4TV9B

Tubulin-pm060184 complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
428
structure length
423
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 170
structure length 423
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv9B01
5IJ9A 5JVDA 4IHJA 4DRXA 2RHLA 4EI8A 4TUYB 1RQ2A 4O4LA 5FNVA 5LXTB 5ITZB 1W5FA 4O4HA 4EI9A 1SA0B 4TUYA 3RYHB 5CB4B 5LXTA 5ITZA 4U3JB 1SA0A 3RYHA 5IJ0A 5MN5A 5KX5B 5CB4A 2XKAA 5MN6A 4U3JA 3HKDB 5C8YB 2GVIA 4O2AA 1TVKB 3E22B 5GONB 5KX5A 4XCQA 3ZBPA 2R6R1 2VAWA 3ZBQA 3HKDA 3HKEB 4IIJB 3CB2A 4TV8B 1RLUA 5GONA 1TVKA 3E22A 3ZIDA 5J2UB 4EI7A 4O2BB 3JAWB 4I4TB 3HKEA 4HNAB 4IIJA 4TV8A 5KMGB 1W5EA 3JAKB 5LP6C 3UT5B 5CA0B 2Q1XA 2VAMA 4O2BA 3JAWA 4I4TA 4X1YB 5C8YA 3WGJA 4KWEA 5KMGA 5EIBD 1W5BA 3UT5A 4DXDA 3WGLA 4X1YA 3JARB 5JH7A 4YJ2B 4E6EA 1FSZA 5JCOA 4ZI7B 1JFFB 4O4IB 3VOAA 3M89A 3JARA 5JCOC 3M8KA 3RYIB 4ZHQB 3RYFB 4YJ2A 4F6RB 5IYZB 4ZI7A 1JFFA 4O4IA 5LP6B 3RYIA 4ZHQA 3RYFA 5BMVB 4F6RA 2VAPA 5IYZA 4YJ3B 3VO8A 5LOVB 5LA6B 3VPAA 1W59A 4B45A 5LP6A 3C8LA 5M7EA 5BMVA 3RB8A 4YJ3A 5LOVA 4X1IB 4FFBB 5J2UA 3VO9A 5MN4A 1Z5WA 2XKBA 4HNAA 2VXYA 4X1IA 3JAKA 3N2KB 4FFBA 5CA0A 3JASB 1W581 3VOBA 5EIBC 4X1KB 4TV9B 2Q1YA 3HKCB 2RHJA 3N2KA 5CA1B 3R4VA 3JASA 4X1KA 4LNUB 2BTOA 4TV9A 5JQGB 4I55B 3HKCA 3JALB 3RYCB 5EZYB 5CA1A 4EB6B 4LNUA 4ZOLB 5JQGA 4I55A 3HKBB 2BTQB 1Z5VA 3JALA 3RYCA 1W5AA 5EZYA 5J2TB 4WBNB 4EB6A 4ZOLA 3HKBA 2BTQA 5LA6A 5IJ0B 1RQ7A 3V3TA 5J2TA 4WBNA 2RHOA 3WGKA 3JATB 4B46A 4X20B 1TUBB 4O2AB 4I50B 3WGMA 1FFXB 1OFUA 3WGNA 3N2GB 3JATA 2RHHA 5EYPB 4X20A 2R751 1TUBA 4M8IA 4I50A 4U39A 5LYJB 1FFXA 4O4JB 5JH7B 3N2GA 5JVDB 5IJ9B 4IHJB 5EYPA 4DRXB 4O4LB 5FNVB 5LYJA 4O4JA 4O4HB
chains in the Genus database with same CATH superfamily
521PA 2YDEA 1SXJD 1PQUA 1JD1A 1EFRD 2KX7A 4MGEA 1KPHA 3AR6A 4FCVA 3KT0A 4C21A 2R66A 2VK8A 1J2UA 3ZNQA 1BXGA 1KYQA 1I80A 3OPYA 3FCSB 3T4EA 4BNTA 1HZJA 3LKVA 3GDWA 1FNNA 1ZH2A 5GPBA 2Z9CA 1Y67A 4GXRA 5DYWA 4MUJA 5ICSA 5LZ7A 3USES 1SURA 4RGQA 1Q2XA 2FDXA 3SS9X 2DECA 4BX0A 2HHAA 1IOZA 2D5AA 5GTIZ 4U2FA 4Z4GA 4P92A 5CTJA 2PS3A 1DDOA 1KERA 1F8XA 2WHRA 4GYYA 1ADBA 3FKJA 4K8OA 3OTFA 4CHGA 1N33B 1M1NA 3FVQA 1AA9A 3F9CA 4HDMB 3D3QA 1IJFA 3QFSA 3QWBA 2R2GA 1G8HA 4Y1RA 1A9QA 2BFNA 3VHRA 2QWOB 1X7DA 4LFBO 2HJFC 121PA 1SU8A 4JZGA 2DC1A 2BSKB 2NVBA 3ZWVA 5FDFA 1AKMA 2JFBA 4ZCPA 3AEIA 5H3CA 5H16A 2JB9A 1A8SA 3W7SA 4EY7A 2GZAA 4UNQA 5B30A 2R8RA 2WUGA 3VKUA 3WYFA 1PSWA 4PC1A 2IM9A 3TB4A 2Q5OA 1V16B 3EIQA 4WOCA 4OLAA 1JIIA 2QJTA 1NU6A 3ZEIA 1SKVA 1V11B 4K0KO 1W0JG 3L2OB 3CMMA 3IOEA 3GXOA 1WQ4A 2LKCA 5DCWA 1KEPA 1GQSA 4KKVA 3SJAA 5KQGA 1XDBA 4ME6A 2H0AA 1T2DA 1Q86H 1NR5A 3AHFA 4ZDWA 2JLAA 4GC9A 3DUFA 1X14A 3HACA 2WAOA 4AKGA 2EAUA 1OH8A 2GKGA 2XUOA 1V9LA 2P4EA 1DBFA 4ALIA 2V1DA 1PU2A 4BT2A 2LV8A 4AJOA 2UVQA 3OX3A 4MWSA 3T1HB 5HQTA 4BDSA 1CUXA 1G9SA 1I6KA 1Q7RA 3K0CA 1L4FA 4LDJA 1KVRA 4JQZA 5ISMA 4IIGA 3ZK9A 1QG0A 5EJ9A 1VSTA 1YZKA 2ZWIA 4FMCF 4R0VA 3I6IA 3DMFA 1S72F 5IXYA 2FB5A 3F6RA 3OR6C 3RAEC 1N32O 4FMPA 3SE7A 2QR3A 2QL5A 3HJGA 2DOKA 4ZJPA 1QVZA 1FMCA 1WD7A 2OO3A 3G0OA 3ICEA 4B47A 1ADGA 4X7BA 3LWOC 3HFSA 1S2MA 3F7YC 4QBIA 2VPYA 4EY8A 3B3QA 2I66A 3LBFA 3HPRA 3V4PB 4WOJA 1G6KA 1NFRA 1WPGA 4I55A 3T7CA 3AG1C 1DPFA 4AKTA 2DVMA 2A5GA 3HDVA 3AVQA 1D4AA 3X1WA 3W9BA 2FW0A 4AJ9A 2XYQA 4JNCA 4MPRA 5FFMA 5HF8A 2AZ0A 4J94A 4H9GA 1NJSA 2NU7A 3A4NA 1XU7A 2FUCA 3ZE0B 3K4PA 4QGBA 1M8JA 2EBWA 4ANFA 2ZSDA 5JC1A 4YR9A 3RVSA 2WICA 1OB2A 1D6SA 2ZYDA 1KAQA 3T54A 2P90A 3MAQA 3KRTA 4FTWA 1JYSA 5JNRA 2LGWA 2I71A 3V1UA 4DLNA 1ODLA 4KYIB 4MW7A 4MKXA 4JI4O 3SLKA 1AQNA 1NW3A 1NQ5A 1KC3A 2AHRA 5HKLA 3IIEA 1G59A 4L8GA 1WMSA 4M7PA 3VAZA 3OX4A 4CM3A 4X1IB 4TX1A 3EDQA 1PP4A 3QV1A 4B3MB 4Z9AA 4DMKA 3QU9A 3MQ4A 1NJFA 4J9UE 1C4KA 3U3DA 1W47A 3ESXA 4JIGA 4PHFA 1XTSA 3NH9A 1OILA 4A5OA 3HRIA 1UK6A 1EDOA 4FLFA 2QROA 4J16A 1SCDA 3OO0A 5H5NA 1DQRA 2X4DA 4DK1A 2QUBA 3K57A 3KXDA 3ASOC 5HIIA 2FSSA 1RBMA 5JYDA 2VJMA 1R15A 3GEDA 2W00A 5AWFC 3H2SA 2XIQA 4C76A 1I5YA 2A9QA 5FNVF 3V4FA 1MDBA 3JYOA 3LT4A 2XB9A 4ITVA 1N0VC 4LFCB 4FWBA 2VF5X 2WP8J 4YRFA 4F21A 4UTZA 4QSMA 1H38A 4AO6A 4B8YA 1H2WA 3M5PA 1Z7GA 3MS2A 1KEVA 1TECE 3IQXA 4BO5A 4E07A 5E1OA 1Y7LA 1NP3A 4NYJR 5JCPA 3GNSA 3VMMA 4JUIA 3B3AA 5FV7A 3U40A 3KXKA 1YNOA 1SKYB 1MUUA 1BA2A 4MV0A 4KYUA 1T2FA 2JDIA 5F7ZA 4QUDA 2X8JB 4HDSB 3RVDA 2HRYA 2BEWA 2GD0A 3GMDA 2EEZA 4TV8B 3CUKA 4M8SA 1W85B 2Y6UA 4L5BA 1PPJH 3F2IA 2ISSD 4DKXA 1QS0B 5D85A 1GPWB 1Q50A 5HGJA 4JJFA 4C0WA 4TWIA 3UQYS 1YS2X 1PT9A 1CUBA 3R6WA 4KV7A 2BCJQ 3ZWKA 3ZDCA 3EYAA 1RDFA 4DDTA 5K2MA 4RIGA 3GA0A 3KQSA 4CQJA 4TV9B 1PS9A 4H0NA 3N0XA 4Q93A 4YV7A 1R1BA 3DZCA 2QZSA 1O97D 4KK4A 4JI3B 4R69A 3KIPA 4JXZA 1UKEA 3QSGA 1N9GA 1M56B 2XLBA 4GS5A 1H0RA 4FDAA 2OPHA 3DONA 3AMVA 1OC4A 5IF9A 3FLAA 3FYCA 3NO4A 5ENVA 4QWMA 5CT5A 4PAOA 2E21A 4G1VA 1HV8A 1KC8H 3NVKI 1XYYA 1OMOA 2NX2A 4RSRA 4Q7EA 2VLIA 2FAXA 4M60A 3WZMA 1H2FA 4QYSA 4FP9A 2W71A 3DBIA 2OYRA 5CLLA 3KSDO 1W35A 4FYYA 2FTKA 4YVFA 1L0BA 2IZZA 2UYKA 1E5TA 1U31A 1NOJA 1NMYA 4W1SA 5DTJA 1E2NA 3BY6A 1GCGA 3IKFA 5LOVA 2I3AA 2PYIA 1FXUA 3PUHA 2WLJA 4BB6A 3WI7A 2J7PA 1X2EA 2OO7A 5C9ZA 3I6MA 4P33A 2I4RA 4P80A 1XTQA 5KYWB 1KQGA 2Z5GA 2XGMA 4A36A 2F9LA 4PPQA 4LWZA 2RBGA 2ETNA 4PTZA 2WAMA 3OOSA 5EKSA 5DLEA 2H4HA 2BKAA 3GEBA 4DANA 2BEUB 3PQ3A 1HR0O 3S2GA 5AM2A 3WMWA 1OW3B 1VLLA 1QGOA 3KVRA 1EFTA 2Q1UA 2XNDA 2X0DA 2CCGA 4RVUA 1KOGA 1Q0LA 3QPWA 1JIQA 5IX8A 3ROGA 4Y2TA 1CRZA 3TCKA 3WB9A 2I4LA 2QTSA 3FX7A 4I6JA 4ACBA 2WWFA 1U8TA 5G53C 4B2YA 4MVMA 4P31A 5GONF 5DOZA 4G25A 3FZGA 4EHKA 1FPQA 4L76A 2VQ3A 4UPDA 1R73A 4RETA 4JEIA 5G3YA 1QOZA 1UJWB 3T7DA 4CLRA 4DTCA 3NXSA 1FP4B 2C84A 1Z6TA 1NRJB 1XRSB 3AFNA 4PYQA 3U13A 4LC1A 4MMYB 4NZYA 4HLDA 4MRSA 2FR0A 4UUJC 2W2PA 1P62B 2AWOA 3Q72A 4RXTA 4F71A 2HA5A 5JXIA 2FCAA 4JJ4A 3O3NB 4HGRA 3GDGA 1OZGA 1X70A 4L4XA 4WVFA 1F48A 3GGCA 1FMJA 2VQDA 4FYIA 1T5DX 2VDNB 2VP9A 2E3CA 4ND6A 3HTXA 1GN8A 4TN1A 1ORVA 4IG9A 3WXMB 2O3TA 4GM0A 1QFMA 5JFTA 3WGHA 2XCQA 3WA7A 3Q9NA 4EHAA 3Q3JB 4YCJA 3ZWNA 3MWEB 4ZHQA 4ENUA 3TB6A 2IH1C 1YS9A 3YASA 1ZCZA 2FZ5A 3COYA 4GOJA 5FR1A 2ZJ4A 3QNEA 3OT1B 1COMA 4KWHA 3TTSA 5EJ2A 4RTLA 2OP1A 4GR9A 2QTAA 3TRKA 4Y6RA 3BIWA 5CYOA 1WUJS 3LPCA 5E3IA 4FJ0A 1T6XA 5FL3A 5HJ7A 1X19A 2YI9A 1YKSA 1P1FA 3EMKA 1OFIA 3LPDA 4L4ZA 3W4KA 4CT0A 2FPMA 5IJ9B 4N0EA 1XRMA 2YMQA 3RQIA 3O4FA 4J4TA 5DB4A 3ED5A 2WLLB 5H02A 3PRHA 4TT3G 2C92A 3O8BA 5K0ZA 5HFLA 4JAAA 4G97A 4HNHA 4JI2O 4G8CA 2XZLA 4QPKA 2O5EA 2ZJAA 2H1RA 3LC1O 3IQHX 1R0KA 4GX0A 3INYA 1BMQA 2J33A 3GHHA 1GSOA 5ITWA 2GN2A 4PHHA 1UMBA 3JZFA 4P22A 1JLMA 6Q21A 4BY9D 5E7QA 3AVVA 3FFBA 3PX2A 1W44A 1KEKA 4O33A 4L4SA 2A8YA 4LCBA 4P4SA 2PV7A 2RKWA 1G5RA 1GPAA 4RK6A 4GLXA 4ND8A 1T9CA 3QM1A 3V1NA 2GX6A 1G16A 4DMFA 4P98A 4LHSA 4AU1A 3AKYA 4UVDA 3AY7A 2ZP1A 2AXNA 1YXBA 1NNEA 4CMJA 3GCDA 1Z12A 4A0SA 2WF5A 3BF7A 3A2KA 1X4TA 3MT0A 4F9GA 3VH4A 5KDOA 4HVCA 1XZIA 2F3RA 1J0CA 1XREA 3BORA 5IEJA 5A2QA 1C9NA 4E5UA 1C4OA 3I34X 1QVGU 3KZOA 4QYTA 3BB1A 2YVUA 1DV1A 3HB0A 5SV2A 3LUJA 3GEPA 3M89A 2WM3A 1E4YA 2XAGA 5AI0A 2OAP1 1I30A 2JI9A 4IDHA 3Q9UA 4DHEA 4P35A 4RYDA 4MV3A 1QQCA 4DR6O 4GKKO 3PAFA 1K7CA 3QBTA 2W2VA 1XZ8A 2QL7A 5CFOA 2JGRA 4D9IA 3S2FA 1VKHA 3DVRX 2CWWA 1F20A 1SG9A 3LWVC 5DSXA 3NRJA 2ZYTX 2OD7A 3JWHA 3QLUC 1UZAA 5HIJA 4CS2A 2H7CA 1CXZA 3L05A 1Y7IA 4NBNA 4D9MA 4XZ3A 2DGDA 4PCUA 3BD6A 2GK3A 1M7HA 4MDYA 3KHSA 2O8CA 2QK4A 4PC7A 1RA4A 5D8DA 4R3WA 5JLJA 3TLYA 3TSAA 1OLXB 4BV2A 2W8BA 3VTIC 1IBKB 4G56A 2K6GA 3SXUA 2CW4A 3CT6A 1OWMA 1O5TA 2Q9UA 2IODA 2ZQ5A 3LUPA 4HDRB 4J3FA 1DKNA 3B85A 1I1HA 1EGQA 1O7JA 2ID9A 1VI6A 4AWAA 3A1CA 3LT5A 3WOHA 3DAYA 4IPTA 5TPWA 2AR0A 4RF2A 2YHIB 4PHGA 1KO8A 1QGDA 1FX0A 2V8OA 1NUTA 5J23A 4NPCA 4X66B 4EHHA 4LNUB 1W0KA 2OC9A 3WXBA 4CIWA 2EATA 1GKKA 4CF7A 4U9IS 2UYPA 1JQJC 3JV7A 2Q62A 2YCBA 3B38A 2ZRKA 3UJ8A 4HZ3A 2QUJA 3WO0A 5A4JA 2PEZA 2RH8A 3V2UA 3DAOA 4EPTA 3PGKA 2MW2B 1HX7A 4NAUA 5KTMA 3BEDA 3D2AA 4TUYA 1R6VA 2DYSB 3IIKA 1EUDB 1NXWA 1VE6A 5THKA 3WPXA 3UWMA 2JRLA 2EX0A 2A88A 5U4QA 3EVCA 4HGZA 4Z3OA 2FEPA 3KXLA 1F0NA 2PBFA 1AO3A 2A0KA 5EZQA 4H3KB 4Y1FA 2ZT8A 3QEMA 1ULSA 2LIPA 4AG3A 2OBBA 3UCFA 3VNAA 3HB7A 2OENG 1VMDA 1MA1A 5DYIA 4PI2A 1JXMA 3GJYA 3ZY3A 4B7ZA 2QD2A 3RUPA 1WZIA 1GHTA 4CIDA 3KDPA 4WZBA 4DMCA 5BNZA 3REOA 1ZN9A 1ZRNA 1JDJA 5LKAA 1IV1A 3VIUA 3KLMX 4L1KA 3H9QA 5B5SA 3GLGB 5IT5A 1K66A 3WK4A 1OT5A 4YO8A 4RTMA 3A37A 2KLBA 2HPVA 2EILB 2FSGA 2YZGA 2H1OA 4B75A 2N04A 3G1WA 4RMJA 2BFAA 5JJ5A 1AX9A 2CEAA 1YJCA 3Q4HA 1XVUA 2B92A 3GRKA 3AJ8A 1M1YE 1AT1A 2GVZC 5A9SA 1PO7A 4L6CA 2XI4A 3B9BA 3DLPX 4GKKB 5CCBA 1YVRA 4NAVA 2JFFA 2JAXA 1U5AA 3GJ4A 2BBWA 4D82A 2OZLA 3CCSF 4IGKA 4YB8A 3OKCA 1KD1H 4O4IA 1I51A 2AJDA 1AS3A 4CR6A 1E9FA 1ZZEA 4QRIA 2CHEA 3N28A 1G1MA 1KHHA 2QZJA 3QUCA 4KTTE 3IPAA 3GVPA 5JAZA 4IFTA 3SQXA 4DV3B 4UEKA 2G40A 4MTOA 4DQXA 2P79A 3OIDA 4J43A 4WZZA 5C46F 2NVUA 4JK3A 2FSPA 2EC5A 4YAEA 1AP5A 1UBCA 1PV2A 5KB3A 4CG1A 5C1OA 1W7AA 2G5PA 3OFNG 2XUKA 3C97A 3OE7G 2H00A 1C3OB 5ALVA 3V4VB 4JJAA 1LJ8A 5EJMA 2XNJA 1G3RA 3GEMA 2Q2NA 3TRDA 4L07A 4WTOA 4X8AA 4UUQA 2HKOA 1GQRA 3KZCA 3FNEA 4KPUB 3ZRVA 1IULA 3R3JA 4NENA 4G1CA 1EE2A 2QT0A 1S5JA 3QX8A 3CCFA 3ZMUA 3LQKA 3O8DA 2BISA 1P4HA 4I2VA 3S7ZA 3HDGA 3OE1A 5EWLA 3GFPA 1R9MA 1SOMA 1AK9A 5BWBA 2AEMA 2H48A 1NU1H 3TD5A 1G19A 1AZWA 2CDCA 1BW9A 1ULTA 5DBEX 2Q6KA 2XCIA 4BC0A 3IBCA 3GRCA 1CRWG 1AUQA 1LLFA 3CZCA 3NHPA 1HBJA 1V3QE 5C18A 4ZYWA 2J5RA 2H31A 1VJ5A 2WF6A 1L1RA 1CJVC 4HWGA 2PHNA 5BVHA 2A0UA 5FBVB 4TLAA 1N5LA 1MRSA 4QBKA 3AUFA 2HWXA 4TLBA 1HRKA 2C1EA 4Z1VA 3BJZA 1U9ZA 5T3YA 1MTZA 1H47A 2XCLA 3MWDA 2VSFA 2WOOA 3WLFA 1T5SA 2QI9C 2Y71A 1XPOA 3PQ7A 3LH5A 2ZIXB 3NEJA 3NHYA 3IEPA 3QWFA 3OD1A 5LP6A 4MW0A 3RGBA 4QNRA 3TVTA 1YASA 1TIKA 2QQFA 5JY6A 3JX9A 1O1YA 3VNVA 4RDHA 4AMYA 2IHNA 1KYZA 3PEYA 1N6KA 5DX0A 5EB0A 3OIYA 4I1RA 4M1WA 1P6QA 3BCSA 1UKBA 1JQLB 5CIQA 2PRKA 4R98A 1RM1C 3OKFA 3B60A 1IQ0A 2AI2A 4A6XA 4RD0A 3F1KA 3CUSA 4U3JB 1M8PA 4TWZA 2A1UA 3PFCA 4FZ1A 1HDJA 3KHNA 4GGMX 3H9UA 1FXKC 5A06A 4FGLA 1OOEA 4BQNA 3WWPA 5LZ2A 2YINC 1NXTA 5JYBA 1VQ8F 3BRQA 3TNLA 2QT9A 1R4NA 2WA3A 3FPBA 4YP9A 4P0TA 3L9WA 3L43A 5KTSA 4NI5A 2WPNA 4I14A 1W4AA 1E4EA 1BCRB 2RDMA 3AG1B 3TUIC 1E3MA 2L18A 3V8BA 1KYOF 1F0YA 2A3QA 3D6FA 5EC2C 4UAGA 4U2CA 4YMIA 4HDQB 2V7BA 4KRXA 4X20A 3AR8A 4IHJB 2BGKA 1L5SA 2FUG1 1KEEB 5JVDA 5KJFA 3ERNA 4WXRA 5ABPA 3FUUA 2C61A 4G9GA 3WL5A 3KZ1E 1Y7HA 1R4AA 4PDRA 5JH7F 1U3GA 4MTCA 3IUJA 4WADA 3H5WA 5JR3A 1WPQA 3ESBA 5IZCC 2VAXA 3WNZA 4ARUA 2PRYA 1IYZA 1LC3A 3WMGA 4KPYA 2R8XA 1JQ0A 2ZJ2A 3UAXA 5COAA 5E2AA 3E7WA 1I7QB 2QLJA 3AXSA 3ZLJA 2EP8A 3GAFA 3PPWA 1KH2A 3HKBA 5AVOA 4MQFB 3ST7A 3ZNOA 1XZDA 1U8EA 3PR2B 4HLUA 1KSFX 2P4KA 2F64A 2Q0XA 4RBNA 3ASOB 5FORA 1VJDA 3PS9A 3K59A 2Q7DA 5EJIA 3KQUA 1VI5A 4GH5A 2HOQA 1Q19A 3RFFA 4AO7A 3PK0A 1R6XA 2P6RA 3A6GA 1I3LA 4MP8A 4F8JA 4OSOA 1X74A 4W7HA 4I9WA 5HQJA 4DSTA 2R1TB 1LF0A 3AIKA 1BOFA 1RS0A 3GT7A 1DAKA 2VJPA 1Y1SA 1EZVH 3Q3EA 2ZVPX 4ZMRA 4XLZA 1KJIA 3OIWA 5SY4A 1RHMA 2B5WA 3ZZ1A 2QG6A 3FSGD 1H2SB 2WTUA 4PO3X 1KUQA 4DG5A 2CLKB 5P8WA 2W9XA 5JJCA 1FFWA 4JGIA 1W2WB 2H65A 2UZ4A 1XCPA 3STUA 4QFBA 1R5NA 2FSVA 2P2DA 2A5FA 4QHTA 4LWOA 1KTVA 1TA9A 2JKYA 2CL6X 1OSNA 4TXJA 2JFZA 4PTYA 1RSOB 1C3VA 1II9A 4NFLA 2D4HA 1COWD 4B3FX 3NDPA 4U8GA 4CC6A 1JJIA 1DC6A 1NONA 3UUFA 3ER9A 5A7HA 2GZMA 3E7XA 2D2FA 4G4WA 1TGOA 5HFAA 4CMIB 4F5EA 4AUKA 1VQNV 1WHTA 1SKYE 1FVHA 1QX3A 2B7LA 3FDZA 3B9RA 4DT1A 2RAPA 4OFXA 1P91A 1W3EX 2RB5A 2HXGA 4BX2A 1ZD3A 4JQSA 1ZQ1A 3RHTA 2PJDA 4ZOQI 1KO7A 2VHWA 3ECCA 3MJHA 3GG2A 1EFHA 4Y7CA 3NLLA 2ZUSA 1G9XA 5J63A 2YJNA 3UB2A 2GLZA 2F1HA 1KNXA 3OUSA 3SPGA 5LQJA 4JVLA 1PZFA 2C5GA 1L7VC 1VQPF 2X2OA 2HMWA 3IBFA 2J5KA 3AJEA 3H2BA 2WIDA 4B80A 1IVNA 5K09A 4LCKA 1D9XA 4X8HA 2OYQA 2WV7A 4W1QA 3E83A 2GETA 5EUMA 3P2EA 1KQFA 2GUGA 4ETWA 3VPBA 2J0EA 4Z51A 2H4XA 1NULA 3DM5A 1FSZA 3IR5A 1C7RA 3EB9A 1GAJA 5JCOC 2ODMA 5BUQA 3U9LA 1MF7A 3O3CA 4P2GA 1W4BA 4MKRA 4UASA 2HU7A 3SPXA 1VQNF 3JCZA 4Y2UA 3H5VA 2ZB7A 1ODFA 4WPGA 3W04A 1ZH0A 2I7DA 4LGCA 4IYJA 3KTDA 1D4FA 2FFJA 4O08A 3WDLA 1K8XB 1YL7A 1GU7A 4K1LA 3U3KA 4UD6A 1FYVA 3FE2A 3FROA 1DXYA 4KZPA 4CU2A 2JD2A 2ZLBA 4D26A 2YWHA 3KEOA 3TJTA 1P60A 2C00A 2QD4A 1PAUA 2Z4RA 1DZ3A 2PCLA 2XOEA 5A6VA 1ISMA 2Y2UA 3WRWA 4EZEA 4O4HA 1MEEA 4ZYTA 2B2XA 3LFOA 2HS0A 4ZEXA 3LDTA 3UZUA 1AHHA 1G42A 3G9TA 4V1CA 2IHJA 2E55A 3DBHB 4MQ6A 2CLFB 4IIJA 1AS2A 4R84A 2HA2A 4Q37A 2R68A 2RGXA 4X3OA 3RAJA 3SYMA 2CJYA 4JI6O 2IH5A 5CVUA 3WLRA 3F5QA 1J2RA 4BIIA 1U6JA 4UHJA 5FD8A 4LV5B 5JJIA 4KN6A 3SIUA 4GVLA 4IGGA 3EQ9A 1POXA 1JIKA 3IIIA 1MDFA 2GCOB 3DF9A 3O1LA 3ESDA 2GPWA 4LYGA 1BE3H 4CF3A 4HLNA 1VQ6F 2I22A 3LNTA 1Y80A 1IN7A 3UKDA 1KKMA 4TM8A 4KAAA 4B7XA 2WV9A 5GY7A 1YIOA 3C3BA 3Q7TA 1MHPA 5EJ6A 2WYOA 1JEYA 1FNMA 1T24A 1H42A 3QOXA 4FHGA 3WOVA 1N36O 2ZYVX 2DQ0A 1RKQA 1WA8B 4BMCA 2XECA 4URUR 4FC6A 2IH2A 4R16A 5A71A 1EEXB 3NBYC 4FIZA 2YDXA 4OGLA 2H2FA 4PQFA 2OO5A 1I3KA 2OXFA 1VQ9V 1G8SA 1ULAA 1X52A 2FPSA 3LXRA 1WCV1 4BN0A 1XWIA 4RZIA 2VZLA 3BK7A 1QV9A 1OTXA 4L78A 1JP7A 2VJNA 1XEXA 1RCFA 4ABYA 4MWDA 3IP6A 1YJ9V 4IQ0A 2FSFA 4HSEA 2EJRA 5LQNA 4MR9A 1S8NA 4ND5A 1RRFA 3EVDA 4E51A 1OBCA 1EBUA 4CU5A 4R68A 1JDZA 3NDBB 3E8HA 2OZEA 4EKEA 5HA5A 3O0DA 1LPOA 2JCXA 4NE7A 1ZICA 4CXMA 2BI8A 2E2WA 3LBHA 4H7HA 4R1QA 4UE3S 1B14A 4QLBA 3B12A 3HP4A 3B6IA 1YDWA 3K96A 4US2R 3BREA 1W87A 3F8WA 3PWTA 2Y67A 2NP6A 3HHEA 2HLPA 4OXRA 4ZVUA 2H17A 2HF9A 4LX8A 5SICE 4KE8A 1JWLA 4PD4F 3F6CA 1UPFA 1UZNA 3OIUA 2ZE7A 1YITV 3HWSA 5DHRA 1XTVA 2QX9A 3GRPA 4DADA 4FLMA 1QRAA 3RQSA 4Y6SA 3KAQA 2WJVA 4NFYA 5I4IA 4UNRA 4EDFA 3E58A 1USKA 3U3MA 3IPYA 2ARKA 2BLLA 5EWJA 4FD3A 4JI6B 3T94A 4M7RA 3IQZA 3H4TA 4DIUA 2Q67A 2VQFO 4TLCA 3NOVA 4H4EA 1WULS 3HCAA 1UDXA 1JMVA 4YT2A 3ASUA 1ZW6A 1CE8A 5IKOA 5TLSA 3CLKA 1SFRA 1VHLA 2A9JA 1LPAB 4XARA 3I12A 2NXJA 3FGPA 4IUCS 1I1NA 4AB1A 1HZZC 2D6FA 4KXXA 2HSWA 3GQVA 4YCCA 1Y3DE 5I7OA 4MPPA 2ZSFA 5JRDS 4X1KB 2ZTVA 1PNRA 1Z9BA 3AJ9A 4PZ9A 1ZWIC 4O1MA 2H8CA 5EZYB 4OMUA 1ODTC 4ZKIA 1R0YA 3A58B 2MYUA 3QVVA 5A5FA 2XDYA 2B1RA 3FPLA 4PQEA 3TOCA 5LUBA 1RHJA 2ZUVA 2C4UA 3DVAB 2CGNA 1W52X 5DCVA 4IRMA 5JU6A 2WIAA 4B3JA 1XRGA 1BS3A 4AYTA 2YRFA 3DMDA 3OQOA 5MF6A 3ORFA 1THGA 4ZFNA 2F23A 2R7MA 2XKKA 1TL7C 2C5EA 1MO5A 5F5NA 3C3CA 4MA4A 1RKVA 4L9AA 1M1YB 1KKUA 2WVJA 5DM0A 2QZ9A 2GPJA 5KQLA 1FJXA 2ZB8A 1O5OA 4F4UA 3AF4A 4A23A 1WZCA 4D46A 3DOEA 2B4TO 1YCIA 4LNAA 1P5FA 3H1GA 2HF7A 5BQ3A 4QPJC 3K2BA 4OOEA 4JL6A 2AG8A 5A4AA 4UM9B 1HSZA 2C8JA 2XVAA 2V0NA 1OWOA 1SCUB 3CCRV 1MNAA 1FOEB 3W7UA 4TLLB 1LU9A 3M3HA 4MV1A 1HTBA 1K8AW 3HU1A 4RV4A 5BV7A 3MGGA 1GTG1 3J80M 5DNWA 3RS0A 3N2GA 5DW0A 2PT5A 4ZC1A 1O08A 4AIRA 1Y1QA 3PJSK 4JCOA 2XB6A 4BMPB 1N5KA 2AUNA 1ARZA 3E9CA 4HADA 5C4GB 1GA6A 3MM4A 3UGTA 3ZGYA 4L9WA 1A50B 3I5YA 3W6NA 1U40A 3S5JA 1P7VA 1NVDA 1YBFA 3T1HO 3VMFA 2QI2A 2EZ4A 2Q2QA 4BNFA 1IY0A 2PRIA 4KWEA 1FVXA 1J97A 1FDRA 4HY3A 1Z5GA 1SZDA 4BVJA 2RAFA 4S3MA 4G4IA 2FMUA 2AG5A 3HCNA 5EIHA 3O4RA 3U0BA 2VQFB 1K4DC 3DLCA 5AVKA 4GMGA 4PSDA 1QKJA 3IB3A 1Q3EA 3TZ6A 1AXGA 1GR1A 4WBNB 3V6LA 3LWRC 2VHEA 2O0LA 4CQMD 3CCRF 1AKUA 3C85A 3BA6A 3VU1A 4HYOA 1MU0A 1UUFA 4LPSA 2CHQA 1IQRA 2NXNA 3QLVC 1PUXA 2YXEA 1KYTA 2PI5A 2FW9A 3F4KA 2J1LA 4ZVPA 1XQWA 2P6YA 3CQ9A 3NKVA 2DQSA 4JSTA 4WNAB 4QOHA 3UXHA 3ZVMA 2WLNA 2J87A 3HPLC 3LHIA 4O4JF 3I2HA 3A25A 3GLGE 3CX3A 3ONWA 4I5SA 5BYJA 1S3FA 3RVKA 2A86A 3R3HA 2PL3A 4TPKA 2R1UA 4PYNA 4B3CA 1J0AA 5FLYA 4IGFA 1V1RA 2JIDA 3E1GA 3A1NA 5L7YA 3K9AA 4KOEC 3IPRA 2XAHA 2VGMA 3RK4A 3BMCB 2GO7A 4BFCA 3GVCA 4TGLA 2JEYA 3UOGA 3KVYA 1A88A 4B3MO 2N3ZA 3B1XA 4GZ5A 3HA5A 4C4WC 5JXGA 3JYPA 3GF4A 4H4DA 1DBIA 5C1PA 4F7DA 4M6WB 1U0TA 1KTIA 5GOTA 2YNMD 1FP1D 4TL8A 2V5UA 5C7LO 1AXEA 1L4BA 1HDZA 4WDQA 4JP8A 5AW8A 4RKEA 3F5TA 5EJ5A 1M5RA 1M0SA 4G37A 3GPCA 2WKPA 4LTMA 1R4MB 4MSUA 2CXUA 2APJA 4AZVA 4MVJA 4IHKA 3BH0A 3TLJA 2OLJA 4DIDA 1SZCA 2QEXV 3UWDA 4PHCA 2HJGA 4BLVA 4CFZA 4CH3A 2CDYA 5JIBA 3EMDA 3ZHTA 4QHYA 3RYFB 2FHPA 4BPRA 5IJWA 4BXOB 4TTJA 2JAWA 3C9UA 5HKAA 4CFSA 1IDSA 2WWWA 2R6DA 1I0ZA 3TR5A 2F90A 2AD1A 4LFCO 3EIEA 4DCSA 5BQ5A 2X8AA 2XNKA 2V6BA 3O94A 4JVOA 3L18A 1ZOLA 3OM9A 2YN2A 4UOEA 4LDNA 3LVFO 4JDPA 3F5MA 3I5DA 1VFNA 2PUEA 3AUYA 1PJSA 1UDAA 1HYEA 1E61A 3HC7A 3UMYA 5GMOA 3OD5A 5L8VA 3HABA 4CVNA 4P86A 1FFXB 1RPOA 4Q3OA 3RU3A 3LVBA 1GZUA 3KYJB 4FT4A 4IJKA 4EPRA 1SO8A 3CPHA 4M9RA 2HI0A 3OVMA 4OU4A 5AIAA 2PGDA 2ZKIA 2ZS9A 5JXJA 3OR7C 2P68A 3V8PA 5JD5A 1LZLA 1IATA 5KX5B 4IGAA 4RA9A 1LZKA 1TVKA 1GKIA 1JXQA 5DHPA 3L7AA 5DV9A 1JHMA 1N8RW 5KA5A 1YAJA 3IAEA 2ZSBA 1SHUX 5DI9A 4IG4A 4EVIA 2PF4E 4R9RA 5IDVA 2XAFA 1HWYA 3M5CA 2O07A 2JGNA 3PDWA 1EK5A 2VPTA 3PTZA 1U28A 2LBPA 3Q7SA 5B6JA 5JAHA 4EB0A 2VCYA 1N5JA 4FCTA 2AMLA 4QYIB 4FMDF 1U0GA 5EBLC 2C94A 1E2PA 1GNQA 3M6VA 1SQ0A 1RM1B 3FKSG 1BS9A 5FL7A 3VH3A 3H9BA 3O84A 2RHHA 4WD3A 1UEIA 3QVGA 1C1XA 2JKZA 3Q0EA 1FCJA 1T2VA 4JI3O 3L70H 2YYYA 4YUZA 1TZMA 4Q4HB 2V7EA 2B9ZA 1ZD5A 2W70A 1Q6ZA 1FXKB 2O1EA 3OIFA 4BL5A 3A1DA 2UV8A 4OGKA 1ECGA 3QKWA 1GL6A 4KCGA 5B1BB 3M4JA 4OHPA 3ZCPA 2QX4A 2ZB2A 4UAUA 5D5QA 2Y2VA 2Q7EA 5E6SA 1N75A 1XTKA 5DDIP 3E4CA 2ZI7A 2H0QA 3T5PA 5H80A 2C7QA 4PLPA 3IAM6 2UYCA 1PGJA 3QWHA 2V7UA 1F8FA 4D8TA 1UANA 1JAYA 4HX2A 4J0JA 5CBPB 3QE4A 4EFMA 4CH6A 1H69A 4CCWA 3TLXA 1WCXA 3G2MA 4ND2A 1UH5A 3M34A 3TNDA 2RI6A 1U90A 3ZCSA 1FFCA 1EA7A 5F35A 2CYBA 2ODEA 3A9RA 4WJLA 2PUVA 3OIVA 4BO7A 2B1JA 4MI9A 5LYJB 1QO0A 1EU1A 2GAOA 4BUCA 3COPA 4DJEC 3F73A 1M2VB 3ZGXA 3KKLA 2E5LO 2G04A 2Z8XA 3JQ9A 2GS9A 5GM1A 4K9DA 4O2AF 3EZNA 1F51A 4XCQA 4HYTA 5BNTA 1KGDA 5L53A 3N2LA 3BUSA 4UPEA 4Y2JA 2VZ9A 1T8RA 2M32A 4D4KA 2X1VA 1YZLA 2YS7A 5IU6A 4D7AA 1AMNA 1TLFA 2BMDA 3ZCUA 1EIZA 2X4LA 1H2ZA 3NJRA 4C0HA 1Z7BA 5BORA 2BEVB 5JJLA 3UA4A 3N2KA 1EZZA 4F97A 2ZFUA 1RWVA 3IVGA 4OKNA 2AOTB 3SQLA 1B23P 1Z4NA 2AD5A 4KYVA 3ZHYA 1P2UA 4M46A 3M2TA 1G7RA 3AF6A 4M0DA 3DT8A 2AI1A 4OHUA 3SR0A 4KQ1A 5B2ZA 2HA4A 3VFDA 3M6XA 2BSQA 2IXTA 1HH4A 3MOIA 5H82A 2D62A 2P5YA 1P3JA 4HNUA 5CVVA 3IP8A 4UE2A 4J7XA 1E1DA 5IDWA 2DQYA 2HU5A 2GK4A 1JX9A 2WMOB 3B5EA 4NECA 3K9GA 3OBYA 1NUSA 1S89A 4NABA 5T3UA 3I76A 1TC1A 3QNUA 5FWAA 1ZONA 1E58A 1UM8A 3SMQA 2JH8A 5BVGB 1HDOA 1TNDA 3R7WA 3CVOA 2PZBA 4TMXA 3ZJZA 4XX0B 1JQ3A 5JQGB 5AUQA 1XK6A 1TGVA 2OFWA 1CRPA 5K6TA 2PQ0A 2D2CB 5CPFA 1PXWA 1W4ZA 2YHBA 2PMBA 1XVLA 4C6SA 2WU8A 2P9TA 4QXQA 2GDJA 4KKXB 3MJCA 5KQPA 3UMJA 3WYNA 4U39A 5AOBA 4BLWA 3UO3A 2EG5A 4KAJA 3IAXA 2BFFA 3KPWA 4QATA 3GU3A 3C8HA 5G4VC 1Q14A 5IBCA 1CUWA 3CEJA 1L3BA 3FB8C 2NN4A 3P9XA 2W4QA 2BR5A 4BUZA 3CS3A 4OK3A 3CXCU 3CD6V 4Q02A 1W0JD 4DSZA 3F46A 3KQOA 2FPUA 3OW2F 4E4EA 1RJWA 3Q88A 1JQEA 2RGWA 4C01A 3L8EA 5FOVA 4KHPO 2HQBA 4PZPA 2C0PA 2E5LB 1AK1A 1IB6A 4YIPA 1H5NA 1Q0TA 3CNQS 5LNK1 5TQ2B 1QSGA 3CCMV 1P4GA 1UM9A 4IHQA 2WU0A 1NPTO 5IWAB 3KV1A 4JWTA 2YQZA 3AUJB 1EBFA 4BB9A 4Q3CA 5JRJA 4A6EA 2P0YA 1ESNA 3GRZA 3GQBB 5JFOA 4DMHA 5DK6A 2NU8A 4RXUA 2CXOA 4IZIA 3L4BC 5FLXA 1Y4AE 5I9BA 5EAZA 2YV5A 3OHMA 2CNOA 2D1SA 3PWKA 4MCHA 1SA0A 3L0BA 5TB5A 1J2EA 3H2JA 3G3EA 5DECA 4C5CA 3HEAA 5FRDA 4FOTA 2QAJA 1XD2A 1U02A 1AIPA 1PGQA 5HDBB 2CY0A 3LA6A 2AYZA 4YP6A 2VS0A 3COSA 2ZIUB 3WRXC 4IIHA 1K9MH 3MRTA 4GZRB 2DFVA 3A0RB 1DAOA 3ZWBA 4R8RA 5AVJA 5J9PC 2OQRA 1FLNA 3P2OA 1QCYA 4EYQA 4DJTA 4ZVMA 3NTQA 4PBSA 3QI2A 1YDXA 3JASA 1NLMA 4AF8A 3SK0A 1YU9A 3T1TA 3LKDA 2JFWA 2W6JG 3M84A 1NN1A 3AHJA 4RZ3A 1QCZA 4FX5A 2VT7A 5TISZ 3EXIA 4L6IA 1QONA 4ZU3A 3D8SA 3V2HA 1SUEA 1TYDE 2FEKA 4MW4A 3HA2A 4TT8A 3GLHA 3M1IA 5JWHA 4JLVA 2IJJA 4NP6A 1QNLA 1MC5A 3NK7A 3Q8MA 4X9XA 5BSKA 3ZU3A 5TMEA 3W5BA 5HF5A 3M6FA 2OWDA 4B76A 1H0SA 1P7ZA 4C4XA 1EGVB 1RC8A 4K8ZA 1WUIS 1TMYA 2YWEA 3F6EX 4I8IA 4CZ2A 1YOVA 1O6BA 1IONA 4ZT5A 4GX5A 1HNXO 1A95A 1TUIA 2ZPTX 1XPUA 2PH7A 2GPNA 1IBKO 1V7QA 3T5BA 3NEAA 2YASA 1EFVA 1FIUA 4JP5A 3JZMA 1XR3A 2GTPA 1HP8A 1DJLA 3NP7A 2V6FA 4J9YB 3C8MA 1RXIA 1B0PA 4LECA 1TB4A 4UNIA 5EZ6B 4NY1A 5FA6A 1V7ZA 6ABPA 1KS2A 4HZUB 1TCBA 2X4IA 2YTZA 3AL3A 3S2IA 4X66O 2O0JA 3RS4A 4HDKB 1Z0DA 2ILVA 3K0HA 4FKBA 1UJ6A 4J9VA 4XGNA 4MGIR 3RVJA 4KHPB 3L9XA 2PJUA 4Q4JB 4NJEB 2POCA 4FDMA 2WJ4A 1CKEA 3WRYA 1JLHA 1M6VB 3W7BA 1C7IA 2HMSA 2RGGA 3VR6A 2DCMA 3A36A 3N5KA 4DJ5X 1HG1A 5LL6P 4RQFA 3MT7A 1GZSA 3G2LA 4CKZA 1WRBA 1PV1A 2E4WA 4XWGA 2RC5A 5CLGA 4IIVA 4MR8B 1K4YA 3P9SA 5DM1A 2IWHA 1ZGBA 1XZEA 3SEZA 3PC8A 1VQ4V 4ARBA 1Q7YH 5ALPA 4J1TA 4CF6A 4LBZA 3CCVV 4XIFA 5JAQA 3BEHA 1LSUA 4ZOLF 1JJ2F 1WKCA 4U9UA 1KARA 1L4MA 3ZWPA 2N05A 1ZRSA 5FWXB 4ETMA 4PZZA 3TPZA 5KLVH 2YUTA 1N6PA 4NFSA 1KJNA 2LBXA 4QT4A 4BQFA 4C8EA 5JMPA 5KSWB 2AW9A 1UKCA 5CB4B 1GZ0A 3OA0A 4QJ5A 5JRZA 1N5IA 3MRSA 3O6VA 3PXUA 3CMCO 1X7ZA 1JOYA 3H8VA 4X89A 4G2TA 1AA6A 1ZAKA 4BLUA 3EIHA 1ORIA 3ZY5A 4QREA 4QJIA 1M66A 2YWRA 4ZO6A 5G40A 5IK2A 3EBLA 1WOMA 4XRRA 3SVLA 4ZGGA 3VR4H 1NT2B 1E1LA 2HUNA 3RODA 4KJZA 2IJIA 4X8OA 4LW8A 4Y2QA 2FPXA 3ZX5A 3QKRB 5JAIA 3U4IA 1FFBA 2XB8A 1U8XX 3VYRB 4Q1BA 3OMAB 5ADUS 2OHWA 4YMSA 1VQMV 3C7CB 4Z0TA 3KQKA 2O2EA 1VQ4F 1WAMA 3T4UA 4GXNA 5BN4B 2HD4A 4BP9A 2DPLA 1FTYA 3BTSA 4DV3O 1OAAA 3QRWA 3FCYA 1ELOA 5E8RA 2HDNB 2IIPA 5BUZA 4AS2A 4A5UB 4CH4A 1HNXB 3G2OA 3FY4A 4ZDJA 5IH3A 1NYRA 3RVBA 3HA7A 3W8NA 4TSFG 1BDMA 2AR9A 2BP7B 1KI1A 4WN9B 1J8FA 3W3AD 1E1QG 1EFKA 1D6JA 5K3FA 2SKCA 1QIGA 4IDPA 3QKSA 4I1UA 3RVYA 3TSWA 1FLAA 4DR2B 2V9YA 3P45A 1G7TA 2RHGB 5J2UB 4IUYA 3C1OA 5K3BA 3K1JA 2OORC 4KO8A 4FVMA 1DRVA 1QH9A 2WJGA 4TQDA 1XNGA 4CQNA 1OXMA 1FDIA 5BMVA 4GP9A 5E3HA 1YR8A 4WF9V 3KDSE 1P7CA 4V03A 4E5KA 2ZAIA 1IM5A 1R6NA 4UOQA 2WPDA 4LRYA 4EUEA 4DV5B 2YMPA 2VQ6A 4W5JA 1QHFA 1KP9A 1LGYA 4H31A 5FOWA 4QU5A 1ODKA 4NZNA 1IY9A 3Q8KA 1F6DA 3OZBA 3I5MA 3N1UA 2CC2A 2YZ2A 4FJ1A 3SF8A 4CI0B 1LDNA 4RFSA 1NRWA 3QELB 3NM6B 3A9WA 4GM4A 5HK9A 1IRXA 4PAGA 1RJGA 4F9FA 3O7WA 4MB6A 4NYIR 1Z6PA 2D7JA 4TLDA 3U37A 2IHVA 1RFGE 4YRMA 1QB8A 1V37A 1MP0A 3QGMA 5HQ3B 1GN2A 1RJEA 3AW8A 1VJRA 3ABRB 1THZA 2COEA 2QUAA 5GQSA 5ESXA 4MJLA 2H29A 3T6KA 1Q6HA 3AEKB 2OFFA 4MH0R 3OWXA 1GQYA 3IPXA 3AVUA 1U8UA 6GPBA 1UQRA 3ZYCA 3BL8A 4OQYA 3U19A 1JJAA 2COUA 4V2IA 2VT2A 3NHRA 1PTKA 1QMGA 2C4TA 4Z1OA 1KAGA 4NTWA 3IT0A 1KKLA 1DGQA 2XYVA 4PYRA 2EKQA 2BFEB 1AU9A 4ZVSA 3OTOO 4NBUA 1X7PA 3LLCA 4XTRA 2I54A 4GC5A 2VDLB 5LBTA 3EG9A 1Z22A 1KVSA 1YVPA 4OVKA 1Z83A 4HK4A 5D3MB 1UPBA 3BWMA 1JR2A 1SMKA 1D5AA 4L5YA 1T5LA 3Q98A 3WY9A 2HCRA 1IEVA 1JB9A 1M90H 3FFWA 4WLOA 5D3ZA 4HRYA 3RYIA 4FLZA 1BFUA 3UFXB 4AW9A 2CL7X 4OBBA 5CBHA 1J9ZA 5JZOA 3VHXA 1ZIXA 4ZJZA 4UD2A 4AJIA 1ZKMA 3V32A 2A4MA 1WPXA 4S1WA 2A7WA 1YCGA 4RVOA 5CA1A 1K06A 5SZKB 1ZH8A 2IEIA 4C7JA 1SY7A 1YO6A 1HFKA 3CYOA 3S70A 1MPXA 4L50A 1Z2AA 3I52A 5C5IA 5CVCA 2V3CC 3LYUA 3EZGA 2VBGA 5DTRA 3I72A 2DE0X 2EL9A 1HYBA 3R0JA 3THRA 2F7SA 3HR7A 4TT3D 4C4PA 2C5BA 2JZOA 1XCOA 2LVBA 4K9RA 2W48A 4FGJA 1OCZC 3O03A 4CRWB 3B1KA 4E3ZA 5BXYA 5JTTA 1LQ2A 4I1YA 1Q0PA 4M98A 3OQ1A 1MV5A 1G20B 3DKPA 2PU5A 1JSLA 1R5JA 4LQLA 3WJ1A 5JSZA 4KN5A 1VSUA 3X1MA 3EK2A 4D9JA 2EJTA 4YJ3B 3O9OA 4RCYA 3JY6A 1YB2A 2Z2XA 5HFMA 3AJRA 2ZSIA 1KZGB 3PTLA 3DT9A 3QZUA 1JLKA 3KB8A 1HDYA 4O29A 4XYBA 5HIMA 1DUVG 1ZLZA 2XHBA 4BMOB 1Z62A 3FCUB 4GOMD 2ALJA 2OYCA 2OSBA 1BCSB 4HHEA 4GO1A 1B8NA 5AK3A 5IDJA 4YHBA 5E7MA 4L51A 1H2HA 4INAA 2WA4A 3KB6A 1H2NA 1FSPA 4WN3A 3LA8A 3T1VA 1ANKA 4EGFA 1CT9A 2ILMA 1SHJA 4NV1A 1O8BA 3M9XA 3ZRXA 3I62A 4E5SA 1OCOC 3D43A 2XKJE 4NU5A 1W40A 1V96A 1EN5A 2X0LA 1RVDA 5G1OA 5H68A 3PL5A 1N6RA 4BO0A 3WGUA 3RJZA 4PBRA 3CVVA 3QG5A 2PVCA 4MI1A 3WQRA 2V8BA 4IX1A 1CEYA 1QM5A 1CBUA 4I9GA 1GT91 4JJKA 2YFQA 5B1NA 4LH6A 2CFIA 3OTOB 1M6EX 5E2IA 1PR5A 4JROA 1JYEA 1K3UB 1CUJA 5DLPA 5F12A 2AXEA 2IA5A 3A2FA 1EXWA 2BCGY 1MJGA 3H5IA 4NDNE 5M3BA 4ALLA 3U1TA 5IBRA 3EC7A 1Z26A 4AJPA 2JI8A 1ST3A 1U4OA 4OHZA 1Y81A 3R5XA 3K12A 1LUAA 3NYQA 2JGMA 3VU0A 4BQIA 4INZA 1PEKE 2QN3A 4S1VA 5KAPA 5LLDA 3C7TA 5B1BC 5CVTA 1TJYA 2XUGA 1UMDB 5IAEA 3FI9A 4ZTZB 2CVOA 3QMPA 4HGYA 3OCJA 3X2SA 1GWNA 4BVRA 3ET4A 1WB7A 3EXHC 3UT5A 3OOJA 1PIWA 2GPYA 2FZVA 3DGFC 4C22A 2PMPA 2AN9A 3ZD8A 5T6BA 1TE2A 3EWAA 3Q1LA 2ZOSA 3RV3A 2I34A 3TFWA 4LZLA 3AG7A 3HJTA 4MI3A 2VXYA 3VJMA 2HA6A 4CTMA 1I33A 3LOQA 3KEFA 2D06A 4CLHA 4C0LA 2B0JA 1JKXA 1K5DA 1RZVA 2WM2A 4Q6BA 5ARBA 4W5HA 4RZ2A 5AM1A 1TUBB 3EGDA 2PU7A 1EN4A 4LRXA 2EKLA 2OXCA 3M1AA 3OZIA 3ESZA 2Y0BA 1LFDB 2UYOA 1OX4A 2FQYA 2WUWE 4IQFA 1G5IA 3WWDA 1UKAA 1BS1A 1JTFA 1Z6GA 2NSYA 3FYHA 5C5DA 3DLAA 2M6KA 4FOLA 3QPUA 2HH9A 1F2VA 1T0UA 3PYMA 2NWQA 4AKSA 1XV2A 3X3HA 2FUEA 4L8WB 2EZTA 3LTEA 3NCHA 5ITSA 1R64A 3KTAA 4HPWA 3SJQC 1A2BA 4B3RB 1WUKS 3JARA 2ARHA 2VHZA 3WZLA 3IFXA 3M6WA 4EYGA 4DLLA 2SCUB 5FWYA 2GYVA 2E76B 2RJ3A 4XCVA 4RZHA 1ZM4A 3FWYA 2ZT9B 3IJ5A 2P77A 3TBKA 2NPIA 3WWZA 2XAAA 1C30B 2CVZA 5KOHB 2VVTA 3JYHA 3ZHZA 3PJEA 1R27A 4NJMB 1CQIB 3OT7A 3D2LA 4S0XA 3FUXA 4HNQA 1E1NA 4UU0A 4BN5A 4HBZA 1NXQA 3AF2A 2RHOA 4ERHA 2H85A 3QXSA 4K6GA 3WFVA 1EGMB 2A1TR 5FBHA 1EHYA 3HEMA 3TNJA 3DPUA 3GJXC 4MUKA 3HCFA 4F2HA 4ZIRB 1IWBB 2M7WA 2WWVD 4NPAA 3JVIA 3WLPA 4UMVA 1XV5A 3LFTA 3SEQA 5IULC 3MJFA 5MGBA 5JE8A 5LQUA 2C7RA 3FPSA 4I3HA 1KMQA 1P1HA 3UW3A 4WCEV 4WX2B 1PR1A 3CRVA 3EXFB 3IMKA 4Z7JA 3H4VA 3UYKA 4UVEA 1GPBA 1LVHA 4U2KA 4XBFA 1FRVA 3GLKA 2XA9A 3N0TA 1JN1A 5EERA 1ENZA 4QGPA 3IKMB 1V4VA 4C5BA 3TKLA 3G8DA 1XZNA 3IUEA 1NPYA 1UAYA 4YRDA 2ODBA 3OFND 2VO1A 4YQYA 5FAXA 4DPMA 4I50B 4EA6A 3OE7D 3IEXA 5KHKA 2NP7A 1BE6A 3PXEA 1LFAA 4FZRA 5CH3A 5E4YA 1GT6A 3VISA 1WZNA 3UUGA 1ULBA 2ZRLA 4HGOA 4CKEB 1Q0RA 2R96A 2BLNA 2XNSA 4LJYA 3DE5X 1WVMA 2VWGA 4BYGA 1QTRA 5KTYA 2NLOA 3O4GA 4HNAB 4RTNA 5IHXA 4WESA 1QFJA 2QF7A 4L7VA 4WXMA 1E6CA 1R0SA 4O0MA 4S2UA 1YC2A 4LYHA 3L92A 4QOIA 4GZMA 2FW6A 4IIEA 3FGNA 1N5DA 1GZ3A 1DX4A 1SXJA 2H5IA 5MN4A 4AWXA 3AXTA 2XD9A 3ELDA 4RJ2A 3E9EA 4D8UA 4EHJA 4E4RA 3LM8A 4G8DA 5AW2A 5KQRA 5FJJA 4MWCA 1W41A 5EMHA 3RUDA 5F4BA 4E5YA 3U11A 1B00A 4PINA 5KQMA 1F2UA 2OZKA 3QIAA 2FPPB 4TMYA 3W2FA 2B33A 1WR8A 1JHOA 4X6UA 1R74A 1RJ9A 1K4MA 2Q2WA 2VTBB 2OIGA 4YS6A 4DLSA 2CBGA 1MAHA 4D3DA 1BH6A 2JHAA 1ZX1A 5CDHA 1PT8A 1MB4A 2WUVA 5C8YF 5B66Z 1AZTA 1AHIA 4ZHWA 1X13A 3ZU4A 1TTQB 1LBSA 2NYUA 3L1VA 1NI8A 1FDTA 2QPAA 3PHLA 2UXXA 2FYUH 4N5IX 5FBRB 4N1AA 2M6LA 1JWBB 1YMQA 1FXWA 3D8BA 3IAS6 4JR0A 5LLSA 4YGYA 3Q3IA 4ENTA 2JHPA 1QU3A 1T6BY 5HMMA 3M5DA 2Q69A 4QDKA 4BCCA 1X3SA 1NDQA 3ZZ0A 5EHXA 2AUTA 1ZJ4A 5L3BA 4MS1A 2F3PA 2KBFA 2CNWA 3R7LA 2FYTA 1XPJA 1NLZA 4FONA 1A1SA 5B4UA 5AI6A 1KMNA 2L42A 3GZNA 2VKTA 3AWIA 1IXKA 1CZLA 3MWGA 3K0CC 1Y9DA 2GILA 4G5HA 5LGTA 3CW2A 1DEHA 4JI7B 1I3NA 3L7QA 3CWQA 1YQNA 3AVXA 1FZTA 4M83A 4NATA 5DN6G 1O3YA 2MYTA 2AOUA 5T6MA 4PSUA 2X7XA 4IDAA 2WWGA 2LJ2A 1X7WB 1M2OB 2Z3VA 4EY6A 3TK1A 3OHPA 2CYAA 2KHZA 4LDZA 5HF9A 4FSHA 2J3QA 4CN8A 1CRLA 5J2TF 4AVYA 1ECLA 3V8VA 1XUOA 3GW8A 3S99A 1K7EB 3G6EV 1OV4A 3ON1A 2ATIA 1IWOA 2CE7A 3O31A 3LX4A 1MB2A 1IN6A 1V5FA 3NHKA 2OTJV 2DEUA 3NTLA 5E9JA 1SVWA 1OZAA 3VU9B 3I61A 2ZU6A 3EEYA 3L1KA 5JD4A 4YMUA 2B61A 2QU7A 1PFUA 2FQQA 1V3UA 4QPCA 3J7AR 2F43B 3KYBA 4OJTA 3J81A 1RLJA 4URVR 3ZX6A 1YZGA 3DPIA 1GO3F 4F6RB 1GEGA 1C9DB 2HSZA 3STTA 4DQLA 1MO4A 3VVLA 1Q8RA 3QLEA 1NVPB 3K0EA 5DOVA 2WYVA 4YDRA 3C9SA 2BFOA 2ID8A 4CLDA 4DLXA 3AEUB 1KYIA 2B1IA 2IY8A 4UNNA 1P5JA 4PZUA 3V6MA 5BR8O 2ONZA 3F7TA 1VLHA 4AXBA 1EXDA 5KSZA 1FD9A 3L8ZA 1U1IA 1SIWA 2O2JA 3I83A 4J16C 4OB6A 2WTBA 2VZEA 1ORQC 1X0VA 5IT9N 1JR3E 2PANA 3KUUA 3VCZA 1TX4B 4WV3A 4EHLA 4QDXA 1NW5A 1II8A 4M21A 1O2DA 2ZTUA 3C45A 4BU0A 4D3SA 1UKYA 1HQDA 8OHMA 1VQ9F 1KI3A 1US8A 4LV6A 5AKYA 4DLWA 1DF4A 3LRTA 1XRQA 2FN8A 3CF0A 3ZKAA 5KEIA 3B78A 2E7ZA 1USUA 3B77A 3DDHA 3B09A 4K9PA 2CN1A 2G7MC 1YJ9F 2OCIA 3EFOB 2AA3A 3P9IA 2RFLA 3T7EA 4S2EA 5AICA 3BA1A 1IHDA 2VXBA 5DNAA 4DG9A 3DNPA 3OZVA 2QZZA 1RCUA 2FKNA 3BSSA 3N58A 2NT4A 4QFDA 4DMUB 1NMUB 4H4CA 4RL4A 1QTQA 1JI0A 1E0SA 4W4KA 1B0AA 2X15A 5ALHA 3JSLA 3D4IA 5FB3A 2IFTA 1Q0SA 3K79A 2Y0EA 4OXNA 4O2BB 1Q5PA 2HL6A 5G1NA 2X5JO 1G3QA 1KO1A 1U2SA 4BX8A 4R2WA 4GSKA 1N6HA 5KNDA 3VV2A 1EFDN 4FFNA 2FP4B 4IXWA 1YITF 1U3WA 2XZPA 3TN7A 5GJBA 3C48A 1SRRA 4HO1X 2WWXA 4MDHA 3D4BA 2PAAA 1RHRA 1JDVA 2DHDA 1BHSA 1YR2A 2H5JA 1PI3A 2B1QA 3AK4A 5BRAA 2PXHA 4ZQBA 2O52A 4DNOA 2IYRA 2WLIA 1L1EA 1QVWA 2AFVA 1RAFA 2NMUA 4RO0A 5JARA 5HK8A 1IC6A 2X23A 2V6GA 4AURA 3EC2A 1BO6A 4MQ5A 3QUWA 2UZAA 3EPJA 5JV5A 3TE6A 3W3ZB 1RYDA 5F51A 2FE1A 4EHBA 2ON6A 1U3DA 4CIVA 2YW9A 3RVOA 4QTTB 2QL6A 4WY5A 4GRIA 4DIFA 2IYYA 1JAIA 1WMAA 3EVFA 4KH0A 4RD1A 5CVDA 4YXWA 2FDCA 1SBHA 1IJKA 4CTJA 2ZETA 3ERCA 4ZZ2A 2WDPA 5BR8B 1I6MA 2Q1XA 3UJCA 4X6LA 4MVYA 2IY9A 3ME5A 3U3OA 3ENNA 2EARA 3IX7A 2GK7A 3DJYA 3KKOA 1CLIA 3KQVA 3MWLA 2P3QA 3WP1B 5CCDA 2HCJB 3RVMA 4EG8A 5KNCH 2CNNA 3AQ4A 4Q7MB 2FFQA 4EDHA 1VLMA 3ORHA 4EKIA 8MHTA 4RSGA 4LHVA 3Q41A 4E2WA 2ZG6A 3LE8A 4GRAA 2WJAA 3K9BA 5BPHA 5HUJA 1OV6A 5DE3A 4R05A 5CFMA 3PLAC 3PJFA 3BTVA 5E0KB 3UM9A 3BEOA 3K05A 4AP9A 1RQ2A 3F1LA 4QAJA 3T3DA 3BM5A 4CM1A 1QH1B 1Q7GA 3Q3GE 2P1DA 1E79A 2QVCA 2XWJI 4CKWA 2I2DA 1MG1A 3JQ8A 3MA0A 1UFVA 3FM9A 4CL8A 3OPMA 5D3QA 2OHFA 4E2ZA 3NT5A 1NZFA 2I3ZA 1PV4A 2MWMA 1JMKC 4N5HX 4MUAA 1WEHA 4I1VA 2X1LA 4ZI7B 3Q7PA 5EE0A 1TQHA 5AVUA 3P20A 1D2EA 2V9PA 2XCSB 1T0BA 3VO8A 5EP1A 3JQ7B 2XOKG 3NTUA 3S1LA 5F9MA 4LDRA 5JYEA 3C14C 3A1UA 5AJYA 3CVJA 3U7HB 4IO0A 2O5CA 3U16A 1PR6A 2YXNA 1MZVA 1J0EA 2C83A 4LBYA 4BWAA 1OE0A 3OESA 1VJ0A 3RHZA 4DAOA 1DKPA 1WCWA 5LPNA 1WJGA 2RONA 4Q01A 1J00A 2BM0A 5KJEA 2ZJBA 4DMRA 4OA8A 4PXSA 3L5OA 3UKJA 4G36A 3AF5A 5AG2A 1T10A 3O21A 3PP8A 2AV6A 3N87A 2VRWA 2HPHA 2JS7A 3WNQA 9ABPA 2PMWB 4XUDA 4W99A 3UW1A 2C96A 3BWXA 3CURA 3LXXA 1D09A 1CR1A 2Q07A 2GEVA 5L3RA 2JI4A 3ZS8A 4FGWA 1DWQA 4NH0A 4M76B 5M7EA 2GZSA 1AKTA 2F8TA 4LDQA 4ZK2A 4FHEA 4DCVA 3OAAA 2FSIA 4XLTA 4BZZA 2WB2A 4X84A 4BW5A 1J2YA 4ZJUA 5G0VA 1GN4A 4X0EA 2W0FC 4ZRNA 1JH9A 3E8XA 4JU9A 4LY6A 3SQMA 5B64A 3VNBA 2BCCH 2WHEA 2B21A 5LDGA 3ESQA 4Y0VA 4ID9A 3OQIA 2WNSA 4W8HA 2DWEC 3OQ6A 4M1EA 1OCZB 3RBVA 2BFCB 4DNQA 1LTKA 2WK1A 3KS9A 2Y0CA 2GBGA 4J07A 5D1HA 1Z4JA 3WQHA 4R6ZA 2HQSA 2TECE 2ZCVA 2XYPA 2H4FA 4NCKA 1KO4A 4UNPA 3QOFA 3K9NA 4C03A 4E2YA 3UHFA 1SXGA 2H9IA 4E46A 4HUQB 1G21A 4CEJA 1JA0A 5JJKA 3L9DA 4RUEA 2IGTA 1G0OA 1YCFA 1DQNA 2WUFA 3GGDA 3MK31 6YASA 1E8DA 4GUDA 5EG5A 4BMDA 3C3SA 1GQFA 5GANK 4EX6A 4CDNA 4BKOA 2CUTA 3UGJA 4G01B 1G5QA 1Y8QA 3EQZA 3BTUA 1Y66A 4XR4A 1G20E 3SMVA 1YUNA 5LZ9A 2J0QA 3FBTA 4BWVA 1K6MA 4GOLD 1U94A 1G6Q1 1WD5A 1C7ZA 1MQ9A 1CCWA 4F11A 5I8WA 3S1AA 2QEXF 1CWUA 3OZCA 4M22A 2PX2A 4WT7A 1OLSB 3UKOA 5IC5A 2EFCB 1OCOB 4CKCA 3BVOA 2Q0HA 4OXKA 4AJHA 5FULA 5IHPA 2AMJA 3WGJA 5CW1A 1WQ1R 2FFRA 4BQOA 2ZK7A 1QTNA 1Z16A 4JUCA 4WFFA 1Y4MA 3T2MA 4JVSB 5J9FA 4XOUA 3O1JC 1P6XA 5A7GA 2FFHA 4ZAWA 1TCAA 1SZQA 1L4NA 3FTPA 4RIEA 2XB2A 2PZSA 3FNGA 3SR2C 1ILWA 1JXOA 3O47A 2FZEA 2EFEB 1FNKA 1KEUA 2YHSA 3NHAA 2FJPA 2GZ2A 2G09A 4JHLA 2BGRA 3JR7A 3KKKA 1J5PA 1E9VA 3WGMA 1YR1A 4JI8O 1IHPA 1JFRA 4LH7A 3NAGA 3PKIA 5K5EA 1XNHA 4R1PA 3ZDXB 5DWVA 2BFDB 3TMYA 3OEHA 4B73A 4J0GA 2XY4A 1K8RA 4S1OA 2DFPA 3JD1A 3H4IA 1DARA 3P0ZA 3EXHB 2IOYA 1YDGA 2W8BC 3PWSA 1NBMA 3OPVA 3FNHA 3PX7A 4AKHA 4BGDA 2XQVA 4CMEA 3HP1A 1Z38A 2WT8A 2O8FB 1R9JA 3SLRA 3R40A 3STYA 3HCDA 2RHDA 4U0KA 1C7JA 2P62A 4U7WA 2FPIA 4QNHB 1RQGA 2OPBA 5B1HA 3L8FA 5CDUA 3FAVB 3B89A 2OUKA 2G83A 1G8YA 1IOLA 2PZGA 1D1TA 1Q6YA 2JZCA 2EQBA 5F78A 4NAHA 5AK0A 2D7CA 2G71A 5CM9C 2X22A 2PAFA 3F90A 3RSLA 2CKDA 2HV8A 1YNSA 4OXQA 5CJPA 4C2BA 5IXJA 3IP9A 1XRPA 4YAUA 1UFRA 4NWOB 3BHNA 5IWAO 1C3XA 3Q0IA 1VF6A 4HOYA 3ZQ6A 3MFQA 2EKZA 4AN4A 1Y34E 4Z0NA 2VP4A 2GCEA 4XQ9A 1A9OA 2JS5A 3SQWA 1I1OA 1I4OA 1TW3A 3LXUX 4GHWA 2B8NA 2I8LA 3NI2A 1Y6QA 3H01A 4M7WA 3AC0A 2A9VA 1E1RA 5DRTA 3VU3A 4D57A 1EIWA 3HN7A 4GVXA 3H9JA 3EVEA 1GR0A 2VKQA 2I67A 4PIMA 2NYVA 3HKCB 1LPBB 3DOCA 3ADBA 2CGOA 2AJTA 4JQOA 1FS5A 3E1SA 5H2FZ 2P9GA 4MYDA 1PKXA 1DTWA 1GQ2A 3MYRA 5A04A 4C7OA 3IMPA 3B1VA 1FJGO 1OFHA 3NB0A 2QVZX 2R751 3RIYA 3ZX4A 2PWZA 5BT9A 4IOMA 4DDHA 3FI0A 1NH2B 2AHYA 1WXHA 4MAAA 4G24A 3C8ZA 2DYKA 3CNBA 2C7VA 4DW1A 3AKDA 2PZJA 3L0ZA 3O85A 5JSQA 4Q7LA 2AUMA 3V46A 4UU7A 5C5EA 3TS1A 5FO1A 4GPTA 2WWHA 3LKZA 4IZHA 5EJAA 2X3FA 4I1PA 3DWGA 3N53A 4RA6A 3WHIA 3Q5EA 1U2PA 3N75A 4UM5A 2JLYA 2E74B 2YVLA 4JI8B 3G0IA 2ZJ1A 5K3CA 2PMDA 3C5VA 3RDPA 1N2CA 4WNYA 1OAOA 4QLOA 5IFKA 4Q4AB 2WHYA 2P4HX 4F6LA 1UJCA 3LZCA 1T9BA 2VYVD 2PQ2A 5HCIA 3R0VA 3DHNA 2FXIA 2BM1A 2BSAA 3U4GA 3WV5A 2QY6A 1TA4A 2XRMA 1O58A 1B76A 2AG6A 3LW7A 2LKDA 2G4LA 1GUYA 4QC2A 5F2NA 1BHBA 4XAQA 2YUIA 1A8PA 2FSHA 4BLQA 2C99A 2GNPA 2WIGA 4PA4A 3AESB 5K8TA 5A7FA 1OASA 4L02A 4LRQA 2PQMA 4B35A 1QHSA 2GCGA 2W5UA 3F2VA 4OHFA 4QU0A 1FSFA 3IBSA 1OLOA 3ROTA 3IBYA 3F9IA 3NX4A 1JUDA 2MU1A 4E94A 4EW1A 4Q34A 1WG8A 3E05A 1J07A 1BXGB 5DISB 3OPYB 4BIMA 1M1XB 2PFSA 3OH8A 2AHZA 5IMBA 1YJWV 3BN3A 4KGDA 3A4TA 2A6PA 1ZA1A 1E0KA 4G4GA 3HVHA 4NG5A 2IEZA 3RTBA 1X39A 3QPAA 4OB7A 1KSGA 4I36A 3I9LA 2G36A 4ZEOA 1IN5A 5LQSA 4EA7A 2R86A 3T3EA 1M1NB 4BQQA 2KSQA 1SOUA 3TDNA 4Y1RB 4BJ1A 2Z83A 2ADMA 5AVRA 1RP1A 1Z8HA 1L5ZA 4EGAA 2QTWB 5ALGA 3F67A 4REMA 1R6KA 1JF8A 2GT1A 4KG7A 2VCEA 3QJYA 2DJIA 4D6PA 3OM0A 5HXAA 4POAA 1XAIA 2IZ1A 3CD6F 3NPAA 4HXGA 4MJ3A 2P30A 1KR2A 4WAUA 4D4MA 3DE6X 3DEYX 2Q2OA 3KAJA 2IBSA 4M1YA 1OA1A 5UKDA 1FJGB 1EQUA 4Z54A 2AQHA 1NF2A 3ONVA 1MB3A 3LGXA 2UXCO 1QU7A 3UJ3X 1K73H 2P6MA 4FYXA 5EVJA 4PLTA 3CCMF 1ZZGA 4QUAA 3EF3A 2PK3A 3ANLA 3VBCA 3TOVA 2ZODA 2EW2A 4YIHA 3DUFB 4HWSA 5CGQB 2QTRA 1QU2A 3FKSD 1USIA 1DQYA 1W6UA 3NBAA 3GMIA 2A3RA 2BUAA 4FFMA 1WEKA 3BFJA 5G0WA 1TF7A 1L6IA 4TWJA 1H0KA 3W5IA 1U2EA 3JVVA 1WP9A 3CA8A 5BYBA 2XHEA 2R1VA 1SK9A 1LB1B 1N34O 1SBTA 4RVCA 2YIAA 2F1KA 1NVXQ 1EFUA 3C0KA 2A4KA 2IU6A 4IJUA 4HNTA 5K7SA 1QAQA 1HETA 3IAUA 1ZCAA 1ETHA 2OGWA 5JSHA 1DE0A 5BW5A 4KLNA 3K31A 3DCNA 3PQ6A 2NOAA 4A6PA 5EB1B 5AKXA 1TEXA 4DR2O 5ELLA 4LXYA 4MRPA 2GA8A 1XMVA 1MO6A 3CHYA 3QF4A 1SKUA 2GM4A 2I33A 1G4YB 4HXYA 4R2KA 4ZXFA 3E82A 2CHSA 3DHVA 1E2LA 5L7WA 2FN7A 1ZNWA 1DIOB 4I55B 4R50A 4FXOA 3P0JA 5AXCA 3L93A 2W6MA 3UXYA 1NOKA 3QWAA 2ZREA 4LGMA 2IZ7A 4DCJA 5JADA 5EHIA 4R8SA 4INJA 1D4ZA 1A5BB 1G9TA 3ZOPA 1YDEA 2NU7B 3IQEA 1IHOA 4DV5O 4HH3C 3BAZA 1HTTA 5FNVA 2QMUA 5KNLA 4Q9JA 1CUYA 1PM9A 4A0FA 3ROMA 1K1EA 1UBHS 3TZLA 5SYNA 3DWIA 4O2AA 2IYXA 3Q8HA 3ZJVA 3LCRA 3HZOA 3KTOA 4FYVA 2XBUA 2HXSA 3ZJ5A 3PUYA 2EBOA 2HX1A 2MSDB 4BFXA 3R66A 4HYQA 1N7JA 1YD7A 1P74A 2ZAUA 2PY5A 1YFLA 2QHXA 2EL7A 1F2DA 4FFBA 3EVGA 3ABMC 2CLEB 3OCYA 1XDZA 4IF4A 4XSVA 1RWQA 3HO6A 3WQBA 4M88A 4Z0HO 4K8XA 4JN6B 1NJ6A 1I2MA 9MHTA 4W5WA 3U3JA 1T2EA 2VXOA 4RTJA 4EF5A 4HLUC 3FOFC 2UXCB 1ZUHA 2XAJA 2GXAA 2ENUA 4QQ8A 4LUCA 5KYGA 1VPEA 3MGBA 1EYZA 2VJMB 2FA9A 4PPFA 1NU8A 5C1BA 5KHIA 1OBVA 1QFXA 1LDBA 1RYBA 1CR0A 4M49A 3ZBQA 1QQ5A 3NKFA 2C4NA 2RCNA 1ZH6A 2JJ1G 3OPXA 2DERA 4LBEC 2Q6OA 4HGQA 4QM7A 4GPAA 4L9SA 2BGTA 1ZDMA 2PX5A 2E9SA 5H83A 4Q9IA 3TLEA 3EQ6A 4V3BA 2EIJC 3ZHQA 3PYLA 1N34B 3CCVF 3ILXA 4Q05A 3SHQA 1ZSVA 5CCEA 1KMCA 5H4GA 1OFGA 1XTJA 4UCSA 3MCVA 4NKRA 4TS3A 3CZMA 10MHA 1XWWA 3HS3A 1LNZA 4OI2A 2LIVA 5EN4A 3UWPA 2I4IA 1N2EA 4IDOA 5EXPA 1U2ZA 3J81k 4RTSA 2C82A 4D6XA 1VLQA 2FSVC 2KQXA 3PC2A 4OSPA 1GG2A 2E1PA 1MABG 5CFPA 4PV7A 4H0CA 4NK4A 1ZL8A 2EDCA 3FR8A 2QXYA 4MEBA 2XYHA 1QH8A 1V5IA 2ORVA 2BEWB 2I1VB 3M1XA 3BMQA 1VBKA 2JVDA 3BSWA 5FBWB 3CPEA 1KY5A 4JB8A 3K6KA 5HY4A 2ZI3A 2JCVA 1BQ4A 2BYTA 1JLLA 3I5AA 2P27A 1FBNA 4WK0B 1E63A 1XNRO 2HJRA 3UO8B 2Z57A 1ZM3A 5IP5A 1VQMF 3HYNA 3P7MA 3FPAA 3GJ6A 2Q5LA 4DUZB 2Q0SA 1USWA 2ECKA 3LHKA 1PVDA 3M99B 2Q49A 1HSOA 4LISA 3G4SV 4ZICA 3E70C 2JHGA 4BNYA 4XWWA 1CS0A 3GJSA 1N9GB 4AZ0A 3BF8A 3BCHA 5K3OA 1Q82H 3UV6A 3NVDA 3DBRA 4Y67A 2P2SA 1BJRE 3QTTA 5DHSA 3EIOA 4Z4FA 1VB5A 2Z2JA 5A0VA 4BT4A 4QFMA 5ESWA 1BD4A 1JQBA 4DUGD 4IJQA 3DOFA 3GDFA 4PGMA 3PI6A 1VZ2A 4PZYA 3STWA 1SM4A 2C5LA 3F0FA 4ZP1A 5GONA 4C0BA 3IHKA 3DD1A 3E9RA 4EK9A 1N2JA 1YI2V 1YI1A 2CDRA 1PK9A 3G85A 1JDUA 2HSDA 5AM4A 4RCVA 4ZKEA 3MWFA 1ZMTA 3K0AA 3A05A 4PZ0A 5LOVB 3RS5A 1JECA 4HFNA 5HZGA 4OX9Y 2BV3A 5PGMA 4OM7A 3PE4A 3Q9LA 1EK2A 3Q7IA 3TTXA 2W6JD 1GXSA 5HHTA 3DYIA 4GMXA 2OHHA 5KVVA 4MIOA 3NR2A 1Z17A 4B6SA 5C0OE 5EY5B 2NUBA 5CDGA 3EA5A 2PX8A 2E48A 1D0IA 5IUKC 3PNPA 1SUPA 3EIFA 3ANXA 3L7IA 5EQFA 3G59A 5I3ZA 1GQQA 1LSJA 4OXXA 3M81A 3TW6A 2W0MA 3EC1A 1WXIA 3B51X 3IXMA 3U10A 2FV8A 4RCZA 3FUCA 3FSRA 1P2TA 1U3VA 3WADA 1DCFA 3F0DA 4J0CA 4ZAVA 3L6OO 3GEGA 5AVVA 2HS4A 5M29A 5I7HA 2WLSA 4Y6PA 1ODEA 3FHLA 4UZEA 1SELA 3A70A 1YI2F 3SNKA 3BKXA 2VRNA 5JWRA 1VZ3A 2FZLA 4KITB 2CBZA 3ESAA 1HNWB 4RULA 1ZN2A 5IG2A 4UFZA 4KRYA 4PG5A 3AFGA 4R8MA 2GBCA 5TSDA 3TR0A 4CLRB 3EGIA 5LHGA 4GMFA 2W83A 3D0KA 3MYYA 1HMYA 2QKCA 2XMQA 1XXLA 2M1ZA 3NANA 2IGBA 3PHGA 4BNZA 2FPWA 4KXWA 1PRYA 1XNRB 4KO4S 1GDTA 2R48A 2CMHA 5B1EA 1RCTE 3H0CA 2VPZA 5K0JA 1R0ZA 4QDTA 1NLYA 4JXXA 3DZ8A 5TIIA 2BMEA 3HJBA 2E4YA 4DYHA 3ISJA 2VFAA 4UKDA 2PZLA 2XKAA 1UFYA 4MKHA 3L0CA 1PFYA 2PSHA 2PWYA 4WVLA 3EA0A 3DE7X 1QPGA 3BE4A 1E7QA 4K88A 4X62B 4B3HA 4MHSA 2ZRMA 3R9XA 3I9MA 3LQYA 1D6MA 4LI3X 4ZHQB 1I6WA 1LSSA 1LV8A 4TLMB 3SZMA 3VI4B 1FYXA 2RK3A 5IYZF 2OO5C 3JYNA 1X1RA 4RLHA 4FN4A 2O8NA 1J24A 3NMUC 5C52B 1E3SA 1XJ0A 2GVDC 4B3RO 1VE7A 4Q1CA 4BX3A 2XZTA 4JC0A 3CX8A 4CIYA 3RADC 4ZOLA 5C32A 4GOXA 4MVZA 2RBEA 4C89A 1NHWA 2CNDA 1ONBA 4CUJA 1N0WA 3L1IA 2ZJ3A 1F3LA 2EYUA 5H3LA 2UUBB 3CLUC 3R2JA 1XMXA 4COOA 4DSUA 5TGTA 2VPIA 2RGUA 2NTNA 4ZCIA 2A57A 2XQKA 3ZW9A 3R6LA 5A2GA 3ROQA 2Q68A 3P9QA 1SBIA 3LDGA 1JQDA 1EP1B 2MSEB 3JVHA 1UL1X 1UMBB 3L7KA 3E81A 4DN6A 3ETNA 1PUIA 4PICA 1E7KA 2HSGA 3SS8A 4YJHA 5YASA 2BBOA 3AM1A 5LCXA 1RLIA 2XMRA 3WKCA 3B8EA 2WT4A 3EGXA 4P4SB 2Y27A 1XTUA 1GTMA 3IALA 1V3TA 2QM8A 4ND8B 1YQWA 1M9NA 4UEOA 4MGYR 3T5MA 3EN0A 4EG0A 1IVYA 5DYTA 4E2XA 1ZINA 5D3KA 1JR6A 2BMAA 2BDEA 1JEOA 3X1YA 3OM3B 1GA1A 2D3TA 4MK4A 3IOBA 1H6CA 2PZEA 4TSFD 2RSLA 1WVGA 1Q90D 4ZRMA 1E1QD 3NWPA 4O59O 2CXHA 1N3YA 4MTFA 4DWOA 3L7JA 1QE5A 1WXXA 2P2CA 4RTOA 1BC5A 2FGJA 1TJ3A 4UCXA 4F4LA 3E3LA 5HX7A 5C7OO 2OV4A 4UCFA 4LDAA 1YFJA 4RM2A 4BZWA 5ALOA 4KQGA 4MUGA 3JQGA 3CZ5A 4G65A 4D4LA 1M2EA 2FZWA 3G8YA 3UY4A 2BE7A 5BNFA 3DEAA 1GUZA 4ZRDA 3DLHA 2C29D 1XHZA 2I6TA 3M6LA 4I8XA 2OG2A 4ES6A 4EYSA 1YJXA 3PV0A 5K01A 2V3VA 2RGNA 1PWXA 2PUCA 1U2TA 2H2GA 2C2XA 2IVZA 2OSVA 5K6AC 5AHOA 1U7DA 2BMVA 1CXZB 5BR1A 3UJHA 1ZJZA 1U97A 1OYYA 4D96A 1OHHG 2V6JA 3NORA 1OIXA 4UUOA 4BVBA 2O8CB 1YHYA 2ZWAA 4YACA 4L2IA 4ZYLA 4YCLA 4EKNB 3WIUA 1P61B 3OO1A 4V0SA 1AJPA 3L6BA 3PGMA 2W8BB 3F5WC 1UMCA 3HDYA 2IDZA 4BASA 3K15A 3N2NA 3SXUB 4D97A 4QARA 1CIJA 2ZIWB 1NJGA 3K70C 4XM2A 3AOGA 3CF4G 2C2ZA 2GD1O 1UDCA 5JZ9A 2QDXA 1UOOA 1RPNA 2WLTA 2X2EA 4DBLC 5TPWB 1ECPA 2HRCA 2VSXA 1Z47A 1FX0B 1YR7A 2EJVA 2W2MA 4RQEA 2Y66A 2QN6A 4ZKDA 2JGEA 1QHNA 2H2HA 1O95A 1MAWA 4O5OA 1RXVA 2GHQA 4YA6A 3WGVA 3D4OA 4LVNA 1XO1A 3KBBA 3VVCA 3NJ8A 2YL2A 3R3UA 4RTQA 4TUYB 4JP1A 5K20A 2VDOB 2HV9A 1LX6A 5IS2A 2XW6A 3LHSA 1YB4A 3NNDA 1KSJA 4PX3A 4TWRA 1Q92A 5K0FA 4JR1A 1GN6A 2HWYA 5BN5A 4IWNA 4YNBA 1ZAUA 3LT1A 3GGJA 1V48A 4J0EA 1IRIA 4WGFA 5K1PA 3QQ5A 4B5CA 4U7PB 4JI7O 3TLKA 1FDUA 3QEMB 2VP5A 3D6AA 3IEQA 3B6EA 1E0JA 4P32A 3PHCA 4RPKA 5TXGA 1IK6A 5L3EA 1QAHA 1BGVA 1CDOA 4S35A 2R6FA 1XMIA 2ZDQA 3N2YA 1P77A 3KCNA 4TYYA 6REQA 1B6TA 1MVLA 3KZNA 4FK8A 4ICGA 4XOIA 3OA2A 4C0QC 3SZUA 1M74A 3R09A 4N3CA 4GSYA 5DM4A 1SB9A 3KSRA 3A6KA 5EJ4A 4YUYA 2EWCA 4WBXC 4L7QA 2O19A 2NTYC 3PUJA 5IAGA 4EENA 3GOQA 1J70A 5DGIA 3T1QA 2CLCX 4P7BA 4TRNA 1K63A 2CHTA 2F9MA 1ROPA 5HZHA 1TU3A 3ZDQA 2AJ8A 4DBLE 1Z4IA 4XH9B 4ZJYA 5A9GA 1P73A 4J4HA 5BSWA 4TZKA 2QX6A 2OZLB 3OHSX 2ACVA 1EFRA 2KJQA 4BWYA 1R50A 4CQMA 1ZW1A 3IOCA 3DXRA 3CLSC 1QIKA 4X71A 1PN3A 3F98A 3I04A 4O4IB 3OLZA 1CNMA 1ESDA 4UREA 2H6EA 2I4NA 3TIIA 5JAPA 2JAPA 2VYQA 3QUQA 2DT8A 3D3IA 1SJ9A 5IYCO 3TLZA 1LI7A 5HG0A 4U8HA 2WD8A 3C3XA 1WCIA 4OK5A 1NQUA 2KLHA 1M2WA 3W2GA 4LYDA 2NVUB 4BFUA 4MV9A 3CCUV 4EY4A 2FWPA 3BIOA 1F4PA 4L3VA 2IHTA 4Z1MG 1KPGA 1WW2A 3VJKA 1P9OA 4WDRA 3FPFA 5JPIA 4C05A 2DUUA 1LPMA 2BD0A 3RIMA 4JI0B 3H0EA 3L1UA 4WQMA 3FR7A 1VLJA 4OOFA 4P2BA 5L3SA 3I4CA 2RJOA 5DT9A 1V8BA 4HDNA 4QE3A 5HBGA 4PAQA 4KC0A 3K3PA 4ZANA 4NENB 2AN5A 4A91A 4DXDA 2GBOA 2PZAA 3SJAC 2HA0A 2XUZA 2V4ZA 3O0TA 2IUSA 4Q9AA 1V39A 5CVJA 2IF2A 4ZVLA 2NIPA 4V0ME 2FNAA 1V54B 4R9UC 3ND7A 5EWLB 4BW9A 5JISA 3DZDA 2QTLA 1KYVA 2COKA 4LCEA 3PI7A 2XMPA 2HLDG 2UUAO 5EMKA 4JGBA 5JAUA 1W34A 1DLIA 4C3VA 1CSEE 3ZK7A 1PYDA 1MO2A 1BW9B 4BTLA 2YS6A 5I9SA 1Z4QA 3ZRWA 4CH5A 2AL7A 1KB9F 2Y0DA 4U7NA 5L4NA 4BV3A 2OOKA 3I55V 4H7IA 3LSTA 3AL2A 1AI4A 4HV4A 4CDGA 3MMPA 1H93A 2ZYIA