4TV9B

Tubulin-pm060184 complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
428
structure length
423
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 170
structure length 423
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv9B01
4FFBB 5IJ0B 4TV9B 2GVIA 3M8KA 4IHJB 5LXTB 5JH7A 4TV8A 3N2KA 4O4LB 3JAKB 4ZOLA 1TUBB 5LYJB 2Q1YA 4KWEA 1FFXA 5J2UB 1Z5VA 4I4TA 3ZBPA 5JQGA 5IYZA 3V3TA 1TVKB 3CB2A 4X1KB 5CA1B 5J2TA 3WGKA 3JASB 4YJ3B 3RYIB 4X1IA 5ITZB 3WGJA 3HKBA 4O4HB 4O2AA 5MN6A 5LP6C 3RYFB 3HKDB 2BTQA 5IJ9B 3HKEA 4I50B 3E22B 5LA6B 4EB6B 3UT5B 2RHOA 5BMVA 4B46A 1RLUA 3VO8A 4DXDA 1W5EA 4ZHQA 4HNAB 2VAPA 1FSZA 4E6EA 4O2BA 2RHJA 4O4LA 2R6R1 3VPAA 4DRXB 3RYCA 3JARB 1W59A 5FNVB 5KMGB 3WGLA 3JATA 5KX5B 2VAWA 5EZYA 4F6RB 3JAWA 4LNUB 5EIBC 3C8LA 4O4IB 3VOBA 4ZI7B 4U3JA 4TUYA 3JASA 1JFFA 2XKAA 4I55A 3HKCB 4X1YB 5JCOC 4WBNA 1W5AA 1SA0A 3RB8A 4EI8A 4YJ2B 5LOVA 5JCOA 3WGMA 5LA6A 3ZBQA 2R751 3M89A 5EYPA 5CB4B 3JALA 5GONB 5CA0A 5MN4A 5M7EA 4IIJA 4X20A 5JVDA 5LP6A 3N2GA 5C8YA 3RYHA 4FFBA 5IJ0A 4TV9A 4EI9A 2RHLA 5JH7B 4TV8B 3N2KB 3VOAA 4IHJA 5LXTA 4ZOLB 4O4JB 3JAKA 4U39A 1TUBA 1FFXB 5JVDB 5LYJA 4I4TB 5JQGB 5J2UA 5IYZB 1OFUA 5J2TB 2VXYA 2RHHA 4X1IB 1TVKA 4X1KA 5CA1A 3HKBB 3RYIA 4YJ3A 5ITZA 2BTOA 4O4HA 3WGNA 2BTQB 5C8YB 3HKEB 3RYFA 1W581 3HKDA 5IJ9A 4I50A 5BMVB 1Z5WA 3E22A 4EB6A 3UT5A 4ZHQB 5EIBD 1RQ7A 4O2BB 4B45A 4HNAA 1RQ2A 3RYCB 4O4JA 4DRXA 3VO9A 3JARA 3JATB 5FNVA 5KMGA 5EZYB 2XKBA 3JAWB 5KX5A 4F6RA 4LNUA 3ZIDA 4U3JB 4TUYB 4O4IA 2VAMA 1JFFB 4EI7A 4ZI7A 1W5FA 4I55B 5MN5A 4WBNB 4M8IA 1SA0B 4XCQA 3HKCA 4X1YA 4O2AB 5LOVB 4YJ2A 1W5BA 3R4VA 5EYPB 2Q1XA 3JALB 5CA0B 4IIJB 4X20B 5CB4A 5LP6B 5GONA 3N2GB 3RYHB
chains in the Genus database with same CATH superfamily
5E7MA 1CZUA 4GRIA 4OMFG 5K0TA 4RMJA 2WW8A 1F8XA 2ODQA 4DDUA 1JQLB 4JB3A 5K0BA 1FX0A 1UBLS 2ZCEA 2Z1UA 1YR2A 4OKNA 2G6TA 3CCVF 2ABWA 2JLZA 4HLNA 4C5CA 1I6LA 4D5GA 1B6QA 1KU9A 2XQFA 1M72A 2DZDA 1WEKA 3W8DA 5LMCA 4GX5A 3M6AA 2UUBO 1NJ8A 4FIZA 2ZSKA 2WWHA 4MV3A 4ZOBA 1QXSA 3FSGD 3G0HA 4PG7A 2NP7A 4ZZ1A 4B8ZA 3ZW9A 4GYYA 4S04A 1I94B 4MPDA 2AQHA 1LS6A 3R3HA 1Q44A 4F4LA 5JARA 5IKPA 3DO6A 2YFQA 5AI8A 2YHBA 1K63A 4LEIA 1V5GA 1CXZB 1DOHA 1GK9A 3RUDA 3OTOB 4O4JF 1BFDA 2EJ7A 3CCVV 3EIFA 1UMCA 1L1FA 4D82A 4QIWF 4R9UC 3V9PA 5I4IA 2XHBA 1Z83A 3I9V1 4YRLA 1E20A 1BS1A 1AKWA 2W58A 2XJ4A 5L3SB 2RG7A 1KQSU 5ANRB 2PLFA 2V1UA 1Q0RA 2W2PA 4CQMB 2BONA 2LIPA 3JZFA 3QOXA 3GNLA 3HZHA 1M2VA 3FHTA 4DG5A 2E3CA 2HBRA 2UVPB 5K0GA 4CEHA 1PZHA 5KYWA 3SAJA 4HDSB 4KPEC 4QU9A 3B6ZA 3B6KA 3ZS8C 1YQNA 5HUJA 4OQ4A 1MU0A 2BTQB 1AO0A 3H0KA 1NC3A 4NAVA 1VPWA 2X22A 3EEBA 1BJTA 3SGIA 3GDHA 5DO9A 1GRCA 3ER6A 2ZKOA 1AXGA 5JAOA 1R6TA 3R0XA 3W4IA 3L9WA 2EIMC 3IA7A 3R0VA 4QBGB 4TMYA 1OGYA 4EABA 4B3GA 3W7VA 2B1RA 4OQQA 4YMGA 4BN4A 5DN6D 1RKVA 3N6XA 3UPDA 2Q5CA 5L95A 3A4IA 3IVRA 3RE1A 5B8FA 1K9VF 5T6BA 4ZYUA 4NZNA 4IVNA 3CISA 3E18A 4Z4FA 3K2XA 4WNAB 1IG3A 2BFEA 3H1EA 1JPNA 3QUCA 4JENA 1NFQA 4MUIA 5LP6F 4JL5A 5KCZA 1A96A 1I0ZA 1D4FA 1LDMA 1UWCA 3RS7A 1E3SA 3AR5A 3TCXB 5LZ5A 4DOMA 3C3SA 3UQ8A 5J5CA 4ZANA 1DOZA 4ZDJA 3S1AB 2GYVA 1XBIA 1ZG3A 3PQ7A 2HA6A 1HNWO 4EY7A 3HY3A 3OFND 2I3DA 1ZD9A 4M9ZA 1CN7A 3L92A 3P2EA 3EF3A 3JQEA 3DD1A 2H63A 4FYKA 2GTAA 3GIDA 3NEPX 3ISVA 2LW1A 1MG0A 1XKXA 3FCYA 5A4IS 2YWHA 5EPEA 5CFLA 3IV9A 1RABA 1D1TA 4C4OA 4YCBA 2IPOA 3K3PA 3MS4A 2OILA 2C94A 1YK1A 1CUWA 3W9BA 1HE1C 4PSVA 1DQNA 2NNWB 2V0CA 3MMPA 2D54A 5IYBO 3PVZA 4DLLA 2Z57A 1TAUA 2C0QA 4W5TA 3KQQA 3TSYA 1S2LA 3MQ2A 4JODA 4E32A 4DWVA 5DI9A 2FZGA 4HFRA 4HDKB 2OCIA 2PZJA 4FMCB 5LCXA 4XDJA 2W6IA 1VLLA 4H35A 4MIKA 5IZ4A 2WLHA 3DAFA 5HS4A 3LXUX 2Z2XA 2O2XA 3JQFC 1C3LA 3OEED 3HDTA 4ARSA 2QBYA 5HKBA 4TKUA 3RS0A 4I19A 1M1YE 3WJ1A 4OI4A 1FRNA 2QRVA 3UJPA 5BQXA 4LMRA 2XBUA 2OD2A 1T5TA 2ZJ2A 3ML1A 1B8PA 2HRYA 3EGXB 1WCWA 4H15A 1CJBA 5EWMB 2O5CA 3GDOA 2ZB7A 4RF2A 1DV1A 4KVZA 3KKZA 1MV8A 4NBKA 1WA5A 1Y34E 3IHKA 2C00A 2ZVYA 2PX2A 1UF9A 2JAOA 4QO7A 5CIQA 4RKYA 1L5NA 3DOIA 1QD9A 3IRVA 1FNCA 4OSEA 2CGOA 4MYTA 4HYQA 3J7TA 2DHDA 1W47A 3ABMB 2X9LA 1UKEA 1O6ZA 1UJCA 3H1GA 1JFFA 5AM1A 1VC2A 3CCJF 1KOJA 3F7TA 1KERA 3X2QB 1P5JA 2FP4A 2WPDA 4JJKA 3KYJB 5K4HA 4JGSA 3MCQA 3IAUA 3S0HA 2Q7GA 2I2AA 1NXXA 2HA2A 1XO1A 2MU1A 2NXWA 2AKAB 5FQNA 3UT6A 2YVKA 3PLNA 1XBLA 2CDCA 3LX6A 2OVBA 4JQYA 3RCBA 3WB9A 5BUZA 2W2XA 4ZK7A 1XB2A 2YJNA 3BMQA 4MJXA 5C0OE 5BP7A 5B57C 1K7DA 3HY4A 1WVIA 1XNHA 3EBOA 5LYJB 2WUFA 4KFRA 5K8IA 1M6WA 3CCJV 4MS3A 2M6LA 3ESJA 4OXQA 4FCVA 2QRNA 4CCYB 1KR5A 2OYSA 3U7GA 2UYPA 3VPCA 5EUCA 4B7ZA 4ROSA 3F2IA 5ESXA 1LPNA 4G4ZA 5KNCH 3PXGA 3G85A 5H83A 3WNVA 2OT5A 5FUMA 1SQBH 1T9KA 1G16A 2FV8A 5UKDA 3MC1A 2WF7A 1P5FA 3DXYA 3RVRA 5AKHA 1NKVA 2CF6A 3OE7D 2Q1TA 1N9GB 3KBBA 3IURA 4J0JA 2JCYA 2A5YB 3ADPA 4PFQA 2NYVA 3P30A 4I50A 1HH4A 4W4TA 3FMVA 5DTEA 4QAQA 1GM5A 3RIMA 3CX4A 4B8YA 2YCBA 3NWJA 4X45A 5I48A 1W41A 2VHUA 1KB9F 4Y67A 3ERCA 4A6EA 4MA5A 4K81B 3E70C 4D4LA 5F3WB 3HLKA 4H33A 4TQAA 1Y37A 4A0FA 5C52B 1N75A 3J80N 3KUUA 4ZVNA 4I4TA 3M81A 1NVXQ 2NMUA 4IAOA 4H6VA 3CS3A 2QRZA 3WYFA 1C8LA 4B09A 3ZHYA 3SFVA 2AOXA 3GJYA 5HUQA 1HEUA 4JI7B 3SYKA 1XHXA 1X1QA 4EYOA 1QR8A 5MFZA 1GIAA 4L8FA 1IOWA 4V0RA 1IN4A 2V98A 3G5UA 3PWKA 4A8HA 4F4JA 3IA2A 4Y8VA 5E7IA 1MJFA 2VUSA 1C5KA 4UTNA 3RUCA 3GXBA 4CV0A 1PS9A 3IR9A 4MRPA 2ZAOA 1AOXA 7REQB 2EXXA 1NBOA 5DCVA 3K70B 1AKVA 3J7AU 3ZX4A 1OC4A 5CYPA 5A4AA 3FBGA 3T6KA 4PAMA 1EWYA 2TMGA 1FVXA 2IOFK 3MHHC 3K04A 5AKXA 1UJBA 1R15A 5CFPA 4BHTA 5B1DA 3L7YA 2DJVA 2PL3A 3N0WA 2FUEA 1M34A 3DVLA 3W5VA 5J1SB 1EDZA 3MUNA 3H4TA 2ZZKA 4KXQA 2F3RA 2V9PA 2Y0PA 2VTBA 1LXCA 2FQXA 3MK31 3A3YA 1TAHA 1RYYA 1NFFA 2OPHA 1PX2A 2Z9DA 1I3NA 5L3DA 4RANA 4XEHA 4NE7A 4KFSA 4QG7A 2B4RO 2Q4DA 3HB7A 4BX8A 4IRXA 4WW0A 1K68A 2WWVD 2R1UA 1E1QG 2XYPA 3SXPA 2HGZA 3K0BA 4JJAA 1Z73A 3PUXA 1IHUA 3DTVB 2BGUA 4FYMA 2J3KA 4DMCA 4HKTA 5KA5A 4G5OA 2F62A 3U7RA 2BY4A 3WVNA 1VIYA 5AKKA 4H0FA 4TM8A 5FA8A 3DOOA 1UINA 5ALYA 3EXEB 1KMNA 5HDBB 1V4NA 2GK6A 4LXIA 5HUHA 1MMFB 5THKA 2VPYA 3R24A 1TKCA 2O2SA 3GRVA 1J97A 1DC7A 1QYWA 3PHJA 4DE5A 3MXOA 1SBYA 4EWLA 1Z5VA 4GXRA 4XB2A 1NAIA 3RHSA 3TEFA 4JASA 2PL9A 2ZE7A 3JQBC 2N47A 3LQRA 4G4YA 3HYCA 2WTUA 4PIMA 5H70A 3C5WP 4UCOA 4MV4A 3LHSA 1JHPA 4HPJB 3UHAA 3VZCA 5ER6A 3GDGA 1OCOB 3LKBA 2FMUA 4R4JA 3KOOA 5JXIA 4DMFA 1OASA 2RJNA 4FE3A 3UTCA 5DSZA 1GNRA 1K4MA 1E2QA 3MCWA 2J3LA 3AR9A 4TM7A 4DJ5X 1CK4A 1CR1A 3MAJA 4XUEA 3EZ7A 1QHTA 1W0KG 5CM8B 4R2IA 3SMQA 1SK8A 1H5NA 2BHNA 1ZBDA 2FL4A 2YMPA 4U0KA 2W7TA 3AR2A 2YOGA 1N34B 4DV7O 1BVHA 4ETNA 3KZ1E 1KDVA 1M2KA 2I2BA 4GNKA 1LPAB 3OHPA 2IYAA 4EBFA 2O0JA 1YC5A 3HEMA 1W5FA 1GXSB 2HVJC 2B8EA 3RUAA 1ULUA 3I8OA 1WY5A 3QKWA 4JI1O 2FR8C 1T8UA 3G7NA 2WNHA 1E1CB 4CVNA 2Q7OE 5IDYA 4LJKA 3QVVA 5H68A 1R2QA 5BO5A 2Y0IA 3QJ5A 1ABFA 3WSVA 5IJ9B 4K6GA 5IABA 1CUHA 4PU0A 3PTZA 3DD5A 1KTIA 1TLTA 1J56A 3EZ9A 2OAP1 4K9PA 2EFJA 1WSAA 3EBLA 2HEIA 4HGRA 4AMBA 3PNBA 4JJFA 3KKKA 4YHHB 1YMQA 1PQPA 2DE0X 1YVEI 1V26A 4IRMA 4N8EA 4LVUA 1X3LA 4UVHA 3T61A 3H84A 4L08A 4V38A 1YL5A 3EA5A 4ZRDA 1VCOA 3CUEF 3WSWA 3H4VA 4US0R 4ZCMA 2O8EA 1YJ9V 2JRIA 2YMLA 3H2HA 3UJAA 4DSNA 1E9SA 1O3YA 3PXDA 1ZFNA 5SZHB 1DZ3A 5BN3A 4ZQFA 4U2KA 5JXWA 5EUBA 4UNSA 5D84A 4DDTA 1GFWA 5EEHA 3GJ4A 4F1KA 1SH7A 3GEDA 2B4AA 2KYRA 2F8MA 5J59A 3KTFA 5JQWA 3D0RA 5FOWA 1WETA 1FXSA 4BAZA 3F2VA 1DAGA 1KAMA 4QODA 5TMEA 5L9AA 2P4KA 3I3SR 4RLFA 4CH3A 3MGGA 5DYYA 1HDEA 3N8HA 4UE2A 2J30A 1I7QB 1W88B 4DKJA 4L3OA 4I9QA 3SG0A 5A2QA 4C0AC 5HQJA 4TTAA 1ZNWA 3QEBZ 4DZZA 3FCSB 2DFTA 3BEHA 2K9PA 4R8SA 4HADA 2DUUA 3RJZA 1Y4UA 3IDZA 1KH3A 4UM8B 3OEYA 4JCCA 5IVIA 1V5EA 1KKCA 2BTOA 3WDMA 4PIPA 3Q85A 2H9IA 1C9KA 4LHYA 2D2CB 1Q17A 3IEUA 4DRZA 1UADA 2PT5A 1QIFA 3LMKA 4CBVA 2HJDA 3VCZA 2IYYA 2PEZA 1JHRA 2BELA 3KAKA 1Y6JA 2GN4A 3GXOA 3WHKA 5C5EA 3R1IA 3E7XA 3P96A 3W6PA 1YB2A 3P94A 1T13A 2NU8B 3CH5A 1VIAA 1KPIA 3FMFA 3TH5A 3KR2A 3A2NA 2EJBA 1NIJA 5U4QA 4ZC1A 1RXSA 1EG2A 2H2HA 2C1EA 3W5DA 4FMBB 1ZR4A 1JXAA 2TMDA 1SBTA 4Z0NA 8ATCA 4H27A 2EFCB 1SEVA 3Q2IA 3NYIA 2ZBPA 1D09A 3EISA 4R83A 1PL8A 3ZJVA 3VQYA 4HEQA 4OQMA 1OLUB 2V5UA 4HMOA 5AVUA 2B82A 4R31A 2Q1SA 2ET6A 3OFJA 4TZ0A 1BMTA 1USGA 1JV2B 2YXHA 1FQKA 2PPVA 3SNHA 4F8JA 2B3TA 2ZAIA 4R7GA 4UEJA 5MN5A 2V9CA 1GO2A 3AL3A 1JILA 5KX5F 5JE8A 1U3UA 1J24A 2CN1A 4NBTA 4Q66C 2FAXA 4FEEA 1B7GO 4JXZA 1DBVO 3UTDA 5ES4B 2E4XA 3ND7A 1DQSA 2LDBA 1NOKA 1Y7IA 2F1JA 1JKXA 1TQ6A 4EENA 3LWBA 3O9ZA 4RKFA 2W2TA 1JP7A 1QDUA 3VQWA 4MGYR 3PFFA 5HPYB 2PK3A 3JS5A 3ZBQA 4ZQEA 3T12A 3MEQA 3HCEA 1X2BA 3OCUA 4LR3A 5AXAA 4XYBA 2YS6A 4GZLA 4K9OA 1HZZA 3SXUB 3KWLA 4HVCA 1GCGA 1PP4A 3ABQB 3ONEA 3FVTA 1QPBA 5CDHA 2VDKB 4UPEA 1AD2A 1L3IA 1DMSA 2P3LA 4N5MA 4YJHB 3UWKA 4QBHA 5FR1A 1GCUA 5CJJA 3W4JA 4QX6A 1QIDA 4UHEA 3PTLA 1PT9A 3PC8A 2NOAA 4DSTA 3STTA 3FWPA 5KWJA 5AVKA 4Z1MG 1RC8A 4TVOA 2O3RA 1SUWA 4CF3A 2GCPA 4B48A 1WBBA 2QN6A 4YV7A 3RFXA 5EPOA 2PYZA 3QVGA 1BX1A 3I42A 2JF0A 4KNYA 1SBNE 5B4TA 4BB0A 3WGLA 4JEHA 2XCIA 4UZFA 2ORYA 1ZCZA 3F8TA 4UUMA 4BNVA 2VYNA 2G63A 1I0HA 4Y98A 1ZHFA 1H05A 4P92A 5JAZA 1FBTA 3B3JA 4ALIA 1P91A 4A0GA 2HQSC 4R8VA 2V7GA 3GG2A 1E1QA 1D4ZA 1YZHA 5AKGA 4WT7A 1N2OA 1FLVA 2IL1A 1YAHA 3TD4A 5G53C 4YIPA 4GWKA 1KMIY 3DBLB 4FM0A 3P3PA 1QB8A 2EIMB 2XITA 1L7DA 4KO8A 2DWCA 2O9JA 2RNBA 1K9SA 4H08A 1GILA 4LJLA 1M93A 4DC9A 4C7VA 4ZOCA 4AXXA 2G9UA 3U3RA 3PHCA 4ZI7F 3E48A 2HMAA 4AICA 2ACKA 3M4SA 4KDCA 5IBQA 4C0LA 3C98A 4F5WA 3OX2A 4PPNA 2IV3A 1RXEA 4JKYA 1JXOA 2QRUA 4L8LA 4BCDA 2VRZA 2PKWA 2QXTA 1Z6GA 3QXCA 4BKUA 1QO7A 3H5LA 5F76A 2WG2A 3TD2A 2PTHA 2HSWA 2PH1A 3L8GA 4FMDF 4RLSA 1VJ0A 3WIDA 1IZZA 1ORQC 5D7BA 1XLWA 4MVQA 5DGXA 3PUVA 2WDZA 3O6VA 4W5RA 1KVTA 4P1ZA 5DIZA 5G0SA 3I4FA 4OM8A 2KLBA 5BN4A 3QHDA 3EXAA 5ADVA 2JAXA 5KQPA 2UAGA 1KZ9A 1M34E 5I3CA 5A2QN 1LV8A 4ZVVA 3SHVA 1R1MA 3RFTA 1W0KA 3LC7O 1BMFG 4DUZO 1ECBA 3WRXC 4E5NA 3MDSA 2ILVA 4OHPA 3O74A 3THYB 4J6EA 4YPVA 5DH9A 3DFIA 4X60A 1WSDA 4N6GA 1LUWA 2WIGA 1GRQA 4QFMA 1GEEA 3ZHVA 1E62A 5E95A 4UCXA 1HTTA 3CB2A 3BJRA 1NP6A 3VNUA 2I66A 2ZS7A 3LY5A 1S2MA 1HMPA 5H0IA 2Q2VA 2BYTA 1M7BA 2GI4A 1YDWA 5FBQB 3H11B 4FUTA 3P4EA 4JP1A 4ZAZA 1UXGA 5BSVA 2FH5B 1G291 3WMRA 4Y2YA 2P78A 3EY4A 3W2GA 2HCJB 2P0AA 3CUYA 5FPQA 4A4DA 4GUNA 2IAFA 4WFJA 5CXUA 1U5BB 4LZPA 3FPHA 3U37A 1FUEA 3EPRA 3L7CA 1BFUA 2I8LA 2FF7A 2YC4C 2BKEA 4X90A 2BO1A 2E76B 1MAUA 2PSSA 4D97A 2QI2A 2JCGA 4E09A 5JPDA 2XXAA 1I7FA 4UVCA 2LBTA 5BPFA 4N6OA 3F3SA 1WR8A 3ZPXA 1F6BA 5HIKA 1G4UR 2CXHA 5K8CA 3B1XA 3K32A 2IH3C 4HEJA 1FXVA 2AFRA 2FY8A 4W7IA 1SQ0A 3RI3A 2EW2A 5FP0A 2VP4A 1U6JA 1XJQA 2D0PB 1VXOA 3T1YO 3JQ7B 2H2IA 3WJPA 3HDHA 1SZCA 1KJNA 4F4HA 4IQGA 1NR1A 3DVQX 4IS2A 3L0OA 1CUAA 4FFOA 3VZQA 1A9PA 3IP5A 2CMGA 4C76A 4DV5O 1XNJA 2AJ8A 1ZCBA 2ZUBA 4J1TC 3NXKA 3HN7A 5F1YA 3IO5A 4Q4DA 3TD9A 1JG4A 4XKJA 4LF5O 5K3CA 2Y4TA 2G09A 4X5OA 3O0DA 2QZSA 3NONA 5EJ7A 1DAHA 1VRVA 4DC0A 3A0BZ 3EVCA 4QC2A 2HVKC 3EXG1 3FPEA 3G0CA 4OGWA 1YJCA 1B1AA 1TZKA 2H92A 3ITKA 2Y1GA 3BHMA 3LCCA 1IZYA 3D54D 3IILA 3IIEA 5HZMA 1KBZA 4RJTA 3ZRXA 5EQDA 4U4AA 2JHPA 2JIQA 5IF9A 3BMNA 3NGMA 1LK0A 1L5ZA 5JTUA 3WY9A 2SICE 3K0AA 3DE7X 1WLEA 2UYNA 2IITA 4HYYA 1JDJA 1EDOA 5K0CA 4JKIA 1PZMA 3BPSA 1MQ9A 4KN9S 3LVFO 4WDRA 1G8YA 4RF3A 1Q5PA 4LDZA 4EW3A 4LGCA 3ZXYA 2A1UA 2JJ1D 4O4IB 4F72A 3NWOA 2G28A 3RIXA 2OHVA 4IDOA 4PBRA 1YHQF 1VSQA 1XHZA 4ON9A 2ZBGA 5ITWA 5DBOA 5D1NA 2ZWOA 1KYTA 3MJFA 4JB0A 1UBRS 2PKQO 3K16A 3MB5A 1PV2A 2BFDA 4OY3A 2DULA 3QVTA 3NHLA 3UJDA 5ALRA 5EK0A 3UCEA 2FG7C 4BLPA 3DPIA 4AJ1A 1IAVA 1N2BA 3C8HA 1NP3A 3T41A 4GMDA 2HWWA 3VR3D 3AKYA 3MWDA 4FI3F 1VBNA 4OXSA 4RL4A 3BKXA 1EESA 4HEA1 3P27A 2OPBA 3AHIA 4DR5B 1L4MA 2JASA 3K09A 5CBHA 3NASA 4OGKA 4LYAA 3CNEA 1BAPA 3S2YA 4AMZA 4MVWA 5I5GA 4LVNA 1H93A 2Z95A 3B4SA 3AHGA 4GVLA 1B76A 3ICVA 3ZBTA 4G0WA 1A7KA 3L18A 5HFAA 5CCBA 2QWQB 4NBLA 2R8XA 4YCCA 2YIJA 1Q7EA 4KR6A 2NZYA 5DBGA 4ND6A 3S2UA 3WGOA 3G1TA 2O50A 2VL7A 2WDPA 3TDKA 1S89A 4MWBA 2P91A 4QEZA 5ILGA 5B1AC 3I01M 3ENZA 1YR8A 1WN7A 2Z43A 3AF5A 5H80A 2OHXA 4HHEA 5TB5A 4UTXA 2IYWA 5IVDA 1TTHA 3RS2A 1U28A 4M0LA 4D0RA 3L9DA 5JFOA 1VHLA 3HXMA 3QEOA 3FNQA 3BQ9A 3P2KA 1UCFA 1XQYA 3A6GA 4JUDX 5LD2C 3VZPA 2Q7HA 4B9EA 3SLGA 4LXUA 5BN5A 2AC7A 4FGKA 2CFOA 5CB0A 1J39A 2GFIA 3K7EA 4BQOA 2A7QA 2Q29A 1XA0A 4Z1MA 4LXTA 4NY1A 3K9LA 4M49A 3PJDA 1RAHA 1IRIA 3AW8A 5DEIA 4G07A 3T5TA 1WUYA 4G0XA 4GI7A 1W55A 1S7GA 4AT1A 3C39A 5HJEA 1JAYA 2CVFA 2J0UA 4HQ6A 4YJ2B 3ZRWA 1XTBA 4HFMA 3VH1A 3UJ3X 4NENA 1FNMA 3VZRA 4C6TA 1J1IA 1EP1B 3ILVA 3L4KA 2VF7A 3BXPA 5ICSA 3LFUA 4I7EA 1WQ1R 4FKMA 1V11A 5AJZA 1WXHA 4FGSA 1P77A 1L4YA 3HKDA 2QMEA 5BYKA 4Q48A 1U2TA 3TEMA 2Z9BA 3BPZA 3UKOA 3BTVA 3QZUA 5DVZA 4ZPJA 2R5NA 4ZJUA 5JSUA 2QNRA 2ZNIA 1YR9A 3PD0A 1U0FA 4HQLA 1TE2A 1MLDA 1GOTA 3UQZA 2C4UA 4J0QA 3T1NA 5EJEA 1PJBA 4Q1BA 3OP1A 5D87A 4WEQA 3WGKA 1FMLA 4U6SA 2DMRA 5FO1A 4XGNA 3ER8A 3SIXA 4R3WA 4IXWA 1RLUA 4OOFA 1Z2PX 3OQJA 5B1SA 2VTVA 3GLIB 3RVJA 3SZMA 1BDIA 2VF2A 2H2GA 2CNKA 3T1QA 4FM2A 2PRIA 2QZZA 2H4XA 1E2EA 1QH8A 3CN9A 3TRHA 4EJ2A 3MG9A 5LXTA 1P5ZB 1PSDA 3C3EA 5ECGC 1AILA 1HI9A 4OHRA 2F4NA 1VLJA 2J0EA 4YCJA 1NUAA 2GLUA 2EFYA 1K8ZB 2MINA 3D0OA 2ZG6A 1Z7BA 1N32B 3CC8A 1C9MA 1JCHA 3I6IA 3KQTA 3NHJA 2ODNA 1PRYA 1T9HA 3AB8A 3DKRA 3Q98A 1BMFA 1L4HA 5D5PA 4UM9B 2AXQA 3S29A 4FS8A 5E6UA 4KWEA 5HFLA 3U4AA 5A3RA 2I7VA 3HGMA 3EYAA 3GT7A 1K4DC 1RKUA 3DAGA 3O9OA 1I7DA 2H7CA 3M5CA 3T5AA 1C29B 5JWRA 1PK7A 2FF5A 4IH4A 2VDVE 3MUOA 4X7PA 4GX0A 4I6EA 2PWZA 1H65A 5DLPA 3GUCA 4FNAA 2FEOA 3H5AA 1DBWA 4RMHA 4WGGA 2W6CX 4CKWB 3RROA 1EDDA 2G1AA 4G8DA 2WD9A 5JZSA 5CGQB 1E6KA 5E7JA 5T3UA 4C7JA 3H8SA 5E2AA 1PV0A 3Q0TA 3H5NA 2W4IA 3PUZA 2JAUA 4R41A 4NOLA 2R00A 3OZXA 5BY1A 4EB0A 2Z8YM 3BTOA 3BA8A 4BUZA 3FETA 2UVQA 3K9AA 1Y3FE 2C98A 2JK5C 1ULTA 1M1NA 2RGNA 1LB1B 4B2YA 1PO7A 3I8SA 5L7YA 4MS1A 1TPZA 4JF3A 3ZVKA 2B9EA 1QR9A 1BHQ1 4K6FA 2ZSIA 2CLFB 1UWVA 1IZ3A 2WJ4A 4MO2A 3K0CA 1XCJA 4DY4A 3EG9A 3HR7A 3B6NA 2G5TA 2JVIA 3AGKA 2Y0BA 4P0QB 5JDCC 3Q15C 4CC6A 1XUOA 3TXYA 1NM5C 2GRJA 1I80A 5HIJA 3D36C 1HG1A 3VPDA 3DE6X 1OCZC 1Y66A 3BWMA 1QHHA 2OZKA 4PN3A 2VC2B 2WHYA 3EXIA 3OFVA 4I5FA 4LYGA 1CY4A 5L7WA 4GBMA 4NCJA 1P7VA 2QYHA 1SD1A 5WRFA 1EXVA 3TYXA 1E2DA 1JEDA 1Y4DE 3PNYA 1IHXA 2ZIGA 5EE1A 1Q20A 2Z9CA 5NLLA 2UUAB 3BGWA 2HU7A 4DQKA 4FFVA 3E9NA 2JGRA 4B44A 1MA0A 1VHWA 4AU1A 5HJ7A 1SRRA 3LWZA 4JIMA 1KETA 1P31A 2WWWA 1XDWA 2J3JA 4G37A 5CM2Z 1B16A 2DLCX 3U3JA 3HJBA 1TW2A 4WFBV 1XTUA 1VSUA 3MERA 1YFKA 1YCFA 4L51A 3ICEA 1QVGU 3D5TA 1PUIA 2QWOB 3TZEA 2Z1FA 1Z4OA 4CM1A 1S7CA 4KODA 3V4SA 1YXBA 4AP5A 3PS9A 1PR1A 1N8RW 3A1NA 1GCAA 4C7UA 1NAHA 3LSYA 4TXHA 1YZFA 1IUOA 1FFAA 3GMSA 4PLTA 2ZR7A 2J3MA 3E5NA 3C3TA 1QM5A 1U65A 1J7KA 3KJFA 2BP7A 1M2NA 1U0NA 4HPWA 2IA5A 6REQB 1YIJV 4PRLA 2AQIA 4DV1O 3RU9A 5JD4A 3DC6A 3AIOA 4N3AA 9LDBA 1XEWX 4KBGA 3LK7A 1ZH6A 3F3YA 2PUGA 3X1XA 1C7RA 4E33A 4YRBA 1QLEC 2ONJA 1PR0A 4LZLA 2OKGA 2NTYC 3Q5EA 3HPLC 1QKKA 3NOQA 2VXCA 4DMMA 4XYLA 4JI5B 4J8PA 2DCMA 5BPHA 1GZVA 2VJQA 4KMOA 1OYOA 3UUWA 3GJ5A 4CEIA 3D7MA 3LVQE 2FEPA 1J2UA 5BQ5A 3CUUA 4HRYA 5L53A 4TLBA 3G8AA 1W4RA 3MBKA 4HD8A 4BXOB 4QARA 3TJZA 4N0QA 2I8CA 3HRKA 3JAMM 3KUCA 1SXGA 3SPXA 4E14A 3GRRA 2XH8A 1ZU4A 4EJMA 4N4AA 4HB0A 4L8VA 2L82A 4D8XA 1KEEA 3CMEV 5FTLA 3PK0A 1H6AA 4YYEA 3MD0A 2F64A 1HDJA 2C9CA 3INYA 4L74A 3V7EA 1L0LH 3LUDA 2R44A 1OIVA 3A2LA 1J9ZA 3IMKA 1F8YA 3V2HA 4MVZA 5KYGA 3DEIA 3O1HB 1O4WA 3VMFB 1H5QA 2VG8A 4J7KA 1QAOA 2EVWX 4RYLA 4WRRA 1US6A 2M2IA 4Z2AA 3KR9A 2W6MA 3NTRA 3WGUA 4A0HA 1XVUA 1VKOA 1UKZA 4XASA 1F51A 2C7GA 4QUBA 4YJGB 4PLGA 2JI6A 2JAPA 1YRLA 4YAGA 5HZKA 5DNCA 1U2ZA 1SKVA 1O1YA 4P9PA 1VG8A 1IBKB 4RD2A 4BQFA 4D6XA 3QO5A 1I2MA 1NP7A 1XP8A 1HURA 4NCKA 4YAEA 2FW8A 1GSOA 1M33A 2DP4E 4R69A 4UOZA 4E3ZA 4BFZA 1UJ5A 5EP3A 4D4IA 3LC1O 4ACBA 3GJ3A 2YIVX 3N05A 2XA9A 1WZIA 2JCVA 2Q4PA 3E86A 4MEAA 3RRZA 1YXMA 1LNSA 5AKEA 3QU5A 1U4OA 4GOND 4NCNA 1SKYE 2BH2A 3D2LA 2WJJA 1IY2A 2L18A 3V8QA 4B3CA 5EBLC 4AY3A 2QRQA 1WY7A 5F23A 3LLVA 4M6WA 2YI9A 2LV8A 2PFSA 2EKDA 3RSGA 5LUAA 3O92A 4W6ZA 1FYXA 3CX3A 2I1VB 4KYTA 4ZEMA 3THXB 2R1TA 2HRZA 4IOLA 3DBRA 1WJGA 2XTAA 3LQ1A 1DRKA 4GPTA 4FOTA 3WBFA 3BG5A 3I53A 4YT2A 3FFMA 2KQUA 5MHTA 4OGLA 2R7MA 2FGKA 3UK6A 3URKA 3EAQA 3L8ZA 1X7PA 1IIRA 1I6WA 5I7RA 4IHAA 1UC8A 2G77B 4QOHA 5CK5A 4XGQA 4EEQA 4RIEA 1R0LA 3BEDA 1CR4A 2UZ3A 3OPVA 3SBEA 1SZJG 2ZIXB 3L73H 3PRYA 1KY4A 2IY9A 3ZCQA 4O5OA 4MNTA 1WBDA 4TXMA 4G5GA 3OGIB 5HP8A 2CTWA 4JYAO 4DCTA 4DWJA 4DRXB 3AFGA 1I3OA 1EFHA 4GNRA 3PB3A 3TTYA 2WHPA 2O3QA 2QD3A 3GAAA 4C0KA 4JLBA 3O8NA 3OQNA 1SC3A 1AXRA 5C5CA 3H1IH 3FPSA 1AG9A 3CW9A 1V4VA 3LT4A 5C7IO 4GL4A 3N2GA 1JR4A 2GDZA 2CZQA 2X8LA 3MQ4A 4Q05A 4ZI3A 5AKIA 5T4BA 3OJ0A 2CL6X 4RY0A 3UAWA 2PS0A 4OBBA 4KQMA 4CN9A 2MSKA 1YGYA 4OFWA 4YBRA 3BK2A 4Z86A 1NN0A 3HABA 4HLUC 1AZTA 1AQNA 2VAMA 4XD2A 1A97A 1PYDA 1G5QA 1Z4LA 1L5LA 2NUTA 3HSKA 4J16C 2ZF8A 1E3TA 2QLNA 1EUCB 3H9QA 1N5RA 2MIIA 4EKEA 3FFTA 4ZICA 4CWAA 3EVNA 3ZRVA 1K66A 4QXRA 5HXAA 1QAQA 3D8SA 3I2KA 4ZCRA 3W4KA 3EEFA 3IKFA 2JJ2D 2Z0AA 5EZSA 5KDOA 4UHHA 5L8VA 3VKFA 3LRPA 3HA3A 1IQ0A 1ORRA 1JMVA 1VJ5A 4TRRA 3ZLUA 3T8YA 4AP9A 1VL6A 3N8KA 4Y3UA 3NRBA 4RAQA 4JLJA 3TTXA 4BZQA 1HTWA 2ATCA 3ROKA 1NU6A 2PTGA 1XVIA 3ENNA 1E1RG 1NVUQ 5T67A 1G8HA 2WFAA 3AG2C 4EI9A 2XVZA 1HLDA 4MYCA 3IFSA 3KV3O 3E8MA 4H31A 1YF2A 1RYNA 4E5MA 1U9IC 3TKAA 1PJAA 3LLMA 2FOIA 5CITA 2O0LA 1IOVA 3M6XA 1YJWV 1T91A 4BECA 4HVTA 2B61A 3H2JA 2YVAA 4J4BA 1M9NA 5JYCA 5KTNA 3JATB 3B52X 4Y2VA 4GZMA 4Q01A 2ZCUA 1WZCA 3FAKA 3ZNPA 2FDXA 2BUCA 1OE0A 3IAS1 4L9WA 2ZWPA 3RHZA 1C1XB 4IXNA 4DEXA 4CDRA 1XJCA 1LWNA 1V16A 3R7FA 4BBZA 2X2FA 3Q12A 2OQ2A 3AX6A 4JYMA 4BEWA 3BMCA 5IAAA 4EHNA 2BKAA 4CLOA 2X6RA 1FZTA 4DNFA 2Y2UA 4CHTA 1JPVA 4XLTA 4R8MA 1PWZA 4QUJA 2J9RA 2G76A 4V02A 3WQSB 2X0KA 1OSNA 2PAAA 2GUGA 1IBCA 1Y5MA 2FUNB 3SC2B 1GGFA 4WERA 4MUMA 1A9XB 1P2SA 3KL2A 3LFTA 1IJFA 3AKEA 3TG8A 4YRNA 3LLCA 1JDVA 1AKRA 2I4RA 3IKMB 1J25A 1EQAA 1JVMA 3CPEA 5EQJB 4PYNA 1R27A 3PYMA 2QLJA 1GDTA 1DO0A 5CA3A 3A0HZ 1PHRA 3IQWA 4KFTA 2WNSA 1VPDA 5EVCA 3JCMM 2DHEA 4M0KA 1RJDA 4JNKA 2WP0A 5F2OA 2OECA 1SQSA 1I3KA 2VZEA 3DL4A 3CLSD 4JI8O 4CTOA 5IEBA 4FGUA 3OE1A 2XGGA 1VDMA 3TQQA 3T9CA 2AMFA 4BLVA 2OBBA 2B8NA 3HKEA 2CNBA 1UP7A 4QYIA 5BOSA 3SJBA 3HFJA 1V48A 4FVMA 1QG4A 1KKLA 4C7XA 4PAWA 3WDLA 3SZOA 2Y05A 2EZPA 4BNLA 2TMKA 3QEMA 3EN0A 2Q6OA 3QX7A 3ESRA 1X59A 1U2EA 3OKPA 5FUYA 5MN4A 3I0ZA 3VHXA 3SZRA 3PYXA 1OAOA 1DK1A 5AP9A 3AHFA 3NM5A 3SC6A 3TCNA 4DILA 3B82A 4I08A 2A9RA 3ST7A 3BHIA 3PSHA 1SCUB 4CETA 2VUHB 2Z4RA 2PR2A 4MR9A 1S5JA 1RPJA 1XFDA 5LD2B 4G2KA 1D2RA 2X77A 5C4IA 1AQ6A 2VNKA 1YZQA 2VJMB 2ZYUX 1RPTA 7ABPA 1F2TA 1E2JA 3Q6MA 5AJYA 3S6JA 2P27A 2AFHB 4KO4S 5LJIA 5CBKA 4LFCO 2VQ3A 5K3FA 3LPAA 3H6KA 2M6YA 1U5AA 3AL0C 1KGSA 3RVDA 2DQKA 4CLEA 4LV8B 2J67A 1ICIA 3NHSA 2X42A 1M5IA 3CRAA 3GD7A 3CZRA 3V55A 3RA5A 3A0UA 5G0WA 1ATIA 4QHYA 2ZJZA 3S27A 1B23P 5DE3A 1KJZA 3TPCA 5EHNA 4IHJF 4DCMA 4RWEA 2ZUTA 2IKSA 3WGMA 5IFLA 1V9CA 7ADHA 1KC8W 2I78A 4G4SP 4B5LA 3ZXUB 4G24A 4DR4B 3P9KA 6ADHA 1XAGA 1AF4A 4GPIB 5AW4A 1GQOA 3R4CA 3GN1A 1XEQA 3R7BA 4Q6GA 5JS2A 1KP3A 2Q3FA 5DI3B 2LGWA 4LF4O 1UOOA 1WQ4A 1DC5A 1Q19A 3VR4A 4AZVA 1W30A 3F67A 4ND8A 5K3AA 3HG7A 1E77A 4M0MA 3DDHA 4I5DA 2B4TO 1DDGA 4IIVA 4F3KA 4X62O 1XAHA 3ZKWA 2VCHA 3KQVA 1E7MA 3ETLA 3L01A 1CY0A 3OF2A 2FUG1 4WZBB 4EEKA 2GFHA 3PQ3A 2HK9A 3CF4G 1P8AA 4L85A 3U1VA 1HO3A 1PSWA 3H19A 2JHFA 4PV1B 1FL9A 1VXRA 1DDOA 4M55A 1U3GA 2BMAA 1CUCA 3RC8A 2G6BA 1K8AW 2N74A 4JELA 2O2CA 1ZMRA 5FD8A 4AJPA 1ZU5A 3B13B 3GCZA 2GTHA 1QLHA 2IXTA 1C1YA 1SMKA 1E0SA 1H8HD 2GRAA 1ZMXA 4TUYB 1OU0A 3QPUA 3ZCSA 2R8RA 2OC9A 3ZKAA 2QORA 2YFKA 3LUAA 1ZGCA 2B34A 1O89A 4BB5A 4MMZB 4ZOLA 5ELXA 1DTSA 2FMTA 2QI9C 4LRQA 4J4TA 4WY5A 1XRGA 5K3DA 2JGEA 5JS6A 5B3AA 2B6NA 4EUKA 2D2FA 3DAOA 4LOAA 2LNDA 2VNJA 1VIMA 2V4DA 1X9HA 3G8CA 2VSXA 2CMDA 2DQSA 2I6GA 2IYLD 2XQIA 4I1OA 2IEBA 7AT1A 4MQ4A 2GXUA 1BQEA 3BF8A 3B3AA 2JD2A 4UU7A 5T5QA 1QAHA 4IR7A 2SCUB 2V54A 4BGUA 2CJYA 2QD4A 3KU4A 4URVR 4G36A 1FMFA 3SWWA 3ZHCA 4IG9A 1OHHD 4HGOA 4J11A 1MOZA 2REXB 1TJYA 3O94A 2Q2QA 3D4PA 3C1TA 5EHGA 1RHMA 2IJGX 1T1RA 3ZBHA 3LT0A 3B78A 2A9KA 3NAQA 4PICA 1KAGA 3RK1A 4LYFA 3K1AB 3VHLB 4F93B 2Z3VA 4UFZA 2CXNA 4E4TA 1KAEA 2G07A 3H8WA 3TBHA 2FN7A 4G85A 3D8UA 2NUAB 3ZR4B 2H2FA 3FMOB 4O3MA 4B3IA 4OH7A 3P7MA 5LJLA 3ACCA 4Q18A 4MP8A 1O95A 2YYZA 3BJZA 3CJHB 1T3TA 1XD2A 2YIMA 3WYNA 2WAOA 3D64A 3Q9LA 5K3OA 5B1NA 3CRVA 3FW1A 2Y6UA 2ZTLA 1AS0A 4WLUA 4HDMA 2Y1OA 1E1RA 2PX0A 4HH0A 3RKUA 3HWUA 4ZVQA 3N5KA 1YI2V 5H8WA 1IZ9A 1P3JA 3CRMA 2XLCA 3NR7A 4BMPB 4UB8Z 4ZC8A 1GGMA 3G2QA 1SXHA 3SFZA 3GYQA 1K4YA 2CVHA 4FHCA 2C04A 2DLNA 1U90A 2G17A 3CUSA 4KQGA 1RAGA 2WE8A 4K8OA 4JTDB 2IZZA 3R75A 4WADA 2HA7A 2AE2A 3ZEIA 3FZQA 5EP2A 1VP7A 4QE3A 4E5SA 1I7PA 5HWSA 1Z7GA 1QGYA 3UYKA 2PYJA 3PXBA 4JCOA 1TC2A 4BFVA 3STZC 2W11A 4KU4A 3C41J 2OZVA 2PMFA 4J42A 3LM8A 1ZYUA 1RC1A 3V8MA 2DTDA 2JRLA 3NBAA 2J5BA 2DPYA 4BCCA 4QRHA 5J5AA 4GWGA 3TIVA 1RS0A 2OCBA 1YJ9F 2IIPA 621PA 3GH3A 3O4RA 1S9DA 1ORHA 2MR6A 4EX7A 1QLEB 4OPHA 5TT0A 4Q02A 4C07A 2A0XA 4LZAA 1DT5A 2H06A 1JPUA 3W7SA 2XNKA 1P18A 3F6BX 4BKRA 4XFKA 2XQGA 4GKAA 1HZJA 2FW0A 1G1XB 1BU8A 1XRPA 4KR3A 1EE1A 2HCRA 3TR5A 2BBWA 2GBIA 3CNBA 1TMKA 2PGIA 3QFRA 3DL7A 2ANCA 2OWDA 1BC5A 2C1XA 2XBLA 4L7VA 4ESVA 1H4SA 1WPQA 1VH8A 3EDOA 4TPKA 4CF4A 1SBHA 4HSGA 4EB8A 3C15C 3V8PA 3BA9A 1VPVA 1OKKD 1R1DA 1H8ED 5HWEA 1XMOO 1LBIA 2BHTA 2HWYA 4JAUA 2X0FA 2QT9A 4L9RA 1T4DA 5C1PA 1K92A 3AG4C 4CKZA 3S68A 1TFUA 5HRUA 2H52A 4HNUA 3OTGA 4RXMA 5DHPA 2A3RA 3CZ4A 4ZIBA 1Q0HA 4BAUA 2X40A 4EI2A 3NV7A 1CVIA 4ADSG 1OH8A 3AF2A 4HJRA 4CGYA 3L05A 1CR2A 3GFOA 4Z49A 3NAMA 3H2SA 4YP0A 2E4AA 3PNKA 3BXFA 3BB4A 1IHYA 5FWXB 1ODEA 3JPYA 1VHJA 3CR8A 5KUKA 3BC1A 5ECDA 2ONKA 1QVAA 1VL0A 4WV3A 3UH1A 5HJ2A 4J0IA 3H9BA 4CU2A 4X24A 1SUAA 3EFOB 3R76A 4F06A 3E5HA 5FNVB 4RK5A 4Q9KA 2OV8A 2QR3A 2D59A 3PVSA 1ODLA 2GBLA 4NP6A 2ZI9A 1GM8A 2UXDB 2L17A 1JHVA 1XNGA 4DUGA 3C6MA 3NHBA 2E87A 3IPCA 4PINA 2Z1MA 1G3UA 4EMBA 1PVVA 4NS1A 1A5BB 4R50A 3PL1A 2EQ5A 1U1DA 3BAAA 4J1NA 3P1JA 1T1EA 4D1YA 4N82A 3JVHA 1K7YA 4NULA 4HQFA 2EBOA 3ROTA 3M0EA 3NP9A 1UEJA 4BRZA 3NCTA 4DCCA 1DTOA 5DN9A 2XWSA 3MGCA 1EFVB 2QLBA 3KXLA 1G17A 3B09A 3VJKA 1NJGA 2AIRA 3JARB 4KXRA 1F1JA 1UFYA 4S2UA 2WT9A 2FZWA 3OY2A 4HGPA 1KMMA 3AFHA 3K0GA 5JVDA 3CF4A 4YQFA 2QNBA 4XH9B 1R50A 5BNFA 4NCXA 1GDDA 3OEWA 3M1LA 4OXIA 1RW4A 2ZIMA 1FYVA 1EWKA 1Z2OX 3D4LA 4Q34A 1LW6E 1MNGA 3IIMA 1QZUA 1WTCA 1TGYA 3TW8B 2ODAA 3RF7A 4EGFA 3QUQA 4HX9A 1POXA 2VHWA 4X54A 1XN4A 1OXSC 3UYLA 1G8GA 3OIGA 3OEHD 1HC7A 4JLNA 4ER6A 3JAKB 1H2KA 3FGZA 4JL8A 1CHNA 4KJXA 2O07A 2O6LA 5TPWB 3JVIA 5HQ3A 4ZCSA 3GCDA 1H4VB 4PG6A 4RH0A 3AIKA 4ZDIA 3VISA 1XJ5A 4QXAA 3PDIA 4D4MA 4YEDA 3D6JA 4FKZA 1UKVY 1IXRC 1M3SA 1AROP 1RMQA 3OQPA 2Q46A 1UPCA 2XSZA 3EOAI 2XCTB 4OATA 1C2YA 1LFAA 5C8ZA 2XMQA 2XUAA 1M56C 4YA6A 2OL4A 2BFPA 4BP3A 5IVKA 2AWNA 4P5EA 1SM4A 1NX6A 1PTJC 3O8OA 4YRJA 3DM9B 2CHEA 1BEZA 3Q7RA 4IIDA 4I55B 3VOSA 4QGHA 3QPWA 4CG2A 1VZ3A 5EPUA 2E55A 1BRTA 3K35A 4L0CA 2Y2VA 1OCRC 3SPCA 3DA8A 1TAQA 2IZ1A 1XWIA 5ECYA 2J5QA 1S02A 3JQDA 1CVRA 1WMSA 1N0VC 2BCCH 2YR0A 1AUQA 2OFOA 2J7KA 3KVOA 2YHUA 1XCPA 3PFHA 3R8FA 2E5LO 3L1HA 1X87A 1H2NA 1V25A 1RWBA 1HEYA 3AG2B 4QEDA 1DEAA 3TCKA 1DCMA 1U2DC 1M1ZA 5M5BA 3IUNA 4POOA 5J3JA 3GRFA 1M6HA 4X94A 3WGZA 4B6SA 3OH8A 4B31A 1DBFA 5BNWA 3S06A 4F3NA 2IDZA 5KKNB 2HRDA 2PUJA 5CX4A 3JQ8B 5CFNA 1Z39A 1PBTA 2Q62A 4BV9A 4ZEXA 3UH0A 3UV7A 4OUKX 5K99A 3RJTA 2VA9A 3U9TA 5G1PA 521PA 3QVMA 2IHVA 5DGTA 4RMIA 4JV5B 3R3XA 4PRKA 2A1IA 3OQIA 2QROA 3RYHB 1J9GA 3ZHOA 2Q21A 4TKVA 4ZYWA 1XRSB 1KOLA 3ZY6A 1ZNQO 2GVZC 1ADYA 1GNLA 1FFYA 2R86A 4RF5A 5ALKA 1SUPA 1CRLA 1ZK3A 4PZLA 2XCOA 4UMDA 1FSZA 4YWJA 1JI0A 2H00A 4FILA 3GNTA 2BCEA 4WKPA 1VQLV 4KPFC 5KJFA 3I01A 3QLTA 2PZSA 3V4OA 3SYAA 1Q81H 3FIJA 2QXUA 2CVLA 3CPQA 3U3XA 4WK4B 1YULA 4L4YA 1H2EA 3K12A 2ZYRA 3O4VA 1XCOA 1PD0A 3AZOA 4RE5A 2PU7A 3CCQV 2ANBA 4RD1A 4PGHA 4I9UA 3L84A 2H3EA 2W0SA 2BZ1A 4U2DA 3CE6A 2Y1XA 4FGJA 4RZHA 4MSUA 4FT4A 4C01A 4E1BA 1NJIH 1Z2NX 4DAEA 5IXSA 5E38A 4HDRA 4M21A 4JH0A 3F97A 3MTIA 2XECA 2A0UA 1JJ2F 3OCCA 1DTEA 1XL4A 1Z7YA 3D31A 3M2TA 4KDRA 3JYLA 4S12A 1ZWZA 1YVUA 3H8VA 4RPKA 2R6R1 2HP0B 1ECGA 1LS1A 3LY8A 1ZX3A 4ZCLA 1IWBB 3MBIA 1RJGA 2QTWB 3MFYA 1UK7A 3NVMB 2CMHA 4AM8A 3OZIA 1F0YA 2GK3A 2JEYA 4DWOA 4PQYA 1F8UA 1EM8B 2JFUA 4XOUA 1P9OA 3A4VA 1JX6A 2VHYA 3MJ4A 1C2TA 3L0DA 1DC6A 1Z0DA 1L7RA 3QFFA 3E20B 1AKEA 1RCTE 3I5MA 4G5QA 1P9RA 1MV5A 3TSZA 2H3OA 3HWX1 2V7PA 2ZUSA 4F9GA 3IGAC 1AGXA 1J8VA 2NVOA 2R4TA 1AKQA 5ES3A 5C53B 1WTAA 4U8GA 1SCBA 3ABTA 3KCQA 1FFHA 2ZSEA 4U3FH 2E75B 3JD2A 3OW2U 2PI5A 1KOFA 3L0ZA 2VS1A 1P4JA 2J9YB 3W3ZB 5CA1B 2BFWA 2ZUVA 1LI7A 4X1IA 5JS8A 5AD1A 5ETJA 3ZZTA 4I8XA 2GPNA 1BOOA 4E7PA 4AJKA 4TYNA 2DEUA 1L5MA 1FTYA 2YV2A 2G0TA 3PEEA 2O8DB 2PF4E 1Q8IA 1FQWA 3KUDA 4Q7QA 2B36A 2JIRA 3EUEA 2O2GA 2ZRNA 1RPNA 5CBPB 3D3WB 5A7FA 2ISSD 5J4KA 4KLRA 1KNKA 1WSWA 4TTSA 3N1UA 4TT3D 3A9TA 4TLCA 1U0TA 3G2LA 1DFHA 1YAJA 2RHCA 2GS9A 1MRZA 3H04A 4FDMA 3TFWA 1SHKA 2CLSA 1JR3D 4A6PA 5GGYA 1YSCA 4LJ7A 3PHHA 1F1BA 1W581 4XGIA 4NXNB 3L6OO 4OUDB 2V7WA 4Z0PA 1LLUA 1KVUA 5KSOA 1ZC4A 1BQZA 3Q10A 3SJAA 5JNLA 4O8ZA 3I39X 4G81A 2DM6A 4PWZA 1PEDA 3R4VA 3V4ZA 5DEOA 2Q3CA 3QE9Y 1R66A 3M83A 4RF4A 2FK8A 2HIAA 2VBCA 5EXEA 3WLQA 5B53A 5CCXA 2EJRA 3GLFA 4XWOA 2EZ8A 2QPAA 3L0PA 4MRSA 3ASZA 1LK7A 1X7DA 2EG5A 4F7WA 1HDRA 1JAIA 3RJ5A 1LBEA 3FX7A 3IPLA 4BVGA 5CYFA 1U80A 1DQPA 2CNLA 4PNHA 3VAZA 1H2RS 4D56A 4H1UA 5BVGB 3MWEB 3X1ZA 4YIKA 4RPJA 4NU6A 3IP3A 2C9YA 2Z8YA 4TL6A 4UTOA 1WB6A 2C57A 1P3DA 3B8MA 4B4UA 3RJ9A 4ZFNA 2Z5VA 3DBOB 4PV7A 3V8NA 2JFBA 3KOZA 3IX7A 2GFQA 3DPSA 4DSUA 4R2KA 1NQAO 3PBKA 1B42A 3GLGB 1SVOA 2PM8A 5TT1A 3F78A 4CLHA 4IX1A 2FSGA 1S8NA 1TL7C 4IDNA 1VECA 4NTWA 4IJVA 3G8BA 1ADGA 2R2AA 4D43A 2P2CA 1NUPA 3CVUA 3ENVA 1ZQ9A 1JEAA 3L4BA 4I3HA 3ZWDA 2AHZA 1P1BA 1Y7HA 3LGXA 3RYCA 4HPXB 2NU7B 3QUWA 2Y4OA 3K5OA 3K2IA 2XYQA 4OQLA 4UULA 4C8GA 3EHEA 2ZBVA 5KKAA 2RQ6A 3B9RA 1NV9A 3KKNA 1XC7A 3LUCA 3LWQC 3IOBA 5AFSA 5LP6A 2A5FA 4NDNE 3LSQA 5CVEA 1UBCA 3U0VA 1YB4A 2ZOVA 4MLDA 1KP9A 3OUTA 3WXMB 3D8HA 2BFBB 5GY7A 4YRPA 2D62A 1Z33A 2EL7A 5FYQA 3T5DA 1YJBA 1UKCA 2Q4OA 4KN6A 3ISJA 3WJRA 2AEFA 4ZHQB 1VA5A 2AF3C 4FDUA 4FFRA 3MJCA 5E2IA 2B92A 3FPCA 2NU6B 13PKA 5JJ5A 3LCJA 4R6XA 2ADPA 4J2OA 3KQPA 3W2HA 4N7JA 2C42A 5TF0A 4M36A 3AM4A 3MLBA 1XILA 4UUJC 2XQVA 1KMQA 2HCBA 3U13A 2GEFA 4GFDA 5FB3A 3QVSA 1BEEA 4Z99A 1YEWA 5GZ6A 5ADWA 3CVVA 4TXLA 4ODIA 4X1OA 5JOQA 2AW9A 3BKWA 3UO8B 1LZLA 5EESA 2BMVA 5J9FA 2BGTA 1B6SA 2Z1TA 2A5JA 2RONA 3THWB 2H0RA 3E4DA 5IAJA 3FKSD 4NC9A 4KMMA 4X1KA 4AKEA 1Z75A 2HK6A 2VRNA 1ZUIA 4M0PA 2I03A 3WB1A 2V0NA 2R97A 3WLSA 1GDHA 4DLXA 2PV7A 3TE6A 1KJ9A 2W2VA 3LWVC 4JI0B 1H2FA 3L7NA 4PZ9A 5CHYA 3L7LA 5B2EA 1ML4A 4NYJQ 2EKBA 3A1UA 3H65A 3ZY4A 4JLMA 4D57A 3A6PC 4F4DA 4BVTA 4B3RB 1K9MH 4R6ZA 3RSZA 3BCRA 2A9PA 3R8XA 2P11A 4JR2A 1OJHA 3T1HO 4PC1A 4JZ2A 3UGQA 3IKLA 4CHGA 3JAMA 1NC1A 3TMAA 1GPBA 5EP1A 2EJWA 2WICA 2WWTA 4D4HA 3GT3A 3VNVA 4P53A 4FZRA 4YUXA 4ENWA 2XYRA 5GTDA 1PS0A 1JQKA 2X6BA 1NJ2A 2OCYC 5K1XA 1R8SA 1NKSA 1NYLA 1GLNA 2GTIA 4FLEA 5FAKA 2ODEA 1H4TA 4CTNA 3AY6A 4EBBA 2N75A 5DBIA 3FKQA 4I0XB 3I6QA 5BV2P 5CK4A 4KXUA 2J0VA 4HOYA 3UA4A 2ZPTX 3FTEA 1YDGA 4Q4AA 3ZIAD 3ZCTA 3WLPA 2FMXA 2WKSA 4MROA 1BXRA 1ESNA 3DTNA 3KR0A 4BLWA 1A69A 4YMIA 1W1WA 1HNZO 4RA9A 3T5PA 3QY9A 2OCLA 1T2NA 4HYOA 1ZSYA 5GM2A 4O4LF 4TS1A 1PVOA 1E2MA 3KJEA 1QRSA 3PC2A 2QTVA 4DCOA 1XVTA 4TVKA 1NW5A 2DR2A 3TJMA 4A3SA 1YASA 1TUBA 2P9GA 3ADDA 2OQVA 3E58A 2FVXA 3LK6A 1DEHA 3AZQA 5AHWA 3TKYA 5LNK1 5FBLB 4B62A 3KKOA 5FLYA 1T0PA 1T2FA 5EZYB 1XX6A 2E4YA 2ZR0A 2P2LA 4PO8A 4AQDA 3PDJA 1DKRA 5I45A 3UO3A 2OUKA 4MS4A 3VSDA 4YJFA 4NZOA 1YBMA 1GO3F 3TJRA 2O19A 4AUNA 4N7BA 1DI0A 4XDHA 1IY9A 2TMYA 4P3OA 5EWLA 2WLLA 3H9EO 4QBIA 1JDUA 1JLLB 3Q3VA 2O4CA 1K8QA 1GVHA 4P83A 3ZDDA 1PYOA 1P2VA 3SPIA 1E2BA 5CJPA 2XEXA 5CX1A 1W49A 3A11A 4PG5A 2XGSA 2MK3A 3MRVA 4D2IA 4XPIA 1NLYA 2PCJA 3RVKA 3ZNQA 4D6PA 3GHZA 3T0IA 4ZKDA 4ACAA 3JRXA 1J00A 2L2QA 4PX5A 1T29A 4ZPXA 1JKJA 4B76A 2EIKC 1E94E 2OESA 1E69A 5CEJA 3ZCPA 1R0SA 4XVQA 1ORWA 3MDOA 3KLMX 1OI2A 4DTIA 4CKEA 2Q3JA 1N0IA 5JADA 4UCVA 1NT2A 2OORA 3MCTA 1A82A 1YIJF 3EW7A 4BO6A 2PGGA 1OTYA 4FHFA 3DEAA 3W3AD 4OKSA 3TIGA 2GJ8A 4CS3A 1TF2A 2P1DA 3L7DA 2AKYA 2C2WA 3HK2A 2PKCA 2WKPA 3UWOA 3L02A 1NVVQ 2OK7A 3MT8A 2HPZA 4S2EA 3E1YA 3WIOA 1N7IA 1M90H 1QV7A 3PICA 5IKMA 4GRDA 5KINB 1RYHA 3WLNA 1OC2A 2BZGA 1KQGA 3DV0A 4QDXA 3V7NA 5BNTA 5AJXA 4FEYA 5EBWC 4UBKA 3ZDEA 1CUIA 4A0QA 4FFKA 5B6PA 4Z0HO 4G65A 4L76A 1M2OA 2O06A 2IYSA 1UIMA 3CB4A 3F4LA 4UCTA 4XD7D 1QU3A 5HILA 3UANA 2DLDA 4CN8A 3E3NA 3LPDA 4XOIA 1I24A 1RAEA 2IYPA 5P8WA 5KTRA 3CMEF 4N3GA 1W4ZA 3NHFA 1XUQA 2PKRA 3N4YA 4BX9A 4OMDA 5TQJA 4EQZA 2LIVA 3RSCA 3STWA 2D5BA 2NSLA 1E8DA 3AVYA 1N36O 2V8BA 3TTTA 1GTVA 5IK2D 4K88A 1PJZA 3C3KA 4JQSA 1OB2A 3WMEA 3AB7A 5FFNA 3KQSA 3CLUC 3H8JA 4RQEA 2GJKA 5LP1A 4C4ZA 2Z09A 3RFUA 1M56B 4CKYA 2NU9A 4NJMA 3ZMTA 3S8EA 3LXRA 5I01A 1QLNA 4X95A 3QIVA 4IKPA 2QVBA 1F4VA 3SE7A 1Y6XA 3JQGB 5AHKA 3AJAA 1SHLA 2MSDB 1GSAA 1P73A 4CH6A 3IT3A 3M6VA 4IFIA 3S40A 1MC4A 1XXHB 4BJHB 1OCRB 3WC4A 4B47A 1CUXA 1JQEA 4ENTA 1C8VB 3FYEB 2BDTA 2GXAA 1SIWA 4FLMA 3M82A 2AC2A 4C3VA 4H18A 1GR0A 4KP4A 2A3NA 4BNTA 4HTFA 4US1R 2PJUA 4M88A 1VE5A 4BNDB 1JBKA 1TJ4A 4ZAWA 1KQFA 2ZJ6A 4IS3A 1DPFA 1RPRA 3T4EA 4J4HA 3KQNA 4D44A 2JHGA 3GBVA 5FUQA 4W8OA 4MSWC 1P8JA 3L43A 2QUBA 4QWWA 1GO1A 1Z29A 4FX5A 2A9OA 3AUAA 2ARKA 4J07A 1PNQA 1GPLA 1W5TA 3SY8A 5BXZA 4F9FA 3SCZA 2OZLB 2GARA 3K5HA 4FLVA 3AUTA 2GCGA 3MNFA 1NY5A 4KIWA 4X8HA 3I05A 4F2DA 2FR1A 4KKXB 1EGVB 4WJZA 1A7JA 5DYGA 3A1CA 4DLUA 2PUEA 1L4GA 3QELB 1MTZA 3CXRA 3LQFA 5L3RA 3U3KA 2IELA 4UDYX 1YR1A 2PZKA 1E6EA 1DF4A 1QHYA 4JVMA 1OBVA 4N12A 2IGTA 1G21B 1ODJA 4KAXA 1G8AA 2B0JA 3JCUZ 4PAOA 5BSUA 3VJLA 3VIUA 3D6UA 3LRTA 3HXQA 3DTTA 1KO7A 2VDUE 5DW3A 5HOQA 4RTOA 4OQXA 2QN1A 3OCVA 2A7WA 3LOUA 2P5UA 1KSHA 5EWJA 4H6XA 1SC1A 3B89A 2VPQA 3PQFA 2EFDB 4MKZA 2JZOA 2X0DA 1WO8A 1GNTA 4ML3A 4Z9FA 3DZJA 3RHTA 2PFGA 3FFAA 1Z74A 5DDIP 1U2QA 1ZMBA 1DIOB 3JYCA 1RAIA 1U7WA 2V3VA 4FK8A 3FYUA 4HX5A 2WVJA 1QZTA 1STOA 4BBPA 4UOEA 3UF0A 5HY1A 4CIDA 3A4NA 2WWXA 4PG4A 3A7EA 5HR5A 3VO9A 3EJWA 3BM5A 4WKCA 4G9BA 3IAYA 4L07A 1YI8A 2TECE 4GM4A 3SQDA 2C7QA 4IEEA 1EGMB 4GYCB 1S3JA 4B4VA 1W36C 4XDZA 5DK4A 5FUXA 1FPQA 2ZSDA 1OBHA 4TLAA 1YS4A 3RRJA 2D74A 3FLEA 1G42A 2D00A 2YN2A 1QVWA 4QQ8A 5AW3A 1GNSA 3ECCA 3LNMB 3L70H 1XK7A 2QRKA 1PJ3A 4J90A 3QW4B 4LDPA 4BYMA 1SKBA 4IFBA 5HMMA 2BLNA 3A06A 2DKOA 3U4CA 2JJ1G 2X6TA 1FS4A 5IULC 3VR5D 1W19A 2FQWA 2WTMA 1PL7A 4DR6B 1K2WA 2WV7A 4OI1A 4OLFA 1XGKA 4R8CA 1YOVA 4OAQA 3Q7SA 1V3TA 3DCJA 2V7TA 2EX0A 1FQJA 2C20A 2IYQA 4ES6A 5LMNB 3GEMA 3DEJA 3NC0C 3G5LA 2RARA 2RKOA 5TQ0B 1U6IA 2V7QG 3CLTC 4Z2YA 8ABPA 1YJWF 3DLBA 1DIGA 1XEXA 1Z0IA 5ICEA 1P4HA 3RD5A 3PA8A 1TT5B 2AMTA 2O23A 4BP9A 4WLNA 1N5DA 1N5MA 5JC8A 1XCLA 3GYGA 4KACA 3C16C 5KYVA 5IC4A 4KJZA 1RRGA 3UT5B 2ZJ4A 1UDAA 4KGZA 1FFSA 2WM8A 2D1YA 1K6IA 2W4MA 1H2ZA 4ANFA 3ZMVA 4EYEA 1U1GA 2Q0OC 1U8ZA 1E0AA 1D2CA 1A8QA 2J0QA 3TGWA 3BGVA 4JUFA 2G5GX 2CTPA 2VQDA 1LDBA 5TMPA 1N2CA 3DAHA 3PQ6A 3BIOA 5J4YA 2VXYA 2R66A 4AG5A 4IW3B 4JP5A 4KXYA 1YDMA 4M9CA 4N54A 1R6DA 5EY5B 4FLTA 5BV7A 3JQAB 3HCRA 5FBZA 2F3UA 3CV3A 4GOKA 3OBYA 4QUGA 3S3WA 1Q11A 3H05A 2QJRA 1JZQA 4QXQA 3WRYA 1FTGA 3NAZA 4C87A 1ZCJA 2H6EA 2EJVA 3I9OA 2ZB4A 1XRNA 3R5FA 2HH9A 3OIYA 3EY9A 1E5TA 2MHCA 2NZ2A 4ZAVA 3U7JA 5DKFA 2NYRA 3PUIA 2XGJA 3CJRA 3DVRX 2BEWA 3INNA 3QNWA 2Q5QA 1SVWA 1T25A 1BX3A 3DMTA 2JG3A 5LHHA 4A23A 2GPYA 1Z7WA 3RUFA 2HDNB 3ZTTA 3HLTA 1OBCA 4B6QA 4HWPA 1ZIXA 2NR5A 3LFOA 5FHRA 4BJ1A 2ITDC 4LFBO 1P4GA 1U81A 3D8NA 2OV6A 4OBXA 2EX3A 2CBGA 2JGLA 2CV2A 4X8OA 1PKEA 1W73A 2QX6A 3CKYA 3GCXA 4INOA 2IW3A 1O96A 3ABRB 5GJBA 2GVIA 1KYWA 4MW3A 2Q6KA 3TK1A 5F73A 1AKUA 1OFVA 4Z4CA 1P7BA 1EPUA 8GPBA 2NO4A 4ZQBA 1L4LA 2E5WA 2FWRA 5GOZA 1JHXA 2FX5A 4B3MB 6YASA 1Y76A 1T4CA 1AK2A 1OZHA 5B1AB 1UQRA 2X86A 5FV7A 1ILWA 2D2IA 1RM3A 1CUUA 1BHBA 1RI1A 3SQNA 4L5IA 2JFHA 3KJJA 2P9BA 3CLHA 2CD7A 5DZSA 1RE1A 2XE6A 4EPTA 1FS6A 2PZFA 4YX9A 5DCYA 5EFZA 4MPRA 4L27A 1SWVA 3ZE0B 3VOTA 4UW9A 3ULKA 4EHBA 2PJRA 3VPGA 2SNIE 3LCMA 5J40A 2BTEA 2JLYA 3K6RA 3G9UA 3GQVA 1EX7A 4JJ6A 4GPZA 5FPHA 4B6OA 1O94C 4XM1A 1DAEA 3QTYA 4ISCA 3BL6A 5IDVA 2AQ8A 1CQPA 3KYCA 1C7QA 2JGFA 3VDXA 3GFBA 5AHRA 2QYOA 2H0QA 4A2PA 2CNOA 5H5NA 4R2JA 1DIAA 1XRJA 4NBUA 2ZTUA 2YQZA 5F98A 1HT0A 2Q68A 3JQQA 3MSCA 3CHXA 5EXSA 1IB0A 4P5DA 3HI6A 3GAZA 3U3MA 4CM7A 3FNFA 3QFCA 4NR1A 1L7QA 1XV5A 4X65B 1QPZA 5HHTA 3WU2Z 1F2UB 2DFKB 1B6TA 4YP6A 4F12A 1R1BA 3KAJA 3QLVA 2AHOA 2CD9A 2P5SA 5D86A 2ODMA 5LKRA 5G02A 1G3QA 1UXIA 4AJIA 2QWPB 1AK9A 3EZFA 2GKSA 3KTOA 3E7WA 4AQYB 1D5WA 2GAJA 4WK6A 2BRUA 1I2ZA 1SG6A 3P2MA 2V6FA 4IL5A 3HKCA 1DB3A 1W1IA 3O75A 2LP7A 3DKIA 4RSMA 2Q4TA 3CA8A 1AQJA 1ZEMA 5ALVA 4EG0A 3ZVLA 2RJZA 1IQUA 3TTSA 3ZGYA 1SVSA 1I3CA 3R3JA 4Q7KA 4LXGA 2EERA 3HEBA 4UUAA 2P06A 4UCFA 2OYCA 4K0KB 4HBZA 4P3PA 1G7CA 4UTRA 2QTFA 4XPZA 1WEHA 4C20A 3QTLA 1NQOA 5KNLA 5LLDA 1RQPA 2BOCC 2VJNA 2LGQA 2C92A 2NWQA 2Y48A 1L4NA 1DEKA 4MR7B 1VL2A 3GZNA 5MGNA 3GIWA 1A4UA 4H59A 4CMEA 3B20A 1QQAA 2VN8A 1YHNA 1NW9B 1RZUA 4D9GA 4FHGA 3M1YA 3LDGA 3ML0A 3LSSA 1F51E 3MPOA 4YO8A 5G40A 4K2HA 1L8DA 2IZ5A 3T3OA 4WECA 4KC0A 3D54A 3CVJA 3BGSA 2QUZA 2Q5LA 2BTUA 2JLRA 2H85A 1S5HC 1E96A 1ZIOA 5LQDA 3TBFA 1PDOA 1MW9X 2G70A 2AUMA 4V0OA 3P97A 3DZFA 3GRKA 1A9QA 3H5IA 4DXAA 3RU7A 4A03A 4BT4A 3AEZA 1N2XA 4KRGA 3OD4A 2X9QA 3R40A 4QD3A 3MWLA 1IHDA 2OFFA 1KDYA 2XKJE 1D2DA 2JJ1A 1S3GA 3SR4A 1MTOA 4PFKA 5JNVA 1TLFA 4X71A 1IV4A 5DXFA 5B58T 2XAGA 2VA8A 3IDSA 1MG5A 1Q86H 1HYGA 1E6LA 6PFKA 5ITVA 4M53A 4NMHA 1YI2F 2P6YA 1G19A 1N8SA 4RHXA 4OHVA 5JAMA 3TB4A 1HMYA 3IBGA 2V7QA 4IJWA 3W3AH 2VT7A 4L6CA 1JJIA 1OCZB 1DRJA 1MO6A 3EAFA 4AI8A 5GTHZ 4RETA 5DM60 1MC1A 4FQ7A 4WUVA 2B6HA 5JJIA 5J2TA 1UBJS 4MWSA 1K5QA 5DTJA 3DOJA 1SXJC 1H2SB 2R7LA 2GM4A 2I3GA 5HY4A 4X7BA 1PFGA 1L1RA 3ASVA 4G86A 1AZWA 5FTNA 5C8YF 1WV0A 3CSDA 3W5UA 1MDBA 3OSZA 1HE3A 4W4KA 2EIKB 4X3CA 2WIBA 2QAGC 1VYUA 5ALPA 5AIBA 3HYSA 2X8AA 1EFAA 5BXYA 3VC1A 2D0IA 1YK0A 5ER9A 1JSRA 2ATXA 3FDZA 1P1CA 3AG7A 3ED1A 3ZV7A 1CUJA 1U8TA 1LNZA 2FFJA 2NXEA 4AJJA 4X88A 4RD6A 3SK0A 1PTKA 2OCXA 4E7OA 1CY1A 2J3EA 2ISQA 3C6BA 2CF5A 4DK1A 1ORDA 1C3OA 4ID3A 5JQGF 4RK7A 2VZ9A 5JCZA 4B4DA 4FFBB 5EJ2A 3RUEA 3HM9A 1WA8A 1HNNA 2L42A 4G9EA 4QOFA 4E21A 3QYPA 3DMRA 1X7OA 5CVTA 4XWYA 1XHOA 4XTCS 2KKWA 5BYAA 2DT4A 2XB9A 2YIAA 4DIUA 2XWJI 1GPKA 3V2UA 2NVUB 1XHEA 4RLHA 3D6HA 3HU5A 2P9TA 4MKHA 4TKMA 3D7KA 2FWJA 1A4XA 1WBJB 2R8PA 3DOHA 3E5RA 4LDJA 1I94O 3W5BA 5COQA 1XTKA 4JLSA 2P4HX 3HYTA 2VWPA 5E3HA 4LBEC 4E5YA 4PCVA 2Q6TA 2FRDC 4JGGA 1GKLA 2WJVA 3OTOO 5C9ZA 4TX1A 1ZICA 3ZHSA 3BCUA 2JAQA 3EIUA 4Q3EA 2LR0A 3MAAC 4DSAA 2N0SA 2P6PA 1OU4A 1F0PA 2CFCA 1AVTA 2GD0A 4QU5A 2HJHA 1MW8X 2RHBA 3KUKA 1IXBA 1E3LA 3O82A 2EG9A 5CCDA 4ZYTA 1ORTA 2YEVB 2VEOA 1YCIA 2VYQA 1R3JC 5KDLA 4E6PA 5K6RA 3E22B 1QDLB 1ZAYA 1FXUA 4Z4GA 3FRJA 3E53A 2ZFUA 4G0UA 3O8CA 2ILMA 3STLC 5K51A 3N0RA 3HUDA 1GA4A 4NBNA 1FRQA 1B0UA 5IAEA 4UPDA 1BQ3A 4HNSA 1JN0A 3W2EA 3SOZA 4TV8B 1C9EA 1J8YF 3VC3A 3U7EB 3A6FA 5EJ6A 1GNVA 2BSXA 2NV6A 1CBUA 4US2R 1HM5A 5FTWA 5CNMA 4GWLA 4AYTA 1BT8A 4EY5A 1X4TA 2WSIA 2IEYA 1ZI6A 4RZUA 2ZS8A 4PPQA 1AP6A 3E8BA 3B9QA 1QVZA 3G8DA 3OT5A 1WKBA 3NU1A 1W5BA 2A88A 4MDEA 1J7HA 2GHYA 3QKIA 3AWIA 2VIIA 5IM4F 5HIIA 2H8PC 5J63A 3S0WA 1WABA 1MH1A 2E5FA 2R8OA 5EJ5A 1RKXA 2VP2A 4E88A 3AHEA 3C8ZA 1UBGA 1I4DD 2UXCB 2WVHA 3BHNA 3ED5A 4MVJI 3OT1B 4L3VA 5JAPA 1WZ2A 1Y8RA 1UKAA 4LWOA 1XMQB 3PNMA 5FH9A 4HNVA 3K71B 5KNCA 1BROA 3NLLA 4LYJA 3BN3A 1KRWA 2VCYA 4P4SB 5EJAA 4LBWA 2Q8NA 2NTEA 4KXMA 4ITVA 2Y1WA 1JAZA 3KQKA 3QSGA 1YJQA 4DHEA 5D85A 1ZUHA 1HG0A 4PY2A 1IZ0A 5H81A 4MA0A 1D8AA 1R5BA 1V43A 1XLTA 5JAIA 3IERA 2UXXA 4QQKA 1UFIA 3L82B 3DM5A 1KAHA 1E2KA 5JMPA 3ESDA 4Q7MB 1Q0ZA 2IH2A 2FEMA 3GVHA 4UFOA 1OV9A 3ZU2A 4E1AA 2GZ2A 5TPZD 1T6BY 2IJHA 1SZQA 1LA2A 2PWBA 4BNIA 3I73A 4MQEB 3IO3A 1FTWA 1DWPA 1HUQA 4B0PA 4D74A 3VH2A 5JFGA 3VR5H 4AMYA 5TMBA 2UVDA 2W2LA 1U6KA 2Q9AA 4QYMA 1PUJA 5IMSA 2ECOA 1I13A 2C4KA 2IXBA 2ZR9A 1FDRA 2UZ4A 1GL6A 2BJHA 1X7WA 3L7AA 5DFAA 4TQFA 4WJLA 5IARA 1EJ2A 5DCLA 5IJ0A 1AGNA 3WV5A 4CM4A 3DZDA 2QY6A 2PO5A 3DWGA 3RSQA 2WEKA 4JJZA 1OFUA 4QDKA 4QPCA 1AC5A 4GE0A 1M5TA 3LL4A 3ZVRA 2JLXA 1CJKC 2MSNA 4DQVA 3W2FA 3NTOA 5DN6G 1N5LA 3DZCA 4IUDS 1P61B 3FOCA 1W36B 1OILA 3C4JA 1Z5UA 3KUXA 3P9CA 3WHIA 4QE7A 4C78A 1U7UA 2ZDIA 1F8FA 3I23A 4PW0A 3TO5A 3JRWA 4BOYA 1IXSB 3FZEA 3ND6A 4YMUA 5HK8A 4PC6A 5DRYA 1HTBA 3N0XA 3LSUA 1FYJA 1GY8A 1T4GA 2ISCA 2IM9A 1LX7A 5K1ZA 1XZHA 4DLZA 3AW9A 3NNDA 1GPMA 2ZCVA 1KI6A 3OFNG 2PBZA 5AI9A 2PE5A 3EDQA 2UYQA 3DHEA 4MWDA 3NIFB 1D5AA 2XDQB 1U1EA 1X70A 4F1WA 5HG0A 3W04A 3IAM1 1RC0A 1E0KA 2BGMA 1US8A 4QAJA 2CCGA 3H7AA 3ADBA 2I33A 1JYEA 1R10A 5IJZA 3O7MA 2RAVA 4O2RA 2H1RA 5TJ9A 1XTPA 3WGNA 5DX8A 1UEIA 3BDVA 3K0KA 3RSSA 3PHIA 1QX3A 3QWIA 3DXXA 2ZUFA 3KEOA 5GAPK 3AKZA 1I8TA 5AJHA 3ZD6A 3STHA 3WG9A 4NBVA 1Y4MA 3WJAA 4S1VA 3ETHA 2AI2A 3HBNA 4UHKA 1ZM3A 2H5LA 2WJAA 5EYPB 4N0DA 3RG2A 1VHQA 3TLAA 4MK4A 1T2UA 2HOQA 1P7ZA 4D9FA 2KG7A 4AJHA 4OQFA 3C6QA 1B26A 1JQAA 5D01A 4YXFA 1Z5GA 3OETA 2XB8A 1KY3A 2EYUA 3D9QX 3REFA 2QZ4A 3H3FA 4KRYA 2RHMA 4EIWA 2HDWA 3OEEG 5M3BA 4BTLA 4N5HX 5ARDA 1LZKA 2QRGA 3C7CB 4IMRA 3P2IA 1EGAA 4ITUA 2KTVA 4M60A 3CG4A 2OTMA 4R84A 2X0IA 1FXKA 2DSNA 4PTYA 1VQLF 4N5NA 5T6MA 4LWQA 4UE6A 4MUAA 4HEHA 1CJTC 2AV6A 3DEFA 1RKBA 3I45A 2B0CA 1UFKA 3FR7A 5AO9A 2NSDA 4X84A 1CRZA 5A03A 1VBMA 4RM2A 3CCQF 1GCOA 1Y9AA 4OHZA 3A1WA 1MJNA 4QPJC 3RG8A 4CCAA 1GAEO 1M2WA 3CIFA 3ZWOA 3KT0A 5G1OA 2PQ0A 5J2UB 1R6VA 1DDIA 2OBMA 2NYUA 1TVKB 3VH3A 1I0IA 3MIZA 4AIRA 3RFRA 1XQ1A 1J7JA 1SQFA 4OBEA 4HH4A 4QTTB 2UXNA 3AETA 1JU3A 4CKCA 4U3JA 2HV8A 2ZYVX 1TFRA 1HL3A 2Q5IA 4HAMA 1EFLA 1ISPA 4ZJPA 2I1LA 4YJ3F 1BA2A 4GX2A 1L8QA 3TLGB 4PLYA 4JK3A 5F2VO 4FC7A 4EMUA 2MSEB 3K9QO 1N7GA 5K4GA 5EB0A 2HFJA 4LMBA 4RACA 1HYHA 4O2BB 2N46A 3CGWA 2G06A 1SQ6A 3GR6A 4R3UC 2V74B 4DEYA 2XMGA 5TC4A 3CEJA 4YRZA 5KBYA 3NR2A 4O2AB 1JQ5A 5JHGB 1YACA 4X9QA 1YZTA 1D5CA 4XDGA 2PY5A 2BFFB 3WKAA 3WJQA 1HDZA 3HADA 2NG1A 4FU0A 2ZAMA 5AXCA 2ZAYA 2C54A 3KL4A 5BSMA 3FFBA 5JSZA 2VQEO 2W6ZA 4LISA 4RTQA 5F21A 5G0VA 1T0AA 4HZUB 2P62A 3SF8B 2ZJOA 3OE7G 3JVEA 1OREA 1QCYA 1UJ2A 5FI3A 4OHMA 2EARA 1ZVVA 4RKRA 1NU1H 1TJ3A 2IBSA 2JHAA 3GRCA 3MTGA 5GONB 2VHXA 4IQ8A 4ZYVA 3IYLW 3KJQA 5A4MS 1IK6A 1MB4A 2RFLA 3IPRA 1MIOB 4YGXB 3LUGA 4G1UC 4Z4HA 2I6UA 5AUNB 3L79A 3AHJA 2PH7A 5LOVB 4CQLB 2HYDA 3VTFA 4G4JA 3RFVA 4KO3S 4C4RA 3QBDA 1P2BA 1CZLA 3W5IA 4REQB 4XDKA 2GHQA 5DISB 1MKYA 4BZWA 5BY2A 3A26A 2XNJA 1QVFU 3QHPA 3SPGA 1GPH1 4NECA 4WBNF 1KIFA 4Z9BA 3EZNA 1VSVA 3I52A 4JC4A 4ZCPA 2E1RA 3IEPA 4AQ7A 3WOVA 3TL6A 1C3XA 16PKA 3FSGA 3HI4A 2X8JB 1N34O 2X3YA 1GSIA 1GAWA 4BVKA 3U60B 3I34X 4D0GA 1E79D 4UHFA 4IGKA 5JHHB 2OZEA 3PXAA 1V1JA 1GLVA 2A2ZA 3WGHA 2HRRA 1YS2X 1OHHG 4DS3A 4O4JA 2E6KA 1K4CC 3FNHA 5ED4A 1DOAA 2CBZA 4YMWA 4JBHA 1ZOPA 4X20B 1C30A 3O8BA 4IYHA 1HSOA 3IC7A 2GZLA 4XB6B 1AH2A 2X6CA 5F33A 5BT8A 3OTHA 1PNLA 3K4HA 1L5HB 3KS9A 2ZSJA 4DT1A 5LA6B 1P0IA 4GVPA 1CQJB 1T3ZA 3LO5A 4IBOA 4P93A 2VAPA 3F5QA 4R7TA 2P6MA 4PPFA 5LDHA 2JZCA 4YRKA 3UICA 4KGVA 3QMMA 3UAXA 4MJLA 3BCSA 1V0JA 4PI0A 3TQIA 2ERYA 5E1OA 4OLAA 4YWHA 3EQ7A 1J1UA 4LYEA 2DFVA 2XAJA 3CEPB 4V1CB 5HIAA 4CQMD 1QFJA 4E1VA 3EK2A 3F7OA 4IEFB 3A6EA 2C03A 5F78A 1Q3EA 2ZT7A 4WQMA 4GBED 1T36B 2I76A 1DXOA 2ZPUA 3QF4A 2OMEA 4K9DA 2CTQA 1WDTA 1V9PA 1MBZA 1ZQ1A 3QKRB 1U8UA 2O48X 3TQHA 1QO0D 3BZUA 2V9ZA 5DN6A 4I99A 2GN0A 4AY2A 2ZRLA 4YV2A 4WNIA 4TZKA 4NQ3A 1U2GC 4JGBA 4J7XA 1IUKA 4KLNA 1TTPB 2JA1A 4J9VA 4MV5A 1J22A 4BMOB 2CMFA 4MI9A 3A3KA 1A5AB 3UN1A 1CS0B 2H17A 1U7PA 1JVSA 4RQUA 3OFNA 5CB4B 2HRUA 1MAWA 4BMSA 4BRSA 1YR7A 1MQ8B 5ENDA 4FD3A 5F2KA 5KOHB 2JBAA 2NADA 3MMNA 3FTFA 4EARA 3QU9A 3FHLA 1M1KW 4U7WA 5IHXA 1XZKA 4KPUA 1D6SA 4LOHA 1Z0SA 2EILC 3PEYA 3GGJA 2WAMA 5CLIA 1U97A 1K73H 1VJCA 3VA7A 4NZPA 2OLJA 2GLZA 5CCEA 1SXJB 1YA4A 4AX4A 3B1KA 2H59A 3OMAB 1J2TA 3OCXA 1UK6A 1BYUA 1ADCA 5GINC 4IDCA 2LRHA 1YJ5A 4CLRA 2YWGA 1IXKA 4OGGA 1H6DA 1SHTX 2BCGY 4G4WA 2QAGB 4OXNA 1DAMA 5HRCA 2FEXA 5K8JB 3GMDA 5JMWA 2NIPA 3OEEA 5EIWA 3MT7A 4ZHYB 1IPHA 3KE1A 1R4NB 4MI6A 5AXBA 2BM9A 2I2XB 4MKIA 1JT2A 1W25A 3DXRB 4W9NA 4URXR