1COMA

The monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
molecule tags Chorismate mutase
source organism Bacillus subtilis
publication title The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1comA00
2EWCA 2IG8A 1XHOA 1ONIA 1COMA 2UYNB 1JD1A 3M4SA 3R0PA 4NWOB 3I3FA 2CSLA 2UYJA 3V4DA 5HP7A 3D01A 3VCZA 3ZO8A 2CHSA 3GTZA 3K12A 1NQ3A 1XRGA 3I7TA 1FNJA 3ZOPA 3LMEA 3L7QA 3ZP7A 1J7HA 1QU9A 2DYYA 1PF5A 1QAHA 1X25A 3QUWA 3M1XA 2UYNA 2CWJA 2UYPA 3LYBA 1ODEA 3K0TA 1DBFA 2CVLA 2CW4A 5HP8A 1UFYA 2UYKA 4ZK7A 1QD9A 2B33A 3ZP4A 3KJKA 2OTMA 3MQWA 3KJJA 2CHTA 1UI9A 1FNKA
chains in the Genus database with same CATH superfamily
5AVMA 2G9IA 1COMA 1RLGA 3HJWC 3F0DA 3HKEA 1VK3A 2UYJA 2W8BC 2UZHA 1TUBA 3RYIB 4R40B 3E20B 3J80M 3SIUA 1QVFF 3I7TA 1W42A 3MCAB 1PF5A 3FD5A 3CPWF 2P6YA 3FBAA 2RHOA 3C9TA 2N48A 3KE1A 3KIZA 4X20B 5LXTB 4EI8A 2RB9A 2FC3A 5FNVA 3CXCF 4O4LB 2H8EA 5EB0A 5JCOA 2EWCA 2WALA 2OTJF 3RYHB 5JQGA 3HAXD 4C8IA 2ZAUA 1T0KB 2LBXA 5LA6B 3L7QA 1VQVA 2V9YA 1OAPA 3P0ZA 5LP6C 3U0OA 4B46A 5KMGA 3WGJA 3CD6F 1ODEA 1OFUA 5CB4B 3K0TA 1DBFA 3JATB 3JCMM 3VOBA 3WJPA 3QTYA 1RQ7A 1H47A 1TVKA 5IT9M 1YJWF 4YJ3B 3VYSC 5CA1A 4F6RB 1GZ0A 2YXZA 1GX1A 4X1YA 5HY1A 5ITZB 2LBTA 2RHJA 4BVRA 5EIBC 1XRGA 4TZZA 3LDTA 2VXYA 3LMEA 3ZOPA 3NVIB 1QAHA 1U3LA 2VGMA 2ZVYA 4G4XA 4M8IA 2R6R1 5CA0B 2L26A 3VI6A 1VQ7F 4BVSA 2BTQB 2VAMA 3C9SA 3KJKA 3G71F 4I55B 3JAWB 3NVKE 4X20A 5B8FA 1YQNA 1IV1A 5HWEA 1Q82H 3VYTC 3LWPC 3F6MA 1SZQA 1VQ4F 4O4IA 1SDSA 3GTZA 3V3TA 5JVDA 3S0YA 4IIJA 4C82A 4EB6A 1QU9A 5J2TB 3OBYA 1DT9A 3HKBB 1E7KA 3GYQA 2CVLA 4ERHA 1SA0A 5LA6A 1NJIH 3SIVA 5IYZB 3KHNA 1FSZA 4FFBA 3JALA 3WJQA 3WGMA 2R751 3I3FA 3JAMM 5HP7A 2K1SA 4O4JA 5CA1B 4BVTA 4TUYA 4EI7A 1KQSF 3LWRC 2AMTA 2DYYA 3T80A 4X1KB 5LXTA 1M90H 3CCLF 1W59A 1KC8H 2KTVA 3EORA 4YJ2A 4DRXB 4O4LA 4BT6A 5C8YB 4U3JB 3MCQA 4ZHQB 4I4TB 5J2UB 1VQ5F 3CCRF 4ZI7A 3CC7F 3V7EA 1YGYA 1W5EA 4X3MA 1H48A 3IKFA 3S0HA 3UT5B 5MN4A 3D01A 5BMVB 1GO0A 4X1IA 2VAWA 1IV2A 4LNUB 5LP6B 3NK7A 4ZHYB 2Q1XA 5JVDB 3E1YA 3LWVC 5LYJA 1YJ9F 4RHAA 3IMPA 3HWUA 2HVYD 2YYEA 3BYQA 3N2GB 1VQKF 3M1XA 4E6EA 5GONB 5ITZA 1X7PA 3JARB 3V4DA 3WXMB 5KX5B 3OW2F 1TUBB 2OTLF 1KNJA 5HY2A 3RYIA 2LCAA 3CCJF 5MN6A 3JASA 3CCVF 5IJ0A 4FFBB 3N2KB 5HXUA 2QA4F 5CA0A 4BY9D 2OHWA 2UYPA 3VTIC 1IPAA 5GAPK 3RYFB 1UFYA 4NQ3A 1W57A 5JH7A 1T0AA 4BVQA 4I50A 3ZP4A 2ZF8A 1XHOA 2CHTA 2Z1UA 1YI2F 4KWEA 2HP0A 3N4YA 2ZOVA 5EO3A 1XBIA 2Z1FA 1VH8A 1GO1A 1KD1H 2KTUA 3HKDB 4ZHQA 3FPIA 4I4TA 3OONA 3S06A 3CMEF 3RA5A 3I55F 4O2AA 3ZP7A 3K2XA 3PLAC 5DCVA 1SA0B 2UYNA 3C9UA 1VHAA 5HY0A 4C8EA 5BMVA 1QD9A 3O85A 4WBNA 1W5BA 2RHLA 1Z5VA 3JALB 3M84A 2CZWA 3TD4A 1IV4A 1Q7YH 5FJ4C 3VMFB 3J7AR 4DXDA 3VIUA 3CMAF 1JD1A 3M4SA 5LOVA 1RQ2A 3VCZA 3N2GA 4B45A 2HRUA 5G4UC 5FLXM 5GONA 1VQOF 1X7OA 3CPQA 3FD6A 4G4VA 2GZLA 4C81A 3AGKA 4ZOLA 4C4WC 3HKEB 3ERNA 5HY4A 5IJ0B 2PMPA 3G4SF 3S03A 5IJ9A 4ZK7A 1YIJF 1H7MA 3CCUF 1Q8RA 5EYPA 3UT5A 3CCEF 2IQQA 4TV9B 1S72F 3LWOC 2H8CA 5GINC 2CSLA 4O4IB 1VQPF 1U3PA 2HP0B 1FNJA 4IIJB 2I6DA 1YJNF 4X3LA 2KG4A 4TV8B 4YJ3A 3LYBA 3WPXA 3CCMF 2FGYA 2CW4A 1FFXB 1VQLF 2UYKA 4O4HB 3F0EA 4PWTA 3JAKB 3KJJA 2UYNB 1ONIA 2KGWA 4BW0B 5GIOC 5KMGB 2IAFA 3OBWA 3JASB 2H6LA 3ZO8A 3VYUC 1VQ8F 2HS3A 4O4JB 3IR9A 1N8RH 3D54A 3JAWA 1J7HA 4X1KA 5JCOC 3ELCA 3RYFA 5LOVB 2AIZP 1M1KH 4B5CA 4F6RA 2QI2A 1NMUB 1U43A 4DRXA 1XV2A 4U3JA 2NMUA 2OTMA 3RE3A 3MQWA 5FNVB 5EZYA 1UI9A 1FNKA 2HQSC 3LWQC 4EI9A 1VQMF 1QVGF 3IEQA 2OZBA 4ZI7B 3E22B 3LFOA 3RYHA 3MDOA 3R0PA 3PAFA 1Z5WA 4O2AB 2CHSA 3CG6A 4G4WA 3WGNA 5GIPC 4O2BB 3F0GA 3CC2F 4LNUA 2GVIA 2I6RA 4HNAB 4WBNB 3CCSF 5LYJB 2AIFA 2QEXF 3F0FA 3I56F 5EWRA 3J81M 1K73H 4BT5A 2BTOA 1KNKA 1FFXA 3RA6A 4G4ZA 4O4HA 2VGNA 1R1MA 4NUTA 3HKBA 5HXZA 4G88A 4RQOA 4C8GA 3IEWA 3DDNA 1W2BF 1YHQF 3JAKA 3VO8A 1VQNF 1IV3A 4BT2A 4LCKA 4IHJB 3MBMA 5IYZA 5EB1B 3CCQF 3RYCA 3Q8HA 1W41A 5J2UA 1X25A 3HKCB 2VAPA 5A2QM 3DC2A 1JFFB 2F9ZC 1YITF 3B6NA 5EYPB 3CYPB 3P10A 1W581 5EAZA 1W5AA 4TUYB 3IKEA 3WGKA 2IG8A 4I55A 2JNBA 2RHHA 3WJRA 4XCQA 1JN1A 1Q86H 2PHNA 2BTUA 2Z1EA 1W40A 2GLZA 5JQGB 3QHDA 4TV8A 5C8YA 2ALEA 4G4YA 4EB6B 3S02A 3FFMA 3VOAA 3JARA 5KX5A 3S0WA 3CC4F 4BT7A 3K14A 4O2BA 5HP8A 2MQEA 1CN7A 2B33A 3WPWA 3N2KA 2Q1YA 1X52A 3N4ZA 1PXWA 4ZHWA 1CLIA 3NMUC 1TVKB 2DT4A 4NWOB 1CK2A 3HTNA 1JJ2F 1W5FA 2HS0A 5JH7B 4X1YB 1U40A 3GHZA 4BT4A 2Z01A 2HX0A 3ON1A 3ESJA 4ZOLB 2HS4A 3V7QA 1VQ6F 4IHJA 4B62A 3HKDA 5IJ9B 4YJ2B 5EZYB 1K9MH 1K8AH 3RYCB 2Z1TA 3G6EF 2QTPA 3HKCA 1RA4A 1NQ3A 3CB2A 3E22A 1Q81H 1W55A 2LBWA 3TD3A 4TV9A 3TD5A 1W3EX 1JFFA 3WGLA 2BO1A 1JY8A 1ZWZA 4U39A 3K12A 4ZHVA 5CB4A 3JATA 3P4EA 4I50B 2ZVZA 4X1IB 4HNAA 4BT3A 3NK6A 5LP6A 3QUWA 3D00A 5MN5A 2HP3A 2CWJA 5J2TA 1VQ9F 5GANK 5EIBD 3C8LA 1RLUA 2HRYA 3JVHA 5G4VC 3CYQA 2ZODA 3C9RA
chains in the Genus database with same CATH topology
2EWCA 2IG8A 1XHOA 1ONIA 1COMA 2UYNB 1JD1A 3M4SA 3R0PA 4NWOB 3I3FA 2CSLA 2UYJA 3V4DA 5HP7A 3D01A 3VCZA 3ZO8A 2CHSA 3GTZA 3K12A 1NQ3A 1XRGA 3I7TA 1FNJA 3ZOPA 3LMEA 3L7QA 3ZP7A 1J7HA 1QU9A 2DYYA 1PF5A 1QAHA 1X25A 3QUWA 3M1XA 2UYNA 2CWJA 2UYPA 3LYBA 1ODEA 3K0TA 1DBFA 2CVLA 2CW4A 5HP8A 1UFYA 2UYKA 4ZK7A 1QD9A 2B33A 3ZP4A 3KJKA 2OTMA 3MQWA 3KJJA 2CHTA 1UI9A 1FNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  2IG8 A;  1XHO A;  1ONI A;  1COM A;  2UYN B;  1JD1 A;  3M4S A;  3R0P A;  4NWO B;  3I3F A;  2CSL A;  2UYJ A;  3V4D A;  5HP7 A;  3D01 A;  3VCZ A;  3ZO8 A;  2CHS A;  3GTZ A;  3K12 A;  1NQ3 A;  1XRG A;  3I7T A;  1FNJ A;  3ZOP A;  3LME A;  3L7Q A;  3ZP7 A;  1J7H A;  1QU9 A;  2DYY A;  1PF5 A;  1QAH A;  1X25 A;  3QUW A;  3M1X A;  2UYN A;  2CWJ A;  2UYP A;  3LYB A;  1ODE A;  3K0T A;  1DBF A;  2CVL A;  2CW4 A;  5HP8 A;  1UFY A;  2UYK A;  4ZK7 A;  1QD9 A;  2B33 A;  3ZP4 A;  3KJK A;  2OTM A;  3MQW A;  3KJJ A;  2CHT A;  1UI9 A;  1FNK A; 
#chains in the Genus database with same CATH topology
 5AVM A;  2G9I A;  1COM A;  1RLG A;  3HJW C;  3F0D A;  3HKE A;  1VK3 A;  2UYJ A;  2W8B C;  2UZH A;  1TUB A;  3RYI B;  4R40 B;  3E20 B;  3J80 M;  3SIU A;  1QVF F;  3I7T A;  1W42 A;  3MCA B;  1PF5 A;  3FD5 A;  3CPW F;  2P6Y A;  3FBA A;  2RHO A;  3C9T A;  2N48 A;  3KE1 A;  3KIZ A;  4X20 B;  5LXT B;  4EI8 A;  2RB9 A;  2FC3 A;  5FNV A;  3CXC F;  4O4L B;  2H8E A;  5EB0 A;  5JCO A;  2EWC A;  2WAL A;  2OTJ F;  3RYH B;  5JQG A;  3HAX D;  4C8I A;  2ZAU A;  1T0K B;  2LBX A;  5LA6 B;  3L7Q A;  1VQV A;  2V9Y A;  1OAP A;  3P0Z A;  5LP6 C;  3U0O A;  4B46 A;  5KMG A;  3WGJ A;  3CD6 F;  1ODE A;  1OFU A;  5CB4 B;  3K0T A;  1DBF A;  3JAT B;  3JCM M;  3VOB A;  3WJP A;  3QTY A;  1RQ7 A;  1H47 A;  1TVK A;  5IT9 M;  1YJW F;  4YJ3 B;  3VYS C;  5CA1 A;  4F6R B;  1GZ0 A;  2YXZ A;  1GX1 A;  4X1Y A;  5HY1 A;  5ITZ B;  2LBT A;  2RHJ A;  4BVR A;  5EIB C;  1XRG A;  4TZZ A;  3LDT A;  2VXY A;  3LME A;  3ZOP A;  3NVI B;  1QAH A;  1U3L A;  2VGM A;  2ZVY A;  4G4X A;  4M8I A;  2R6R 1;  5CA0 B;  2L26 A;  3VI6 A;  1VQ7 F;  4BVS A;  2BTQ B;  2VAM A;  3C9S A;  3KJK A;  3G71 F;  4I55 B;  3JAW B;  3NVK E;  4X20 A;  5B8F A;  1YQN A;  1IV1 A;  5HWE A;  1Q82 H;  3VYT C;  3LWP C;  3F6M A;  1SZQ A;  1VQ4 F;  4O4I A;  1SDS A;  3GTZ A;  3V3T A;  5JVD A;  3S0Y A;  4IIJ A;  4C82 A;  4EB6 A;  1QU9 A;  5J2T B;  3OBY A;  1DT9 A;  3HKB B;  1E7K A;  3GYQ A;  2CVL A;  4ERH A;  1SA0 A;  5LA6 A;  1NJI H;  3SIV A;  5IYZ B;  3KHN A;  1FSZ A;  4FFB A;  3JAL A;  3WJQ A;  3WGM A;  2R75 1;  3I3F A;  3JAM M;  5HP7 A;  2K1S A;  4O4J A;  5CA1 B;  4BVT A;  4TUY A;  4EI7 A;  1KQS F;  3LWR C;  2AMT A;  2DYY A;  3T80 A;  4X1K B;  5LXT A;  1M90 H;  3CCL F;  1W59 A;  1KC8 H;  2KTV A;  3EOR A;  4YJ2 A;  4DRX B;  4O4L A;  4BT6 A;  5C8Y B;  4U3J B;  3MCQ A;  4ZHQ B;  4I4T B;  5J2U B;  1VQ5 F;  3CCR F;  4ZI7 A;  3CC7 F;  3V7E A;  1YGY A;  1W5E A;  4X3M A;  1H48 A;  3IKF A;  3S0H A;  3UT5 B;  5MN4 A;  3D01 A;  5BMV B;  1GO0 A;  4X1I A;  2VAW A;  1IV2 A;  4LNU B;  5LP6 B;  3NK7 A;  4ZHY B;  2Q1X A;  5JVD B;  3E1Y A;  3LWV C;  5LYJ A;  1YJ9 F;  4RHA A;  3IMP A;  3HWU A;  2HVY D;  2YYE A;  3BYQ A;  3N2G B;  1VQK F;  3M1X A;  4E6E A;  5GON B;  5ITZ A;  1X7P A;  3JAR B;  3V4D A;  3WXM B;  5KX5 B;  3OW2 F;  1TUB B;  2OTL F;  1KNJ A;  5HY2 A;  3RYI A;  2LCA A;  3CCJ F;  5MN6 A;  3JAS A;  3CCV F;  5IJ0 A;  4FFB B;  3N2K B;  5HXU A;  2QA4 F;  5CA0 A;  4BY9 D;  2OHW A;  2UYP A;  3VTI C;  1IPA A;  5GAP K;  3RYF B;  1UFY A;  4NQ3 A;  1W57 A;  5JH7 A;  1T0A A;  4BVQ A;  4I50 A;  3ZP4 A;  2ZF8 A;  1XHO A;  2CHT A;  2Z1U A;  1YI2 F;  4KWE A;  2HP0 A;  3N4Y A;  2ZOV A;  5EO3 A;  1XBI A;  2Z1F A;  1VH8 A;  1GO1 A;  1KD1 H;  2KTU A;  3HKD B;  4ZHQ A;  3FPI A;  4I4T A;  3OON A;  3S06 A;  3CME F;  3RA5 A;  3I55 F;  4O2A A;  3ZP7 A;  3K2X A;  3PLA C;  5DCV A;  1SA0 B;  2UYN A;  3C9U A;  1VHA A;  5HY0 A;  4C8E A;  5BMV A;  1QD9 A;  3O85 A;  4WBN A;  1W5B A;  2RHL A;  1Z5V A;  3JAL B;  3M84 A;  2CZW A;  3TD4 A;  1IV4 A;  1Q7Y H;  5FJ4 C;  3VMF B;  3J7A R;  4DXD A;  3VIU A;  3CMA F;  1JD1 A;  3M4S A;  5LOV A;  1RQ2 A;  3VCZ A;  3N2G A;  4B45 A;  2HRU A;  5G4U C;  5FLX M;  5GON A;  1VQO F;  1X7O A;  3CPQ A;  3FD6 A;  4G4V A;  2GZL A;  4C81 A;  3AGK A;  4ZOL A;  4C4W C;  3HKE B;  3ERN A;  5HY4 A;  5IJ0 B;  2PMP A;  3G4S F;  3S03 A;  5IJ9 A;  4ZK7 A;  1YIJ F;  1H7M A;  3CCU F;  1Q8R A;  5EYP A;  3UT5 A;  3CCE F;  2IQQ A;  4TV9 B;  1S72 F;  3LWO C;  2H8C A;  5GIN C;  2CSL A;  4O4I B;  1VQP F;  1U3P A;  2HP0 B;  1FNJ A;  4IIJ B;  2I6D A;  1YJN F;  4X3L A;  2KG4 A;  4TV8 B;  4YJ3 A;  3LYB A;  3WPX A;  3CCM F;  2FGY A;  2CW4 A;  1FFX B;  1VQL F;  2UYK A;  4O4H B;  3F0E A;  4PWT A;  3JAK B;  3KJJ A;  2UYN B;  1ONI A;  2KGW A;  4BW0 B;  5GIO C;  5KMG B;  2IAF A;  3OBW A;  3JAS B;  2H6L A;  3ZO8 A;  3VYU C;  1VQ8 F;  2HS3 A;  4O4J B;  3IR9 A;  1N8R H;  3D54 A;  3JAW A;  1J7H A;  4X1K A;  5JCO C;  3ELC A;  3RYF A;  5LOV B;  2AIZ P;  1M1K H;  4B5C A;  4F6R A;  2QI2 A;  1NMU B;  1U43 A;  4DRX A;  1XV2 A;  4U3J A;  2NMU A;  2OTM A;  3RE3 A;  3MQW A;  5FNV B;  5EZY A;  1UI9 A;  1FNK A;  2HQS C;  3LWQ C;  4EI9 A;  1VQM F;  1QVG F;  3IEQ A;  2OZB A;  4ZI7 B;  3E22 B;  3LFO A;  3RYH A;  3MDO A;  3R0P A;  3PAF A;  1Z5W A;  4O2A B;  2CHS A;  3CG6 A;  4G4W A;  3WGN A;  5GIP C;  4O2B B;  3F0G A;  3CC2 F;  4LNU A;  2GVI A;  2I6R A;  4HNA B;  4WBN B;  3CCS F;  5LYJ B;  2AIF A;  2QEX F;  3F0F A;  3I56 F;  5EWR A;  3J81 M;  1K73 H;  4BT5 A;  2BTO A;  1KNK A;  1FFX A;  3RA6 A;  4G4Z A;  4O4H A;  2VGN A;  1R1M A;  4NUT A;  3HKB A;  5HXZ A;  4G88 A;  4RQO A;  4C8G A;  3IEW A;  3DDN A;  1W2B F;  1YHQ F;  3JAK A;  3VO8 A;  1VQN F;  1IV3 A;  4BT2 A;  4LCK A;  4IHJ B;  3MBM A;  5IYZ A;  5EB1 B;  3CCQ F;  3RYC A;  3Q8H A;  1W41 A;  5J2U A;  1X25 A;  3HKC B;  2VAP A;  5A2Q M;  3DC2 A;  1JFF B;  2F9Z C;  1YIT F;  3B6N A;  5EYP B;  3CYP B;  3P10 A;  1W58 1;  5EAZ A;  1W5A A;  4TUY B;  3IKE A;  3WGK A;  2IG8 A;  4I55 A;  2JNB A;  2RHH A;  3WJR A;  4XCQ A;  1JN1 A;  1Q86 H;  2PHN A;  2BTU A;  2Z1E A;  1W40 A;  2GLZ A;  5JQG B;  3QHD A;  4TV8 A;  5C8Y A;  2ALE A;  4G4Y A;  4EB6 B;  3S02 A;  3FFM A;  3VOA A;  3JAR A;  5KX5 A;  3S0W A;  3CC4 F;  4BT7 A;  3K14 A;  4O2B A;  5HP8 A;  2MQE A;  1CN7 A;  2B33 A;  3WPW A;  3N2K A;  2Q1Y A;  1X52 A;  3N4Z A;  1PXW A;  4ZHW A;  1CLI A;  3NMU C;  1TVK B;  2DT4 A;  4NWO B;  1CK2 A;  3HTN A;  1JJ2 F;  1W5F A;  2HS0 A;  5JH7 B;  4X1Y B;  1U40 A;  3GHZ A;  4BT4 A;  2Z01 A;  2HX0 A;  3ON1 A;  3ESJ A;  4ZOL B;  2HS4 A;  3V7Q A;  1VQ6 F;  4IHJ A;  4B62 A;  3HKD A;  5IJ9 B;  4YJ2 B;  5EZY B;  1K9M H;  1K8A H;  3RYC B;  2Z1T A;  3G6E F;  2QTP A;  3HKC A;  1RA4 A;  1NQ3 A;  3CB2 A;  3E22 A;  1Q81 H;  1W55 A;  2LBW A;  3TD3 A;  4TV9 A;  3TD5 A;  1W3E X;  1JFF A;  3WGL A;  2BO1 A;  1JY8 A;  1ZWZ A;  4U39 A;  3K12 A;  4ZHV A;  5CB4 A;  3JAT A;  3P4E A;  4I50 B;  2ZVZ A;  4X1I B;  4HNA A;  4BT3 A;  3NK6 A;  5LP6 A;  3QUW A;  3D00 A;  5MN5 A;  2HP3 A;  2CWJ A;  5J2T A;  1VQ9 F;  5GAN K;  5EIB D;  3C8L A;  1RLU A;  2HRY A;  3JVH A;  5G4V C;  3CYQ A;  2ZOD A;  3C9R A; 
#chains in the Genus database with same CATH homology
 2EWC A;  2IG8 A;  1XHO A;  1ONI A;  1COM A;  2UYN B;  1JD1 A;  3M4S A;  3R0P A;  4NWO B;  3I3F A;  2CSL A;  2UYJ A;  3V4D A;  5HP7 A;  3D01 A;  3VCZ A;  3ZO8 A;  2CHS A;  3GTZ A;  3K12 A;  1NQ3 A;  1XRG A;  3I7T A;  1FNJ A;  3ZOP A;  3LME A;  3L7Q A;  3ZP7 A;  1J7H A;  1QU9 A;  2DYY A;  1PF5 A;  1QAH A;  1X25 A;  3QUW A;  3M1X A;  2UYN A;  2CWJ A;  2UYP A;  3LYB A;  1ODE A;  3K0T A;  1DBF A;  2CVL A;  2CW4 A;  5HP8 A;  1UFY A;  2UYK A;  4ZK7 A;  1QD9 A;  2B33 A;  3ZP4 A;  3KJK A;  2OTM A;  3MQW A;  3KJJ A;  2CHT A;  1UI9 A;  1FNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...