3HTN A;  2VXY A;  1W58 1;  1T0K B;  1W42 A;  1FFX A;  2YXZ A;  3JAL B;  1YIT F;  1RQ2 A;  4ZOL A;  1W55 A;  4DXD A;  3JAR B;  1CLI A;  3V7Q A;  5ITZ B;  4X1I A;  4DRX B;  2Z1U A;  3VOA A;  3JAK A;  5EYP B;  3M1X A;  3HKC A;  3WXM B;  1X52 A;  5LP6 B;  2I6R A;  1W5A A;  5LYJ A;  5LXT A;  1H7M A;  3M4S A;  3S06 A;  2VAM A;  5EIB D;  4XCQ A;  3CG6 A;  5JH7 A;  1U40 A;  4TV8 A;  2CVL A;  4O2A A;  3JAT B;  2FC3 A;  4I4T A;  5G4U C;  1JD1 A;  3GTZ A;  4PWT A;  3S03 A;  1Z5W A;  1COM A;  5HXU A;  3VI6 A;  2BTQ B;  4U39 A;  5GIN C;  2RHH A;  2L26 A;  1JJ2 F;  1PF5 A;  4ZHW A;  4IHJ B;  2HX0 A;  4EB6 B;  2OHW A;  3VIU A;  4YJ2 A;  5KMG B;  3HKB A;  1M90 H;  2HS4 A;  4R40 B;  1YQN A;  3MCQ A;  3HAX D;  3G6E F;  3RYC B;  4ZI7 A;  5C8Y B;  1UI9 A;  2KTU A;  4NQ3 A;  2UZH A;  4X1K B;  2ALE A;  4X3M A;  4U3J A;  4BVQ A;  1FNK A;  1FSZ A;  4TUY B;  3V4D A;  1JN1 A;  2UYN B;  4LCK A;  2GZL A;  4IIJ A;  2PMP A;  1KNJ A;  3JAW B;  5EAZ A;  5EZY B;  4X1Y A;  3R0P A;  3E20 B;  3MQW A;  5HY1 A;  3CCV F;  4BY9 D;  1YJ9 F;  3B6N A;  3WGL A;  1VQ7 F;  4G4X A;  4YJ3 B;  5FNV A;  3RYF B;  1VQO F;  3CC2 F;  2LCA A;  1U3P A;  1E7K A;  1XHO A;  3SIU A;  4O4H B;  1K9M H;  2HP0 A;  2ZVZ A;  3GHZ A;  3C9T A;  3G71 F;  3OBY A;  1QVG F;  3UT5 B;  1JY8 A;  2G9I A;  1VQ5 F;  2H8E A;  2Q1X A;  4BVT A;  1GO1 A;  4B46 A;  3CCR F;  1W2B F;  1KQS F;  4M8I A;  4BT4 A;  3E1Y A;  2H8C A;  3JVH A;  5CA0 A;  3CPQ A;  4WBN A;  3RYI A;  5MN4 A;  3NK7 A;  1VQK F;  1X25 A;  5FLX M;  3MCA B;  4BT5 A;  4TV9 A;  4G4V A;  2R6R 1;  5IYZ A;  1W5B A;  3S02 A;  3JCM M;  1SDS A;  3FBA A;  1XRG A;  1PXW A;  1IPA A;  3CCQ F;  3LWP C;  3LME A;  4KWE A;  3HWU A;  3JAM M;  2H6L A;  5ITZ A;  3P0Z A;  1DT9 A;  4BT7 A;  2DYY A;  3FD5 A;  2WAL A;  3KE1 A;  4G4Y A;  5EB1 B;  5EYP A;  3VOB A;  5LP6 A;  1XBI A;  2KG4 A;  2OTM A;  5EB0 A;  4EI8 A;  4O4I B;  5GON B;  4RQO A;  1GO0 A;  3VYU C;  5J2U B;  3N4Y A;  1VQ6 F;  1H48 A;  3JAT A;  4ZHV A;  1ONI A;  1U3L A;  4BT6 A;  2CW4 A;  2BTO A;  2IQQ A;  3VYT C;  4O4J B;  1IV4 A;  3CCJ F;  3TD4 A;  5EWR A;  4FFB A;  2B33 A;  3VCZ A;  5JQG A;  3CC4 F;  2N48 A;  3WJP A;  3N2G A;  3MBM A;  5J2T A;  3V3T A;  5MN5 A;  3PAF A;  3CPW F;  1VQ8 F;  1TUB B;  3ELC A;  5KX5 B;  4G4Z A;  2LBW A;  5GAN K;  1XV2 A;  3RYH A;  3ZOP A;  5DCV A;  1RLG A;  2LBT A;  3JAS B;  5KMG A;  2MQE A;  3F6M A;  1KNK A;  3NVK E;  5IJ0 B;  2QEX F;  3WGN A;  3RYC A;  4I50 B;  3J81 M;  3CCE F;  1CK2 A;  5C8Y A;  3MDO A;  3E22 B;  2CWJ A;  2NMU A;  3OW2 F;  4C4W C;  1IV2 A;  3WPW A;  3CXC F;  1FFX B;  2OTL F;  3CCM F;  2P6Y A;  3I56 F;  3DC2 A;  1M1K H;  1TVK A;  4X1I B;  5EZY A;  1QVF F;  4O4L A;  3JAK B;  2Z1F A;  4C81 A;  1S72 F;  5HXZ A;  3ZP4 A;  3C8L A;  3GYQ A;  3D54 A;  3CCL F;  5LYJ B;  3K0T A;  3I55 F;  3FPI A;  3O85 A;  5JH7 B;  1VK3 A;  2DT4 A;  3UT5 A;  4TV8 B;  3WGJ A;  2CHT A;  3LWV C;  2IG8 A;  4I4T B;  3C9R A;  5A2Q M;  1GZ0 A;  3LWQ C;  2W8B C;  1IV1 A;  3LWO C;  2Z1T A;  1SA0 B;  4F6R A;  5LOV A;  2LBX A;  3IKF A;  5CA1 B;  4B5C A;  4X20 B;  3ON1 A;  4I55 A;  2GVI A;  3CYP B;  1ZWZ A;  1W3E X;  3HKD A;  3IR9 A;  4ZHQ B;  1X7O A;  4HNA A;  3ZO8 A;  4BVS A;  4YJ2 B;  3J7A R;  1JFF A;  4EI7 A;  4NWO B;  2Z01 A;  2ZOV A;  5JVD B;  1VQ9 F;  2QA4 F;  1K73 H;  2UYP A;  5FJ4 C;  1OAP A;  1VH8 A;  3VYS C;  4ZI7 B;  3CCS F;  4X3L A;  3K14 A;  3HKE B;  1VQN F;  3F0G A;  5LA6 B;  3QTY A;  3CYQ A;  3CCU F;  4U3J B;  1QD9 A;  2BTU A;  1VQV A;  5G4V C;  2UYK A;  5GON A;  5JCO A;  4BT3 A;  2HQS C;  4IIJ B;  3JAL A;  1Q82 H;  3VMF B;  3JAR A;  3WGM A;  5IT9 M;  2CSL A;  5CB4 B;  2RHJ A;  4DRX A;  1SZQ A;  4NUT A;  5FNV B;  4O4J A;  3FFM A;  1IV3 A;  2HP0 B;  3DDN A;  4C8G A;  2YYE A;  2VAW A;  3IEQ A;  3IEW A;  2AMT A;  3D01 A;  5HY4 A;  3S0W A;  2HVY D;  2HS0 A;  3RE3 A;  1YIJ F;  3TD3 A;  3ZP7 A;  1FNJ A;  3L7Q A;  5BMV B;  3JAS A;  1Q81 H;  5CA0 B;  1Q8R A;  1RQ7 A;  3F0D A;  4WBN B;  3RYI B;  5IJ0 A;  4I50 A;  3SIV A;  4LNU B;  1CN7 A;  2AIZ P;  2HS3 A;  3E22 A;  5MN6 A;  5IYZ B;  1W41 A;  3NK6 A;  5GAP K;  2HRU A;  2VAP A;  2HRY A;  2PHN A;  1UFY A;  2EWC A;  2I6D A;  4IHJ A;  1KC8 H;  3BYQ A;  4ZK7 A;  5IJ9 B;  2V9Y A;  4EB6 A;  5LP6 C;  3G4S F;  4B62 A;  1Q86 H;  3OBW A;  4TZZ A;  3KJK A;  2RB9 A;  4O2B B;  2ZVY A;  4BVR A;  2GLZ A;  3P4E A;  1K8A H;  2RHL A;  3N2K B;  3Q8H A;  4G88 A;  3RA6 A;  4X1K A;  1U43 A;  1VHA A;  2Z1E A;  1GX1 A;  2UYJ A;  3T80 A;  4C8E A;  1YHQ F;  4TUY A;  3CMA F;  2OTJ F;  2R75 1;  2UYN A;  1KD1 H;  3EOR A;  4ZOL B;  4RHA A;  2RHO A;  3QHD A;  3ESJ A;  5HY2 A;  3JAW A;  2IAF A;  1QU9 A;  1RLU A;  2VGM A;  3WPX A;  3LYB A;  2AIF A;  3WJQ A;  4E6E A;  3N4Z A;  3HKC B;  1SA0 A;  5HP7 A;  3QUW A;  4YJ3 A;  3RYF A;  2FGY A;  1W40 A;  4FFB B;  5EIB C;  1DBF A;  5JQG B;  4O4H A;  5LXT B;  5CA1 A;  3C9S A;  4X20 A;  2JNB A;  3N2G B;  5J2T B;  2OZB A;  3U0O A;  1W5E A;  4ZHQ A;  3KJJ A;  1Q7Y H;  2KGW A;  4O2A B;  1YGY A;  3RYH B;  1W57 A;  3IMP A;  3LDT A;  5JVD A;  3FD6 A;  2F9Z C;  3VO8 A;  4BW0 B;  2Q1Y A;  1YJN F;  1VQM F;  2VGN A;  1T0A A;  3V7E A;  3C9U A;  2ZOD A;  3HKE A;  5LA6 A;  3TD5 A;  4C8I A;  1NQ3 A;  1J7H A;  3CME F;  3F0F A;  3CD6 F;  5GIP C;  3D00 A;  5HY0 A;  1W5F A;  3PLA C;  1Z5V A;  3VTI C;  1TVK B;  1N8R H;  3I3F A;  3HKB B;  4O4L B;  1W59 A;  3LWR C;  5CB4 A;  1YI2 F;  3CB2 A;  1VQL F;  2CHS A;  4G4W A;  2KTV A;  1QAH A;  1VQP F;  4C82 A;  3CC7 F;  2QTP A;  3M84 A;  4O4I A;  3K12 A;  3S0Y A;  3ERN A;  5AVM A;  4X1Y B;  4EI9 A;  1X7P A;  4B45 A;  5J2U A;  1OFU A;  5HP8 A;  3NMU C;  5BMV A; 
#chains in the Genus database with same CATH homology
 2DYY A;  3I3F A;  4NWO B;  2B33 A;  3M4S A;  3VCZ A;  2UYJ A;  2CHT A;  2UYP A;  3R0P A;  2IG8 A;  3I7T A;  3MQW A;  2UYN A;  1UFY A;  2EWC A;  2CHS A;  3D01 A;  2OTM A;  1QU9 A;  1X25 A;  2CVL A;  4ZK7 A;  3LYB A;  1XHO A;  1QAH A;  3ZOP A;  1QD9 A;  1ODE A;  3ZP4 A;  1JD1 A;  1UI9 A;  3GTZ A;  1NQ3 A;  1J7H A;  5HP7 A;  1XRG A;  3KJK A;  3ZP7 A;  2UYK A;  3QUW A;  1FNJ A;  3K0T A;  3L7Q A;  3K12 A;  1COM A;  1ONI A;  3LME A;  1DBF A;  2CW4 A;  1FNK A;  3V4D A;  2CWJ A;  3M1X A;  3ZO8 A;  2CSL A;  2UYN B;  5HP8 A;  1PF5 A;  3KJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...