1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chorismate mutase
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
2UYPA 2CHTA 1ODEA 3LMEA 1FNKA 1QAHA 3KJJA 3R0PA 3GTZA 5HP8A 1XHOA 3ZP7A 2CW4A 1NQ3A 3K12A 3QUWA 3LYBA 5HP7A 1QU9A 3M1XA 4ZK7A 1XRGA 2CWJA 2EWCA 3VCZA 3I7TA 2CSLA 3L7QA 3V4DA 1FNJA 3ZP4A 1COMA 1DBFA 2UYKA 1PF5A 3M4SA 3D01A 3MQWA 4NWOB 3ZOPA 2CVLA 1J7HA 2CHSA 2OTMA 1UI9A 2UYJA 3K0TA 1JD1A 1ONIA 1UFYA 1X25A 1QD9A 2IG8A 3KJKA 2UYNA 2UYNB 3I3FA 2DYYA 3ZO8A 2B33A
chains in the Genus database with same CATH superfamily
5J2TA 1QVFF 3SIUA 3NVIB 3RYFA 1U40A 3P10A 4TV8A 5MN6A 1GO0A 4YJ2A 5HP7A 3J80M 4O4LA 2H8CA 2HQSC 3ON1A 2KTVA 4C8GA 5JQGB 4X3LA 1VQ7F 4I55A 3JVHA 2ALEA 3JASA 5EAZA 1H48A 5LYJA 1TVKB 3FD6A 1TUBB 3C9TA 5LP6A 4BT5A 3CD6F 3TD3A 2BTQB 2VGMA 4EI8A 1QAHA 5FNVA 1YQNA 2UZHA 3KJJA 4TUYB 2G9IA 3RYHB 5LOVA 3OW2F 3NVKE 2RHLA 3GHZA 1SDSA 4ZHYB 5EB0A 3N2KB 3JALA 4ZI7B 3E22B 4TZZA 4BVTA 3NK6A 3UT5A 3ZOPA 3ELCA 4LNUB 1W5BA 1JD1A 1X25A 4BT2A 1VH8A 2OHWA 3I3FA 1IV1A 4FFBA 3LWRC 3G6EF 3D54A 2Q1XA 3HKBA 1YHQF 4I50A 3S06A 2CZWA 1DT9A 3ERNA 3M1XA 4U3JB 3FPIA 2OTJF 5EZYB 1E7KA 3I55F 3CG6A 1Q8RA 1H47A 1NJIH 3HKCA 1K9MH 3C8LA 1W5FA 2HRYA 3JAWA 3JATB 3JAKB 4C4WC 2ZODA 1IV4A 1JFFB 4X1KA 1RQ7A 3C9SA 2N48A 1SA0A 1FNKA 2PMPA 1OAPA 2W8BC 3RYFB 3CCLF 1N8RH 2RB9A 3CCSF 3QUWA 3K12A 3LWOC 1QU9A 4C8IA 1SZQA 3CCRF 3S0WA 3U0OA 2BTUA 4I55B 3D01A 1W5EA 4HNAB 3N4ZA 5A2QM 2UYJA 1QD9A 1IV2A 3M84A 2HVYD 3RE3A 3CYQA 2UYPA 3LWQC 2FC3A 2KG4A 2BTOA 3VTIC 5FNVB 2Z1FA 3LDTA 5LOVB 2VAWA 4G4VA 1K8AH 2QTPA 4G4XA 5ITZA 3RYCB 4C82A 5IYZA 1IV3A 3AGKA 1YJWF 5EO3A 2R751 3RYIB 1U43A 3JALB 1M1KH 4DRXA 2OZBA 4G88A 1R1MA 3WXMB 1FFXA 2H8EA 5CA0A 5GIOC 4B46A 3ESJA 1Q86H 3CCJF 1UFYA 5HY1A 4IHJA 2UYNA 2HS3A 3OBWA 3VOBA 1YIJF 1W55A 3HAXD 4BT3A 2LBTA 1W581 3HKBB 2VGNA 5EYPB 5LA6B 3RA6A 1Z5WA 1U3PA 3BYQA 4I50B 4BVQA 3LWPC 2QI2A 2VAMA 4O4HA 3JARA 3VYUC 5MN4A 3VIUA 1T0KB 5AVMA 3VI6A 3HKDB 1VQVA 3F0FA 4XCQA 2UYKA 3P0ZA 3J81M 3G71F 1KQSF 1YI2F 1W42A 3D00A 5IJ9A 5HY0A 1W41A 3JAWB 4IIJA 2F9ZC 5C8YA 4I4TA 3WGKA 4X1KB 4B45A 4NQ3A 1GZ0A 5FLXM 5IJ0A 5JH7A 1KD1H 3MDOA 4C8EA 5B8FA 3LYBA 1VQ6F 2P6YA 2PHNA 1IPAA 2KTUA 2CSLA 1VHAA 3GYQA 4R40B 3M4SA 3IKFA 2IQQA 2ZF8A 5JCOA 1VQ4F 4RQOA 4BT7A 3HKEA 4F6RB 4O2BA 3T80A 1YJ9F 2V9YA 3LMEA 2ZAUA 1X7PA 3R0PA 5HXZA 3WJQA 3JAMM 4B5CA 3MCAB 5KMGA 2LBWA 3S0HA 3WPWA 3N4YA 5GONA 1JJ2F 4EI9A 5G4UC 2KGWA 3CPQA 4DRXB 5J2UA 5CA1B 5LXTA 3CMEF 3V4DA 1FNJA 5JVDA 4ZHWA 3CCEF 1FFXB 4YJ3B 4O4JB 5CB4A 3OONA 1PF5A 2Z01A 3TD5A 1J7HA 1VQLF 3KHNA 3KJKA 1W57A 2JNBA 4G4ZA 4IHJB 1ZWZA 3CC2F 5DCVA 3I56F 5J2TB 5GAPK 1GX1A 3V3TA 4ERHA 2K1SA 3CC4F 2VXYA 3QTYA 2GVIA 4TV8B 2I6DA 3CCMF 1VQ5F 1CN7A 4X1YA 4YJ2B 5EIBC 4O4LB 4O4HB 3VMFB 3F6MA 3I7TA 4X3MA 3S02A 1GO1A 2Z1EA 5JQGA 3CXCF 1ONIA 3JASB 1XBIA 1TVKA 5LYJB 1TUBA 2AIZP 3SIVA 3Q8HA 5LP6B 2MQEA 4RHAA 5IJ0B 4TUYA 3JCMM 4O2AA 3RYHA 3CCQF 1VQOF 5HXUA 5KX5A 4E6EA 2Z1TA 5EIBD 2OTLF 2QEXF 3E1YA 1W59A 2ZVYA 3N2KA 3WJPA 4ZI7A 3G4SF 3E22A 1W3EX 3UT5B 1YGYA 3C9RA 2HS4A 3N2GA 1VQMF 4LNUA 1OFUA 3IEQA 3F0DA 2ZOVA 4B62A 4ZHVA 4FFBB 2H6LA 2L26A 3EORA 4KWEA 4EB6A 4WBNA 4ZHQA 3S0YA 3C9UA 4TV9A 1FSZA 3ZP7A 1XHOA 3IEWA 3PAFA 1Q81H 2Q1YA 3DDNA 2EWCA 5J2UB 5EZYA 3L7QA 1VQPF 3QHDA 4M8IA 5EB1B 4C81A 4NWOB 3KIZA 5IT9M 3HWUA 3HKCB 2NMUA 3S03A 2IG8A 1W40A 3JATA 1K73H 3LWVC 3CCVF 1XV2A 1VQNF 2WALA 3NMUC 2YXZA 1SA0B 1VK3A 4ZOLA 2CW4A 4X20A 5HY4A 3O85A 3HJWC 5GIPC 1NQ3A 4X1YB 1QVGF 3WGNA 4BVSA 2CWJA 3VCZA 3HTNA 2AMTA 5FJ4C 2RHOA 3OBYA 4U39A 2LCAA 1YITF 3PLAC 3J7AR 4HNAA 1W2BF 2CVLA 3TD4A 5BMVA 1KC8H 1VQ9F 4O4IA 1M90H 2HX0A 1CLIA 1RLGA 4DXDA 3ZO8A 1ODEA 4X1IA 4O2AB 3VO8A 1CK2A 3GTZA 5KX5B 3RA5A 3RYCA 5ITZB 3DC2A 5IYZB 2HP0A 4BVRA 2RHJA 1PXWA 3RYIA 4ZK7A 1XRGA 1JY8A 3CCUF 3F0GA 3FD5A 2R6R1 5CA0B 2AIFA 3NK7A 4BY9D 3N2GB 3K2XA 3MBMA 4BT4A 3VOAA 2UYNB 2RHHA 2VAPA 5GANK 4WBNB 4EB6B 4NUTA 2B33A 2CHTA 4ZHQB 3MCQA 4TV9B 3IMPA 3WPXA 3CB2A 5EYPA 5LA6A 2FGYA 1NMUB 5HWEA 3IR9A 3WGLA 5GINC 3WJRA 3FFMA 3JARB 4EI7A 1X52A 1T0AA 2BO1A 3HKDA 1COMA 1YJNF 1DBFA 2HP3A 1JN1A 2DT4A 5LP6C 2CHSA 2HRUA 2OTMA 5IJ9B 1UI9A 3K0TA 3F0EA 4IIJB 3CMAF 4G4YA 5C8YB 4I4TB 5G4VC 3VYTC 1RLUA 2LBXA 3CYPB 1RA4A 5JH7B 1KNKA 3V7QA 2GLZA 4ZOLB 4X20B 5HP8A 2YYEA 3B6NA 5JCOC 3KE1A 3WGJA 5EWRA 1VQ8F 3FBAA 1Z5VA 1U3LA 1H7MA 5MN5A 1Q82H 2IAFA 5BMVB 4O4IB 4F6RA 3HKEB 4O2BB 3IKEA 1W5AA 3E20B 1RQ2A 4X1IB 1Q7YH 4G4WA 2HS0A 3K14A 4PWTA 4BW0B 3P4EA 3VYSC 2HP0B 3CC7F 5KMGB 4BT6A 1KNJA 3WGMA 5GONB 5HY2A 4U3JA 5CA1A 1VQKF 1X7OA 2I6RA 5LXTB 3ZP4A 5JVDB 4YJ3A 4O4JA 3V7EA 2Z1UA 5CB4B 3MQWA 3LFOA 4LCKA 1S72F 3CPWF 2GZLA 2ZVZA 2QA4F 3JAKA 1JFFA 2DYYA
chains in the Genus database with same CATH topology
2UYPA 2CHTA 1ODEA 3LMEA 1FNKA 1QAHA 3KJJA 3R0PA 3GTZA 5HP8A 1XHOA 3ZP7A 2CW4A 1NQ3A 3K12A 3QUWA 3LYBA 5HP7A 1QU9A 3M1XA 4ZK7A 1XRGA 2CWJA 2EWCA 3VCZA 3I7TA 2CSLA 3L7QA 3V4DA 1FNJA 3ZP4A 1COMA 1DBFA 2UYKA 1PF5A 3M4SA 3D01A 3MQWA 4NWOB 3ZOPA 2CVLA 1J7HA 2CHSA 2OTMA 1UI9A 2UYJA 3K0TA 1JD1A 1ONIA 1UFYA 1X25A 1QD9A 2IG8A 3KJKA 2UYNA 2UYNB 3I3FA 2DYYA 3ZO8A 2B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYP A;  2CHT A;  1ODE A;  3LME A;  1FNK A;  1QAH A;  3KJJ A;  3R0P A;  3GTZ A;  5HP8 A;  1XHO A;  3ZP7 A;  2CW4 A;  1NQ3 A;  3K12 A;  3QUW A;  3LYB A;  5HP7 A;  1QU9 A;  3M1X A;  4ZK7 A;  1XRG A;  2CWJ A;  2EWC A;  3VCZ A;  3I7T A;  2CSL A;  3L7Q A;  3V4D A;  1FNJ A;  3ZP4 A;  1COM A;  1DBF A;  2UYK A;  1PF5 A;  3M4S A;  3D01 A;  3MQW A;  4NWO B;  3ZOP A;  2CVL A;  1J7H A;  2CHS A;  2OTM A;  1UI9 A;  2UYJ A;  3K0T A;  1JD1 A;  1ONI A;  1UFY A;  1X25 A;  1QD9 A;  2IG8 A;  3KJK A;  2UYN A;  2UYN B;  3I3F A;  2DYY A;  3ZO8 A;  2B33 A; 
#chains in the Genus database with same CATH topology
 5J2T A;  1QVF F;  3SIU A;  3NVI B;  3RYF A;  1U40 A;  3P10 A;  4TV8 A;  5MN6 A;  1GO0 A;  4YJ2 A;  5HP7 A;  3J80 M;  4O4L A;  2H8C A;  2HQS C;  3ON1 A;  2KTV A;  4C8G A;  5JQG B;  4X3L A;  1VQ7 F;  4I55 A;  3JVH A;  2ALE A;  3JAS A;  5EAZ A;  1H48 A;  5LYJ A;  1TVK B;  3FD6 A;  1TUB B;  3C9T A;  5LP6 A;  4BT5 A;  3CD6 F;  3TD3 A;  2BTQ B;  2VGM A;  4EI8 A;  1QAH A;  5FNV A;  1YQN A;  2UZH A;  3KJJ A;  4TUY B;  2G9I A;  3RYH B;  5LOV A;  3OW2 F;  3NVK E;  2RHL A;  3GHZ A;  1SDS A;  4ZHY B;  5EB0 A;  3N2K B;  3JAL A;  4ZI7 B;  3E22 B;  4TZZ A;  4BVT A;  3NK6 A;  3UT5 A;  3ZOP A;  3ELC A;  4LNU B;  1W5B A;  1JD1 A;  1X25 A;  4BT2 A;  1VH8 A;  2OHW A;  3I3F A;  1IV1 A;  4FFB A;  3LWR C;  3G6E F;  3D54 A;  2Q1X A;  3HKB A;  1YHQ F;  4I50 A;  3S06 A;  2CZW A;  1DT9 A;  3ERN A;  3M1X A;  4U3J B;  3FPI A;  2OTJ F;  5EZY B;  1E7K A;  3I55 F;  3CG6 A;  1Q8R A;  1H47 A;  1NJI H;  3HKC A;  1K9M H;  3C8L A;  1W5F A;  2HRY A;  3JAW A;  3JAT B;  3JAK B;  4C4W C;  2ZOD A;  1IV4 A;  1JFF B;  4X1K A;  1RQ7 A;  3C9S A;  2N48 A;  1SA0 A;  1FNK A;  2PMP A;  1OAP A;  2W8B C;  3RYF B;  3CCL F;  1N8R H;  2RB9 A;  3CCS F;  3QUW A;  3K12 A;  3LWO C;  1QU9 A;  4C8I A;  1SZQ A;  3CCR F;  3S0W A;  3U0O A;  2BTU A;  4I55 B;  3D01 A;  1W5E A;  4HNA B;  3N4Z A;  5A2Q M;  2UYJ A;  1QD9 A;  1IV2 A;  3M84 A;  2HVY D;  3RE3 A;  3CYQ A;  2UYP A;  3LWQ C;  2FC3 A;  2KG4 A;  2BTO A;  3VTI C;  5FNV B;  2Z1F A;  3LDT A;  5LOV B;  2VAW A;  4G4V A;  1K8A H;  2QTP A;  4G4X A;  5ITZ A;  3RYC B;  4C82 A;  5IYZ A;  1IV3 A;  3AGK A;  1YJW F;  5EO3 A;  2R75 1;  3RYI B;  1U43 A;  3JAL B;  1M1K H;  4DRX A;  2OZB A;  4G88 A;  1R1M A;  3WXM B;  1FFX A;  2H8E A;  5CA0 A;  5GIO C;  4B46 A;  3ESJ A;  1Q86 H;  3CCJ F;  1UFY A;  5HY1 A;  4IHJ A;  2UYN A;  2HS3 A;  3OBW A;  3VOB A;  1YIJ F;  1W55 A;  3HAX D;  4BT3 A;  2LBT A;  1W58 1;  3HKB B;  2VGN A;  5EYP B;  5LA6 B;  3RA6 A;  1Z5W A;  1U3P A;  3BYQ A;  4I50 B;  4BVQ A;  3LWP C;  2QI2 A;  2VAM A;  4O4H A;  3JAR A;  3VYU C;  5MN4 A;  3VIU A;  1T0K B;  5AVM A;  3VI6 A;  3HKD B;  1VQV A;  3F0F A;  4XCQ A;  2UYK A;  3P0Z A;  3J81 M;  3G71 F;  1KQS F;  1YI2 F;  1W42 A;  3D00 A;  5IJ9 A;  5HY0 A;  1W41 A;  3JAW B;  4IIJ A;  2F9Z C;  5C8Y A;  4I4T A;  3WGK A;  4X1K B;  4B45 A;  4NQ3 A;  1GZ0 A;  5FLX M;  5IJ0 A;  5JH7 A;  1KD1 H;  3MDO A;  4C8E A;  5B8F A;  3LYB A;  1VQ6 F;  2P6Y A;  2PHN A;  1IPA A;  2KTU A;  2CSL A;  1VHA A;  3GYQ A;  4R40 B;  3M4S A;  3IKF A;  2IQQ A;  2ZF8 A;  5JCO A;  1VQ4 F;  4RQO A;  4BT7 A;  3HKE A;  4F6R B;  4O2B A;  3T80 A;  1YJ9 F;  2V9Y A;  3LME A;  2ZAU A;  1X7P A;  3R0P A;  5HXZ A;  3WJQ A;  3JAM M;  4B5C A;  3MCA B;  5KMG A;  2LBW A;  3S0H A;  3WPW A;  3N4Y A;  5GON A;  1JJ2 F;  4EI9 A;  5G4U C;  2KGW A;  3CPQ A;  4DRX B;  5J2U A;  5CA1 B;  5LXT A;  3CME F;  3V4D A;  1FNJ A;  5JVD A;  4ZHW A;  3CCE F;  1FFX B;  4YJ3 B;  4O4J B;  5CB4 A;  3OON A;  1PF5 A;  2Z01 A;  3TD5 A;  1J7H A;  1VQL F;  3KHN A;  3KJK A;  1W57 A;  2JNB A;  4G4Z A;  4IHJ B;  1ZWZ A;  3CC2 F;  5DCV A;  3I56 F;  5J2T B;  5GAP K;  1GX1 A;  3V3T A;  4ERH A;  2K1S A;  3CC4 F;  2VXY A;  3QTY A;  2GVI A;  4TV8 B;  2I6D A;  3CCM F;  1VQ5 F;  1CN7 A;  4X1Y A;  4YJ2 B;  5EIB C;  4O4L B;  4O4H B;  3VMF B;  3F6M A;  3I7T A;  4X3M A;  3S02 A;  1GO1 A;  2Z1E A;  5JQG A;  3CXC F;  1ONI A;  3JAS B;  1XBI A;  1TVK A;  5LYJ B;  1TUB A;  2AIZ P;  3SIV A;  3Q8H A;  5LP6 B;  2MQE A;  4RHA A;  5IJ0 B;  4TUY A;  3JCM M;  4O2A A;  3RYH A;  3CCQ F;  1VQO F;  5HXU A;  5KX5 A;  4E6E A;  2Z1T A;  5EIB D;  2OTL F;  2QEX F;  3E1Y A;  1W59 A;  2ZVY A;  3N2K A;  3WJP A;  4ZI7 A;  3G4S F;  3E22 A;  1W3E X;  3UT5 B;  1YGY A;  3C9R A;  2HS4 A;  3N2G A;  1VQM F;  4LNU A;  1OFU A;  3IEQ A;  3F0D A;  2ZOV A;  4B62 A;  4ZHV A;  4FFB B;  2H6L A;  2L26 A;  3EOR A;  4KWE A;  4EB6 A;  4WBN A;  4ZHQ A;  3S0Y A;  3C9U A;  4TV9 A;  1FSZ A;  3ZP7 A;  1XHO A;  3IEW A;  3PAF A;  1Q81 H;  2Q1Y A;  3DDN A;  2EWC A;  5J2U B;  5EZY A;  3L7Q A;  1VQP F;  3QHD A;  4M8I A;  5EB1 B;  4C81 A;  4NWO B;  3KIZ A;  5IT9 M;  3HWU A;  3HKC B;  2NMU A;  3S03 A;  2IG8 A;  1W40 A;  3JAT A;  1K73 H;  3LWV C;  3CCV F;  1XV2 A;  1VQN F;  2WAL A;  3NMU C;  2YXZ A;  1SA0 B;  1VK3 A;  4ZOL A;  2CW4 A;  4X20 A;  5HY4 A;  3O85 A;  3HJW C;  5GIP C;  1NQ3 A;  4X1Y B;  1QVG F;  3WGN A;  4BVS A;  2CWJ A;  3VCZ A;  3HTN A;  2AMT A;  5FJ4 C;  2RHO A;  3OBY A;  4U39 A;  2LCA A;  1YIT F;  3PLA C;  3J7A R;  4HNA A;  1W2B F;  2CVL A;  3TD4 A;  5BMV A;  1KC8 H;  1VQ9 F;  4O4I A;  1M90 H;  2HX0 A;  1CLI A;  1RLG A;  4DXD A;  3ZO8 A;  1ODE A;  4X1I A;  4O2A B;  3VO8 A;  1CK2 A;  3GTZ A;  5KX5 B;  3RA5 A;  3RYC A;  5ITZ B;  3DC2 A;  5IYZ B;  2HP0 A;  4BVR A;  2RHJ A;  1PXW A;  3RYI A;  4ZK7 A;  1XRG A;  1JY8 A;  3CCU F;  3F0G A;  3FD5 A;  2R6R 1;  5CA0 B;  2AIF A;  3NK7 A;  4BY9 D;  3N2G B;  3K2X A;  3MBM A;  4BT4 A;  3VOA A;  2UYN B;  2RHH A;  2VAP A;  5GAN K;  4WBN B;  4EB6 B;  4NUT A;  2B33 A;  2CHT A;  4ZHQ B;  3MCQ A;  4TV9 B;  3IMP A;  3WPX A;  3CB2 A;  5EYP A;  5LA6 A;  2FGY A;  1NMU B;  5HWE A;  3IR9 A;  3WGL A;  5GIN C;  3WJR A;  3FFM A;  3JAR B;  4EI7 A;  1X52 A;  1T0A A;  2BO1 A;  3HKD A;  1COM A;  1YJN F;  1DBF A;  2HP3 A;  1JN1 A;  2DT4 A;  5LP6 C;  2CHS A;  2HRU A;  2OTM A;  5IJ9 B;  1UI9 A;  3K0T A;  3F0E A;  4IIJ B;  3CMA F;  4G4Y A;  5C8Y B;  4I4T B;  5G4V C;  3VYT C;  1RLU A;  2LBX A;  3CYP B;  1RA4 A;  5JH7 B;  1KNK A;  3V7Q A;  2GLZ A;  4ZOL B;  4X20 B;  5HP8 A;  2YYE A;  3B6N A;  5JCO C;  3KE1 A;  3WGJ A;  5EWR A;  1VQ8 F;  3FBA A;  1Z5V A;  1U3L A;  1H7M A;  5MN5 A;  1Q82 H;  2IAF A;  5BMV B;  4O4I B;  4F6R A;  3HKE B;  4O2B B;  3IKE A;  1W5A A;  3E20 B;  1RQ2 A;  4X1I B;  1Q7Y H;  4G4W A;  2HS0 A;  3K14 A;  4PWT A;  4BW0 B;  3P4E A;  3VYS C;  2HP0 B;  3CC7 F;  5KMG B;  4BT6 A;  1KNJ A;  3WGM A;  5GON B;  5HY2 A;  4U3J A;  5CA1 A;  1VQK F;  1X7O A;  2I6R A;  5LXT B;  3ZP4 A;  5JVD B;  4YJ3 A;  4O4J A;  3V7E A;  2Z1U A;  5CB4 B;  3MQW A;  3LFO A;  4LCK A;  1S72 F;  3CPW F;  2GZL A;  2ZVZ A;  2QA4 F;  3JAK A;  1JFF A;  2DYY A; 
#chains in the Genus database with same CATH homology
 2UYP A;  2CHT A;  1ODE A;  3LME A;  1FNK A;  1QAH A;  3KJJ A;  3R0P A;  3GTZ A;  5HP8 A;  1XHO A;  3ZP7 A;  2CW4 A;  1NQ3 A;  3K12 A;  3QUW A;  3LYB A;  5HP7 A;  1QU9 A;  3M1X A;  4ZK7 A;  1XRG A;  2CWJ A;  2EWC A;  3VCZ A;  3I7T A;  2CSL A;  3L7Q A;  3V4D A;  1FNJ A;  3ZP4 A;  1COM A;  1DBF A;  2UYK A;  1PF5 A;  3M4S A;  3D01 A;  3MQW A;  4NWO B;  3ZOP A;  2CVL A;  1J7H A;  2CHS A;  2OTM A;  1UI9 A;  2UYJ A;  3K0T A;  1JD1 A;  1ONI A;  1UFY A;  1X25 A;  1QD9 A;  2IG8 A;  3KJK A;  2UYN A;  2UYN B;  3I3F A;  2DYY A;  3ZO8 A;  2B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...