1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chorismate mutase
molecule keywords CHORISMATE MUTASE
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
3D01A 1NQ3A 1UI9A 1XHOA 1J7HA 2CVLA 2EWCA 1FNJA 3VCZA 1QAHA 3I3FA 2CHTA 1FNKA 3ZP4A 2CW4A 3V4DA 2UYNA 2CSLA 1UFYA 3ZOPA 1ODEA 2B33A 1JD1A 3M4SA 1PF5A 1DBFA 2UYPA 2CHSA 4NWOB 3ZP7A 3M1XA 1QD9A 2OTMA 5HP7A 1X25A 1QU9A 2DYYA 3KJKA 3LMEA 1COMA 3R0PA 2IG8A 3QUWA 1ONIA 3K12A 2CWJA 2UYNB 1XRGA 3MQWA 3I7TA 3LYBA 2UYKA 3KJJA 3L7QA 2UYJA 3GTZA 3ZO8A 3K0TA 5HP8A 4ZK7A
chains in the Genus database with same CATH superfamily
1UI9A 2HVYD 5GIPC 4TV8A 2VXYA 3V4DA 2IAFA 2YYEA 2HQSC 1K9MH 2H8CA 1K73H 4I4TA 3CPWF 1NJIH 4ZI7A 2BO1A 3CXCF 2UYNB 1XRGA 3I7TA 3JCMM 2KG4A 2JNBA 1NMUB 5J2UB 3TD4A 1YJWF 1ZWZA 4ZHWA 3FPIA 4ZOLA 1RQ7A 4NQ3A 4DXDA 4BT7A 3I56F 2R6R1 3JASA 1T0KB 4G4WA 2VGNA 5AVMA 1VQ9F 3ZOPA 1VQVA 5IJ9B 3J7AR 3F0FA 5GIOC 3HKEA 1XBIA 4EI8A 3CCRF 3G6EF 3NK6A 5KMGB 5ITZA 4ERHA 1TUBB 5BMVB 5KX5A 3JARA 2CWJA 1GO0A 4YJ3B 3IKEA 3N4YA 5EYPA 1S72F 2KTUA 1CN7A 4TUYB 3KJJA 1RLUA 4HNAB 2N48A 4C81A 5LYJB 4U3JB 3D01A 5C8YA 2Z1UA 3OONA 2EWCA 1IV4A 2AIZP 3S02A 2BTOA 2OTJF 3S06A 3RE3A 4U39A 4ZHQA 4BY9D 4G4VA 4HNAA 1W42A 4IIJB 2R751 5JVDB 4TV9B 3WGLA 2OTMA 4BT4A 1W55A 4BVSA 3CD6F 3M84A 1R1MA 1RQ2A 2Z1FA 4IIJA 2KGWA 2UYJA 4IHJB 5HY4A 3CCSF 4O4LA 4X1IB 1W3EX 5FNVA 1W59A 1VQ4F 5JQGA 2AMTA 3NK7A 4YJ3A 3CC7F 4I4TB 3LWOC 2ZVZA 1Q82H 4BT2A 4M8IA 5IYZB 3CCEF 5CA0A 3GHZA 1TVKA 5LXTB 3IMPA 3JATA 3ESJA 3J81M 1W5FA 5CA1B 4X3MA 3N2GA 1VQLF 5EO3A 1FFXA 3PAFA 1W57A 3V3TA 4E6EA 3NVKE 1IPAA 3JAWA 5J2TB 3E20B 1IV3A 4EB6B 5EB1B 2HRYA 4RQOA 4XCQA 4F6RA 1U43A 4C82A 4DRXA 4G4YA 5FNVB 1W2BF 5LP6A 2L26A 2FC3A 3RYHA 1PF5A 3P4EA 2MQEA 3C8LA 4EI9A 4C4WC 5IJ0A 1VQ8F 1IV1A 2HS0A 3LMEA 4YJ2A 4TV8B 3IKFA 3IEQA 3QHDA 1H7MA 1GX1A 3N2KA 3CMAF 2VAWA 3HKEB 1U3LA 4O4JA 1E7KA 1QVFF 3E22B 3WJRA 5GONB 4YJ2B 1TUBA 4ZI7B 1KNKA 3HWUA 4NUTA 2DT4A 2PMPA 5HWEA 3CC4F 1JD1A 5MN6A 2QTPA 5EIBD 3ZP7A 1Q86H 5GONA 1X25A 4O4LB 2WALA 3RA6A 2Z1TA 1COMA 4FFBB 3IEWA 1YGYA 1VH8A 4BT3A 5LP6B 1M90H 3TD3A 1XV2A 2HRUA 1JFFB 3VOAA 1FSZA 3P0ZA 1J7HA 5G4UC 3RYIA 1PXWA 1KD1H 4BVRA 1QAHA 1GZ0A 3JARB 5LXTA 1JFFA 5HY1A 3WPXA 2RB9A 3N2GB 4X1IA 3M1XA 4ZHVA 5C8YB 4X20B 5HY2A 3FD6A 3JAWB 5J2TA 1VQOF 3HKBB 3QUWA 1ONIA 2BTUA 3K12A 2RHJA 3C9SA 3HTNA 3CCJF 2Z01A 1Z5WA 3JALB 3GTZA 5HXUA 2FGYA 4G4ZA 3D54A 1NQ3A 2LBWA 4O2AB 2KTVA 2ZVYA 1N8RH 4BT6A 1H48A 2CHTA 4X1YB 5IJ0B 4RHAA 2RHOA 2HP0A 5LP6C 4EI7A 2UYPA 4R40B 3KE1A 3CYQA 3DC2A 2ZOVA 1VQPF 1YJNF 4X1YA 3U0OA 3WGMA 1OAPA 3J80M 3HAXD 5EIBC 5HXZA 5IT9M 3CCQF 3VYUC 2UYKA 3JASB 1KQSF 5JH7B 4LCKA 3T80A 5IJ9A 1Q81H 5GAPK 3OBYA 5FLXM 4BT5A 5ITZB 4LNUB 1UFYA 1FFXB 3CCUF 5FJ4C 2B33A 1W40A 3HKCB 3KHNA 4B62A 3VOBA 3Q8HA 1W41A 2I6RA 3GYQA 4O4JB 5EB0A 3R0PA 2IG8A 3G4SF 5IYZA 2QA4F 2HS4A 1VHAA 5CA0B 2IQQA 1YI2F 2UZHA 2GLZA 2HP3A 5HP8A 4ZHQB 5LOVB 3OBWA 3ERNA 4PWTA 3K14A 1RA4A 4G4XA 2LCAA 1CLIA 3BYQA 5EZYB 4KWEA 3VO8A 5KX5B 1VQKF 3N2KB 2G9IA 1K8AH 3ON1A 3RYCA 1YJ9F 3TD5A 3E22A 3KIZA 1QU9A 2DYYA 5MN4A 1VQ7F 3NVIB 3RYIB 4DRXB 2VAMA 5JQGB 2CZWA 2OHWA 2GZLA 4G88A 3SIVA 1W5EA 2H8EA 5EAZA 2NMUA 3LWQC 2HP0B 3K0TA 3LWVC 4TV9A 2YXZA 1W5AA 4O4HB 3LWRC 2H6LA 3EORA 5G4VC 2ALEA 2Q1YA 1QVGF 3I3FA 3ZP4A 1YHQF 3CCMF 5DCVA 4O2BB 1ODEA 3UT5A 3CG6A 2OTLF 2K1SA 3JALA 3LFOA 2VAPA 5HP7A 1QD9A 1W581 5JH7A 3C9UA 2ZAUA 3VTIC 2Q1XA 2ZODA 3DDNA 1RLGA 4EB6A 4B46A 3MQWA 3VIUA 2F9ZC 3MBMA 3WJQA 3JAMM 1SA0A 2VGMA 2PHNA 1U40A 2LBXA 3WGNA 3VMFB 3NMUC 4C8GA 1SDSA 3JATB 4TUYA 3C9TA 3RYFA 4C8IA 3FD5A 1Q8RA 4ZHYB 4BVTA 3D00A 2CHSA 1JY8A 4X1KA 3V7QA 1JJ2F 5B8FA 4I50B 4WBNB 4F6RB 1IV2A 5LA6A 1T0AA 5A2QM 3HJWC 4B5CA 4B45A 3WGJA 3VCZA 3LWPC 3CCLF 3WPWA 1M1KH 3SIUA 2CW4A 2RHLA 2UYNA 2CSLA 3WXMB 5GINC 1VQ5F 1U3PA 3M4SA 1YIJF 1X7PA 3S03A 4NWOB 4BVQA 1Z5VA 4U3JA 3RA5A 4LNUA 1VQNF 3QTYA 5JCOA 3LYBA 3WGKA 3L7QA 1OFUA 3ZO8A 1DT9A 3RYCB 2BTQB 2I6DA 3JAKB 1XHOA 4WBNA 1FNJA 3O85A 3WJPA 1X52A 4FFBA 3PLAC 1GO1A 5LA6B 1VK3A 3MCAB 5JCOC 2HS3A 3CMEF 5LOVA 5LYJA 3CYPB 3MDOA 4O4HA 3F0GA 3KJKA 2OZBA 2W8BC 3V7EA 2QI2A 4C8EA 4I55B 3VI6A 5CB4A 3B6NA 3HKCA 3HKDA 2V9YA 3S0HA 1SZQA 1H47A 3F6MA 3FFMA 2LBTA 1JN1A 3MCQA 4X1KB 1YQNA 5EYPB 3CCVF 3I55F 3HKDB 3IR9A 5HY0A 4I50A 2P6YA 1X7OA 2Z1EA 5CA1A 4IHJA 3CB2A 3CPQA 3CC2F 1KC8H 3N4ZA 4TZZA 3F0EA 5EZYA 4O4IA 5GANK 1VQMF 1CK2A 3K2XA 4O2AA 3C9RA 4BW0B 2HX0A 3RYFB 4O2BA 3P10A 3F0DA 5KMGA 5MN5A 1W5BA 5JVDA 4ZK7A 1TVKB 5BMVA 1YITF 1VQ6F 4I55A 5CB4B 2QEXF 4O4IB 3OW2F 2CVLA 2GVIA 1FNKA 2AIFA 3AGKA 3G71F 1SA0B 1DBFA 3S0YA 5EWRA 5J2UA 3E1YA 1KNJA 3FBAA 3LDTA 4ZOLB 3VYTC 2ZF8A 2RHHA 3JAKA 3UT5B 3ELCA 1Q7YH 3VYSC 3JVHA 4X3LA 4X20A 3RYHB 3HKBA 3S0WA
chains in the Genus database with same CATH topology
3D01A 1NQ3A 1UI9A 1XHOA 1J7HA 2CVLA 2EWCA 1FNJA 3VCZA 1QAHA 3I3FA 2CHTA 1FNKA 3ZP4A 2CW4A 3V4DA 2UYNA 2CSLA 1UFYA 3ZOPA 1ODEA 2B33A 1JD1A 3M4SA 1PF5A 1DBFA 2UYPA 2CHSA 4NWOB 3ZP7A 3M1XA 1QD9A 2OTMA 5HP7A 1X25A 1QU9A 2DYYA 3KJKA 3LMEA 1COMA 3R0PA 2IG8A 3QUWA 1ONIA 3K12A 2CWJA 2UYNB 1XRGA 3MQWA 3I7TA 3LYBA 2UYKA 3KJJA 3L7QA 2UYJA 3GTZA 3ZO8A 3K0TA 5HP8A 4ZK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D01 A;  1NQ3 A;  1UI9 A;  1XHO A;  1J7H A;  2CVL A;  2EWC A;  1FNJ A;  3VCZ A;  1QAH A;  3I3F A;  2CHT A;  1FNK A;  3ZP4 A;  2CW4 A;  3V4D A;  2UYN A;  2CSL A;  1UFY A;  3ZOP A;  1ODE A;  2B33 A;  1JD1 A;  3M4S A;  1PF5 A;  1DBF A;  2UYP A;  2CHS A;  4NWO B;  3ZP7 A;  3M1X A;  1QD9 A;  2OTM A;  5HP7 A;  1X25 A;  1QU9 A;  2DYY A;  3KJK A;  3LME A;  1COM A;  3R0P A;  2IG8 A;  3QUW A;  1ONI A;  3K12 A;  2CWJ A;  2UYN B;  1XRG A;  3MQW A;  3I7T A;  3LYB A;  2UYK A;  3KJJ A;  3L7Q A;  2UYJ A;  3GTZ A;  3ZO8 A;  3K0T A;  5HP8 A;  4ZK7 A; 
#chains in the Genus database with same CATH topology
 1UI9 A;  2HVY D;  5GIP C;  4TV8 A;  2VXY A;  3V4D A;  2IAF A;  2YYE A;  2HQS C;  1K9M H;  2H8C A;  1K73 H;  4I4T A;  3CPW F;  1NJI H;  4ZI7 A;  2BO1 A;  3CXC F;  2UYN B;  1XRG A;  3I7T A;  3JCM M;  2KG4 A;  2JNB A;  1NMU B;  5J2U B;  3TD4 A;  1YJW F;  1ZWZ A;  4ZHW A;  3FPI A;  4ZOL A;  1RQ7 A;  4NQ3 A;  4DXD A;  4BT7 A;  3I56 F;  2R6R 1;  3JAS A;  1T0K B;  4G4W A;  2VGN A;  5AVM A;  1VQ9 F;  3ZOP A;  1VQV A;  5IJ9 B;  3J7A R;  3F0F A;  5GIO C;  3HKE A;  1XBI A;  4EI8 A;  3CCR F;  3G6E F;  3NK6 A;  5KMG B;  5ITZ A;  4ERH A;  1TUB B;  5BMV B;  5KX5 A;  3JAR A;  2CWJ A;  1GO0 A;  4YJ3 B;  3IKE A;  3N4Y A;  5EYP A;  1S72 F;  2KTU A;  1CN7 A;  4TUY B;  3KJJ A;  1RLU A;  4HNA B;  2N48 A;  4C81 A;  5LYJ B;  4U3J B;  3D01 A;  5C8Y A;  2Z1U A;  3OON A;  2EWC A;  1IV4 A;  2AIZ P;  3S02 A;  2BTO A;  2OTJ F;  3S06 A;  3RE3 A;  4U39 A;  4ZHQ A;  4BY9 D;  4G4V A;  4HNA A;  1W42 A;  4IIJ B;  2R75 1;  5JVD B;  4TV9 B;  3WGL A;  2OTM A;  4BT4 A;  1W55 A;  4BVS A;  3CD6 F;  3M84 A;  1R1M A;  1RQ2 A;  2Z1F A;  4IIJ A;  2KGW A;  2UYJ A;  4IHJ B;  5HY4 A;  3CCS F;  4O4L A;  4X1I B;  1W3E X;  5FNV A;  1W59 A;  1VQ4 F;  5JQG A;  2AMT A;  3NK7 A;  4YJ3 A;  3CC7 F;  4I4T B;  3LWO C;  2ZVZ A;  1Q82 H;  4BT2 A;  4M8I A;  5IYZ B;  3CCE F;  5CA0 A;  3GHZ A;  1TVK A;  5LXT B;  3IMP A;  3JAT A;  3ESJ A;  3J81 M;  1W5F A;  5CA1 B;  4X3M A;  3N2G A;  1VQL F;  5EO3 A;  1FFX A;  3PAF A;  1W57 A;  3V3T A;  4E6E A;  3NVK E;  1IPA A;  3JAW A;  5J2T B;  3E20 B;  1IV3 A;  4EB6 B;  5EB1 B;  2HRY A;  4RQO A;  4XCQ A;  4F6R A;  1U43 A;  4C82 A;  4DRX A;  4G4Y A;  5FNV B;  1W2B F;  5LP6 A;  2L26 A;  2FC3 A;  3RYH A;  1PF5 A;  3P4E A;  2MQE A;  3C8L A;  4EI9 A;  4C4W C;  5IJ0 A;  1VQ8 F;  1IV1 A;  2HS0 A;  3LME A;  4YJ2 A;  4TV8 B;  3IKF A;  3IEQ A;  3QHD A;  1H7M A;  1GX1 A;  3N2K A;  3CMA F;  2VAW A;  3HKE B;  1U3L A;  4O4J A;  1E7K A;  1QVF F;  3E22 B;  3WJR A;  5GON B;  4YJ2 B;  1TUB A;  4ZI7 B;  1KNK A;  3HWU A;  4NUT A;  2DT4 A;  2PMP A;  5HWE A;  3CC4 F;  1JD1 A;  5MN6 A;  2QTP A;  5EIB D;  3ZP7 A;  1Q86 H;  5GON A;  1X25 A;  4O4L B;  2WAL A;  3RA6 A;  2Z1T A;  1COM A;  4FFB B;  3IEW A;  1YGY A;  1VH8 A;  4BT3 A;  5LP6 B;  1M90 H;  3TD3 A;  1XV2 A;  2HRU A;  1JFF B;  3VOA A;  1FSZ A;  3P0Z A;  1J7H A;  5G4U C;  3RYI A;  1PXW A;  1KD1 H;  4BVR A;  1QAH A;  1GZ0 A;  3JAR B;  5LXT A;  1JFF A;  5HY1 A;  3WPX A;  2RB9 A;  3N2G B;  4X1I A;  3M1X A;  4ZHV A;  5C8Y B;  4X20 B;  5HY2 A;  3FD6 A;  3JAW B;  5J2T A;  1VQO F;  3HKB B;  3QUW A;  1ONI A;  2BTU A;  3K12 A;  2RHJ A;  3C9S A;  3HTN A;  3CCJ F;  2Z01 A;  1Z5W A;  3JAL B;  3GTZ A;  5HXU A;  2FGY A;  4G4Z A;  3D54 A;  1NQ3 A;  2LBW A;  4O2A B;  2KTV A;  2ZVY A;  1N8R H;  4BT6 A;  1H48 A;  2CHT A;  4X1Y B;  5IJ0 B;  4RHA A;  2RHO A;  2HP0 A;  5LP6 C;  4EI7 A;  2UYP A;  4R40 B;  3KE1 A;  3CYQ A;  3DC2 A;  2ZOV A;  1VQP F;  1YJN F;  4X1Y A;  3U0O A;  3WGM A;  1OAP A;  3J80 M;  3HAX D;  5EIB C;  5HXZ A;  5IT9 M;  3CCQ F;  3VYU C;  2UYK A;  3JAS B;  1KQS F;  5JH7 B;  4LCK A;  3T80 A;  5IJ9 A;  1Q81 H;  5GAP K;  3OBY A;  5FLX M;  4BT5 A;  5ITZ B;  4LNU B;  1UFY A;  1FFX B;  3CCU F;  5FJ4 C;  2B33 A;  1W40 A;  3HKC B;  3KHN A;  4B62 A;  3VOB A;  3Q8H A;  1W41 A;  2I6R A;  3GYQ A;  4O4J B;  5EB0 A;  3R0P A;  2IG8 A;  3G4S F;  5IYZ A;  2QA4 F;  2HS4 A;  1VHA A;  5CA0 B;  2IQQ A;  1YI2 F;  2UZH A;  2GLZ A;  2HP3 A;  5HP8 A;  4ZHQ B;  5LOV B;  3OBW A;  3ERN A;  4PWT A;  3K14 A;  1RA4 A;  4G4X A;  2LCA A;  1CLI A;  3BYQ A;  5EZY B;  4KWE A;  3VO8 A;  5KX5 B;  1VQK F;  3N2K B;  2G9I A;  1K8A H;  3ON1 A;  3RYC A;  1YJ9 F;  3TD5 A;  3E22 A;  3KIZ A;  1QU9 A;  2DYY A;  5MN4 A;  1VQ7 F;  3NVI B;  3RYI B;  4DRX B;  2VAM A;  5JQG B;  2CZW A;  2OHW A;  2GZL A;  4G88 A;  3SIV A;  1W5E A;  2H8E A;  5EAZ A;  2NMU A;  3LWQ C;  2HP0 B;  3K0T A;  3LWV C;  4TV9 A;  2YXZ A;  1W5A A;  4O4H B;  3LWR C;  2H6L A;  3EOR A;  5G4V C;  2ALE A;  2Q1Y A;  1QVG F;  3I3F A;  3ZP4 A;  1YHQ F;  3CCM F;  5DCV A;  4O2B B;  1ODE A;  3UT5 A;  3CG6 A;  2OTL F;  2K1S A;  3JAL A;  3LFO A;  2VAP A;  5HP7 A;  1QD9 A;  1W58 1;  5JH7 A;  3C9U A;  2ZAU A;  3VTI C;  2Q1X A;  2ZOD A;  3DDN A;  1RLG A;  4EB6 A;  4B46 A;  3MQW A;  3VIU A;  2F9Z C;  3MBM A;  3WJQ A;  3JAM M;  1SA0 A;  2VGM A;  2PHN A;  1U40 A;  2LBX A;  3WGN A;  3VMF B;  3NMU C;  4C8G A;  1SDS A;  3JAT B;  4TUY A;  3C9T A;  3RYF A;  4C8I A;  3FD5 A;  1Q8R A;  4ZHY B;  4BVT A;  3D00 A;  2CHS A;  1JY8 A;  4X1K A;  3V7Q A;  1JJ2 F;  5B8F A;  4I50 B;  4WBN B;  4F6R B;  1IV2 A;  5LA6 A;  1T0A A;  5A2Q M;  3HJW C;  4B5C A;  4B45 A;  3WGJ A;  3VCZ A;  3LWP C;  3CCL F;  3WPW A;  1M1K H;  3SIU A;  2CW4 A;  2RHL A;  2UYN A;  2CSL A;  3WXM B;  5GIN C;  1VQ5 F;  1U3P A;  3M4S A;  1YIJ F;  1X7P A;  3S03 A;  4NWO B;  4BVQ A;  1Z5V A;  4U3J A;  3RA5 A;  4LNU A;  1VQN F;  3QTY A;  5JCO A;  3LYB A;  3WGK A;  3L7Q A;  1OFU A;  3ZO8 A;  1DT9 A;  3RYC B;  2BTQ B;  2I6D A;  3JAK B;  1XHO A;  4WBN A;  1FNJ A;  3O85 A;  3WJP A;  1X52 A;  4FFB A;  3PLA C;  1GO1 A;  5LA6 B;  1VK3 A;  3MCA B;  5JCO C;  2HS3 A;  3CME F;  5LOV A;  5LYJ A;  3CYP B;  3MDO A;  4O4H A;  3F0G A;  3KJK A;  2OZB A;  2W8B C;  3V7E A;  2QI2 A;  4C8E A;  4I55 B;  3VI6 A;  5CB4 A;  3B6N A;  3HKC A;  3HKD A;  2V9Y A;  3S0H A;  1SZQ A;  1H47 A;  3F6M A;  3FFM A;  2LBT A;  1JN1 A;  3MCQ A;  4X1K B;  1YQN A;  5EYP B;  3CCV F;  3I55 F;  3HKD B;  3IR9 A;  5HY0 A;  4I50 A;  2P6Y A;  1X7O A;  2Z1E A;  5CA1 A;  4IHJ A;  3CB2 A;  3CPQ A;  3CC2 F;  1KC8 H;  3N4Z A;  4TZZ A;  3F0E A;  5EZY A;  4O4I A;  5GAN K;  1VQM F;  1CK2 A;  3K2X A;  4O2A A;  3C9R A;  4BW0 B;  2HX0 A;  3RYF B;  4O2B A;  3P10 A;  3F0D A;  5KMG A;  5MN5 A;  1W5B A;  5JVD A;  4ZK7 A;  1TVK B;  5BMV A;  1YIT F;  1VQ6 F;  4I55 A;  5CB4 B;  2QEX F;  4O4I B;  3OW2 F;  2CVL A;  2GVI A;  1FNK A;  2AIF A;  3AGK A;  3G71 F;  1SA0 B;  1DBF A;  3S0Y A;  5EWR A;  5J2U A;  3E1Y A;  1KNJ A;  3FBA A;  3LDT A;  4ZOL B;  3VYT C;  2ZF8 A;  2RHH A;  3JAK A;  3UT5 B;  3ELC A;  1Q7Y H;  3VYS C;  3JVH A;  4X3L A;  4X20 A;  3RYH B;  3HKB A;  3S0W A; 
#chains in the Genus database with same CATH homology
 3D01 A;  1NQ3 A;  1UI9 A;  1XHO A;  1J7H A;  2CVL A;  2EWC A;  1FNJ A;  3VCZ A;  1QAH A;  3I3F A;  2CHT A;  1FNK A;  3ZP4 A;  2CW4 A;  3V4D A;  2UYN A;  2CSL A;  1UFY A;  3ZOP A;  1ODE A;  2B33 A;  1JD1 A;  3M4S A;  1PF5 A;  1DBF A;  2UYP A;  2CHS A;  4NWO B;  3ZP7 A;  3M1X A;  1QD9 A;  2OTM A;  5HP7 A;  1X25 A;  1QU9 A;  2DYY A;  3KJK A;  3LME A;  1COM A;  3R0P A;  2IG8 A;  3QUW A;  1ONI A;  3K12 A;  2CWJ A;  2UYN B;  1XRG A;  3MQW A;  3I7T A;  3LYB A;  2UYK A;  3KJJ A;  3L7Q A;  2UYJ A;  3GTZ A;  3ZO8 A;  3K0T A;  5HP8 A;  4ZK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...