4TV9B

Tubulin-pm060184 complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
428
structure length
423
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 170
structure length 423
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv9B01
1SA0B 4X1YB 4EI9A 3RYIB 5MN5A 4KWEA 4IIJA 3N2GB 3HKCA 5MN6A 1W59A 5EZYA 4TUYA 5J2UB 4ZHQA 4WBNA 2VXYA 4O4IB 5LOVA 5LXTA 3JASB 5JH7A 4B45A 3JALA 3N2KA 3WGNA 2GVIA 4FFBA 5LP6A 4O2AA 4YJ2A 1FSZA 4LNUA 4ZI7B 3RYFB 1W5EA 3N2GA 1TVKA 5CA1A 4IIJB 3WGMA 1RQ2A 4X1KB 3HKDB 2RHLA 1TUBB 3HKBB 4O2BB 3JARB 3RYFA 5IJ9A 3JATA 4F6RB 3JALB 3JASA 4DRXB 5JH7B 5LYJA 3N2KB 3HKEB 5GONB 5CB4A 1FFXB 4I4TA 3UT5A 5IJ0B 5JQGA 4U39A 4EI8A 3ZBPA 3RYHB 3E22B 4ZOLB 3RYCB 4I50B 4EB6A 1Z5WA 4TUYB 4ZHQB 5KX5B 3ZBQA 1JFFB 1Z5VA 4U3JB 1W581 4X1IB 5MN4A 4I4TB 3UT5B 5JQGB 4E6EA 4HNAA 4X20B 1RQ7A 4LNUB 4ZI7A 4O2AB 5EIBC 1TVKB 5CA1B 5LP6B 3R4VA 2BTOA 4O4HB 4F6RA 4TV8B 4I50A 2BTQB 5J2TB 3HKDA 4EB6B 3HKBA 3ZIDA 5IYZB 5EIBD 4DXDA 4O4LB 5C8YA 4U3JA 4IHJB 2R751 3WGJA 5EZYB 4WBNB 1OFUA 1FFXA 5IJ0A 5ITZB 5IYZA 3WGLA 5LXTB 5C8YB 2VAMA 3E22A 2VAWA 2RHOA 3VOAA 3WGKA 4O4HA 5JCOC 3RB8A 2BTQA 3CB2A 5J2TA 4TV8A 4XCQA 4EI7A 5LP6C 5ITZA 2RHHA 5EYPA 2XKAA 4O4JB 5BMVB 4O4LA 4X1KA 5KMGB 3C8LA 3RYIA 1JFFA 1RLUA 5KX5A 4X1IA 4O4JA 2R6R1 3JAKA 3JARA 5IJ9B 5JCOA 1W5AA 1W5FA 5LOVB 4O4IA 3VO8A 3JAWB 4TV9B 5JVDB 5LA6B 4YJ3B 5KMGA 3HKCB 4FFBB 5J2UA 5FNVB 4YJ2B 4I55A 2RHJA 3VO9A 4IHJA 3M89A 4M8IA 2Q1YA 3VPAA 2VAPA 3RYHA 1SA0A 3VOBA 3V3TA 5CA0A 4ZOLA 4X1YA 3RYCA 5FNVA 3M8KA 4I55B 1TUBA 4O2BA 5LA6A 5JVDA 4B46A 3JAWA 4HNAB 4TV9A 4YJ3A 4X20A 3HKEA 5M7EA 5LYJB 5GONA 4DRXA 5EYPB 5CB4B 2XKBA 5BMVA 3JAKB 3JATB 1W5BA 2Q1XA 5CA0B
chains in the Genus database with same CATH superfamily
3GHZA 1Z5GA 5HCUA 4F97A 1MX5A 1T3GA 2GVDC 3Q5GA 1IZ0A 5KQLA 3MRTA 4NMMA 4UXJA 5ALEA 4YEDA 2ZUCA 2LFSA 3H1LH 4EGCB 2OTJV 1P6QA 3BXFA 1IN8A 4R4JA 3MW8A 4KGVA 1GPBA 3ZRWA 1VL8A 2YBDA 5G4LA 3NR7A 1CD5A 1RPAA 3U11A 2D06A 2D1RA 4IDNA 4AI6A 1SG6A 1XDUA 4DV1B 1ZCFA 2OHVA 5B1OA 2W70A 1BC5A 4FYXA 4R40A 1PG2A 4HB2A 3MOSA 4IXTA 5H02A 2EHDA 3EMBA 1C3LA 2QVZX 4NXMO 4CDRA 2WDZA 3VKVA 4B32A 4ZGGA 2PD6A 2FWBA 1SUWA 4JYBA 4LF8B 2A3RA 5DNVA 2V6GA 1ZMXA 2V5VA 1VECA 2WNSA 3B3AA 3NKVA 1GQ2A 1X1TA 4XM1A 2FDRA 1X4TA 2PKWA 1Q90D 2D5CA 3QHQA 5JSZB 4KR7A 4B7XA 1YR7A 5KUKA 3E81A 3FKSD 3HCOA 3WRYC 1FCJA 1U0FA 1KY3A 3G2KA 4GHWA 4E4RA 3RFRA 3D36C 2DOSA 1JHUA 1R3UA 1QGUA 1XX6A 1KK3A 2PR2A 2R4QA 3FSEA 3PFFA 2GKSA 2DEUA 1ODEA 3A0RA 1Z0UA 4QHTA 1DO8A 1PVVA 1FP7A 3GNLA 3KC2A 3FWKA 3SYLA 3F5SA 1N6PA 1GGEA 3H5TA 1JTVA 1RQNA 1SU7A 2IHUA 4RQBA 5K6AC 2JHAA 2VDVE 3DZKA 3VV3A 4PG8A 1A82A 7MDHA 3K92A 1OILA 3FHLA 2F1OA 3LX6A 4GOND 5FRDA 3ZCQA 1U2GA 2MTBA 4F06A 4UFPA 4P4LA 2NAFA 4FR5A 5L7WA 2R9RB 5TQ0A 3HXKA 3V00A 3WL4A 1EEHA 3PTLA 1IJKA 3UFXA 4RHCA 2PZFA 1J2EA 4MV9A 2K9PA 3IXQA 1IM2A 3UO8B 3K4HA 3MFQA 3OZTA 3B9BA 3HYLA 3WBJA 3AG4B 4TGLA 2XUDA 3KVOA 4D9EA 4WY8A 4XWGA 2MINA 1NVAA 1M2FA 2PWZA 4H6WA 2G9ZA 4A26A 2OPBA 1VA5A 2NADA 2P1RA 2WWVD 3TEJA 4MJLA 2XGGA 1VYUA 1WRBA 3DV2A 2R8ZA 3LVRE 3SZRA 16PKA 2P0AA 1Z6XA 1OC2A 1E18A 5JD3A 2ARKA 4BVGA 5JI2E 3OZDA 4BVJA 1NT2A 5EIWA 4ZCTA 2QD3A 4YRPA 5DX8A 3KQUA 1RDFA 4JBLA 4NX2A 1WU7A 1O95C 2D2FA 1S72F 1Z0ZA 2D1SA 3OLWA 1W5AA 3QUAA 4Y2VA 3OU7A 5FWDA 5C35A 3UFBA 1R3LC 1UC4B 1C9KA 3BILA 3JYLA 3AF1A 1SQXH 1WNSA 2QUIA 5AJWA 4FSDA 1Q0QA 3OE7A 2DE0X 2Y0DA 1SCUB 1VPDA 3E9CA 1FNMA 4TL7A 5BWLA 1ABEA 3D02A 3CZQA 1II0A 2GZ1A 4L5BA 2NSJA 1GYPA 2A5FA 4HFJA 2FMIA 1U7OA 4RQAA 2AG6A 1B3BA 4ZARA 3ZTTA 4GMKA 5F7OA 4YJDA 3CVYA 1RWMA 2AFHE 3BEOA 1YQUA 1HRKA 3KKQA 1QR2A 5INTA 3ETEA 1GZDA 4EP1A 2OAEA 1NVBA 1VQ7F 3TNJA 3I5DA 5LYJB 4P30A 3EFEA 2W2TA 4QA9A 1HNZO 2W4QA 5EWJB 3FX2A 3GEGA 3QXJA 1HORA 3I8XA 1YQQA 2ODWA 4MYDA 4R83A 4IHJF 1PBTA 5E95A 1K92A 2OORC 2P4HX 4J1NA 4KAAA 3H9QA 5ICGA 1PV2A 5A2QN 4MVSA 2IZOA 3BTSA 3EQZA 1K0FA 3E20B 2Y4NA 2NUAA 2PZMA 3QLVC 4BNYA 2O1WA 1T8PA 4AW9A 3D5EA 3SMQA 3TRFA 4TSRA 4K26A 1R6NA 2F43A 3ICOA 3UGQA 3GPLA 5CG2A 1IBMO 2VSFA 2G5TA 2P62A 4JOCA 1XXLA 5MF6A 3A32A 4JEIA 1KAOA 3TIIA 2EBFX 4E5NA 2V1UA 4I5GA 1Z6AA 2H7VA 1S89A 5K8VA 5CUQA 3OJLA 2WD8A 3X0DA 3AR4A 1P84F 3QVTA 2H3OA 3P96A 5HMMA 3NEYA 3PNVA 2R72A 5M3BA 3ZXSA 1DUVG 1VHTA 2VRWA 4ZQFA 3CSDA 5LZ9A 3VNVA 4G07A 1DKQA 3LVQE 2VGMA 1FSFA 3IMEA 4PHGA 3QLTA 1JN1A 3DPIA 3QKRB 5DSXA 3SXPA 2XYPA 2UXCB 2D1FA 1PNLA 2JFOA 3CR7A 1QK4A 2PEZA 1Z5UA 4C21A 1UEIA 1JPXA 3ABTA 3QNEA 3A2MA 3QPUA 1J7HA 3ZBPA 5CFMA 5HQTA 1NVVQ 2FPWA 1RXYA 2ZBVA 3I01A 2P9BA 2FWRA 1GLNA 4KHPB 1EXMA 1G8PA 3LXRA 3QXSA 4M0CA 5EP1A 3RSQA 3T35A 3WIEA 4H31A 5L53A 4S1WA 2PUAA 4M1SA 4X5OA 5J58A 5SYMA 4KL1A 2FKNA 3H6KA 3RABA 3ZXUB 3FPAA 2YYZA 4FVTA 5DP2A 4RK7A 1UZAA 1H2AS 4JC4A 5B55A 5LHIA 3JZDA 4US2R 4XIIA 2WTEA 4I7EA 1ENYA 1T15A 3WFZA 3WISA 2FWNA 1SU6A 2X2OA 1NJ2A 3FZYA 5LQRA 2GJSA 1VQPF 1KOJA 3EF1A 4Q47A 3KO8A 3IESA 3U7IA 4O2BF 1V95A 2I6QA 3R3VA 1BKSB 2W2XA 4G5XA 1IV2A 5GM1A 2UU9O 5SZJA 1MTOA 2XX3A 3A9WA 5P8WA 2E2WA 4C6RA 5BVHA 5TLSA 4MWSA 4RLFA 5C8VA 3JXEA 4Z9XA 5BV0A 1DC4A 2QKSA 1OQAA 3PQ3A 4WBXC 4XUEA 5EGNA 4K40A 1A9ZA 2WMOB 3K9WA 4O4JB 4OB8A 4TWAA 3TLXA 3Q7TA 5CPBA 4OP1A 1BXRA 3NUZA 3NASA 4JR2A 4LA4A 4EIWA 2GZRA 4DMMA 4PBSA 4G41A 1KYWA 5HFJA 2GAIA 1VFNA 2JFGA 2DYRB 3P27A 4LRTB 2CH7B 4UAVA 4IBOA 4CIAA 1IZ3A 3VQYA 1QVGU 5SICE 1XNRB 4BB9A 2H48A 2J5QA 3OPMA 3HCNA 3L74H 1EX9A 1XN4A 4WX2B 1X38A 3UOWA 5JZ9A 1K3UB 4OM8A 5AUPB 4QEZA 4R0NA 1TMYA 3IVCA 5AK5A 1KKCA 2ICAA 1L0BA 3K0TA 3BKWA 3UMCA 2B4QA 1B26A 1N75A 1ZOOA 1NXSA 3P5BA 1J5PA 4FHFA 3JZIA 4RE5A 3SXUA 5IUJC 1Y6GA 1MSDA 1E5QA 2PH3A 4XYEA 4B3DA 1XTSA 5BQPA 5LP6F 1E9FA 5DMHA 1KZYC 3U7GA 1FNJA 3PPIA 3OTIA 3UJBA 4DSUA 2CXPA 1Q0HA 3A37A 2YDYA 4GI2A 5DRTA 4HQLA 4ZVSA 1GL6A 4FLEA 2PFKA 2IEZA 5CA0B 2NN4A 3SPCA 2BFMA 4R9NA 5EC8A 4BNWA 5FH9A 1D4OA 1PEKE 5K0EA 2GXAA 1ZXBA 3H1GA 1F6BA 1VQ5V 3I1FA 1HLPA 4B3RO 3TSCA 3RNOA 1UXHA 1Q17A 2R8RA 3UTDA 1Y3CE 3EFFK 3AB3A 2WVGA 1GZHB 4NK5A 1JPVA 3RHTA 3V8MA 4V0ME 3HVRA 4REOA 1ZGCA 3ZNPA 4BYMA 4LF9B 2FR1A 5DBIA 3IVGA 5JSHA 3IP9A 5H6QA 2QMZA 3KU1A 1RABA 2H8GA 3WGYA 1XZNA 3LQYA 1G4AE 1DMSA 1ITZA 4F4HA 1EWYA 1E2DA 1JT2A 2ANBA 4K9RA 5FOUA 3AG1C 2IPXA 3E18A 4RK0A 4UEOA 4CMEC 2PUEA 4CMKA 1J07A 2W2LD 3W7AA 1DKRA 3AY6A 2O59A 3VM6A 5JXHA 1M1NA 3BJZA 1MN6A 1NL3A 2Z30A 4G23A 3USZA 4UMFA 1FL9A 4EFDA 1I4EB 5KZMB 1E9AA 3GH1A 2ONJA 3JASA 2I6DA 4D96A 3U3DA 1H1LB 4IGAA 3ET5A 5SYAA 3NV7A 2QYSA 3TGWA 4JBYA 1YDEA 1VJ5A 2LIVA 2VSOA 1Z2AA 5AHWA 1WSAA 2RH4A 1YZKA 5F1PA 1LJUA 5HK8A 3MSXA 4AJ1A 1N8KA 1Y34E 4A0QA 3CNLA 3MMZA 1JDNA 4ZYVA 1JDVA 1QO0D 2VNHA 3QKSB 4KN8A 5C7YA 3K1AB 1PR5A 1I10A 1TEVA 2KMLA 3H2KA 4TV8F 5LQUA 4BBJA 3MPUA 4OKSA 1DKMA 4YT2A 2WB2A 2C2MA 1P45A 5JO0A 1PTJA 1C0LA 1Q16A 4TWKA 4Y6RA 4DDKA 1T2EA 5CDUA 1B2LA 2B69A 3M6WA 4MW4A 4G5YA 3PXUA 1O7JA 4ARZA 4QYWA 3OA0A 1ZIPA 5IPFA 3FXAA 1EMDA 1DTWA 2V9CA 2PMFA 3KVVA 3ONVA 1EBOA 5F1OA 1JG4A 3N7UA 1DRVA 1VGQA 3OSUA 1YS4A 3FJYA 2YXHA 3H1BA 3IO3A 4EYGA 2HGZA 3JR3A 4CKYA 1VQ6F 4RULA 1FRFS 4ZV4A 4OB6A 1F4NA 1GV0A 1RNLA 1YT5A 2WMNB 3AESA 1NXTA 3T3OA 1N3YA 2WSBA 1GZ5A 5KOJB 1JH9A 3F3KA 4DADA 4KYTA 4BGEA 4V1CA 1UKYA 2EILB 1D0VA 3IAS6 4B7ZA 5ICMA 4I3HA 3VOAA 1JZTA 1ZISA 1JQJC 2VN8A 1H6CA 2FWPA 3PPYA 4U02A 4B6FA 1EVLA 1I4OA 2XQVA 4UM9D 4ZQGA 1WEHA 2OKCA 2RGDA 3A11A 3C7AA 3U7QA 4DUZB 3QYFA 4B43A 3OI7A 1VQPV 1HDZA 3B5IA 3PRYA 3DOUA 4Q3KA 3WYGA 4YFYA 1UJNA 1UKAA 1SBYA 3MWDA 3TK1A 2YHBA 1G5TA 2CZCA 2J6IA 3LQRA 2XJ4A 1K34A 4G8JA 2J3JA 2A86A 2HKIA 1SZTA 1CR0A 3OIYA 5C7IO 2UXBO 4R41A 2PYZA 5D1NA 4G8BA 5H1YA 3FPBA 5IARA 5AOCA 4KQFA 1YXMA 1LRJA 2HS3A 3JVEA 2IHYA 4PAWA 2C7PA 4B4KA 3DXFA 1ADFA 2CYAA 2FH5B 1B8PA 4NXNO 3DNFA 3IPCA 4FOOA 3JQQA 4MJXA 1FTSA 4G89A 2XI4A 1QFMA 4C8EA 4S1TA 2ZIUB 3GYQA 3NB0A 4J4TA 3CU5A 2OBBA 2OGSA 2HVJC 1UWVA 2ZJ5A 1NC3A 3DT6A 5LHGA 3EC1A 2ZAYA 4LVNA 2X0FA 2VS1A 3DQZA 4EUKA 4BXOB 5LB4A 2WJ3A 2BCEA 4GYJA 4N7JA 5CFNA 4G4JA 5HY2A 1XEFA 4YT8A 1BXRB 2WPDG 1MUUA 1ZD2P 3CRMA 2CFIA 2OCPA 1BGVA 1NMXA 4XRGA 1G8KA 1YRHA 4NJMB 4D9JA 3N2NA 2BDTA 1MJGA 2GUWA 3GRVA 4PLPA 1AGXA 1Q2XA 4Q02A 1PWHA 2RMKB 1UBKS 2VHTA 4LF5O 1RHKA 1PG5A 2IOQA 4O2AA 1WMAA 1FRVA 2CHVA 2YXYA 2MSLA 4PZUA 4QDZA 4E33A 4YXFA 4M60A 2CV0A 2QTRA 3UCXA 1XMIA 2ZM5A 2JJMA 5B8FA 3OAAD 4XGKA 2I2DA 3V7WA 1GR0A 2KBEA 5DT2A 2PSHA 2V59A 3SKXA 3WQHA 4RXUA 4YCJA 4Y6OA 3GJ6A 1FYWA 2BFDA 4KN5A 2QLTA 2WILA 4D41A 4CMHA 5EJFA 1K6JA 3KPYA 1DDIA 1Y7HA 4PDRA 2CHFA 2Y9PB 4MUYA 2F17A 4LQ4A 4O3FA 4ZCPA 3SQOA 2YFHA 3STWA 4ENPA 2WWFA 1A2QA 2PKYX 4MIKA 4Q4DA 5CH5A 1DGQA 4JN6B 4A23A 1GL9B 3EYWA 3T1YO 3LK7A 4HZIA 4ZQCB 3WPWA 3DLPX 1XELA 4QL3A 2WK1A 3EPKA 5LQMA 4J7ZA 4FEGA 3WKEA 4DTIA 2GNPA 4LRUA 3AH8A 4IAOA 1PGJA 3IL2A 1CQJB 2ZUEA 5JQGB 4AP6A 1IK4A 1EN5A 2OQ2A 4C14A 2PS1A 3ANYB 4FGKA 2J0QA 3E03A 4MCHA 4L87A 1W29A 3RTAA 3OTOO 4MVZA 3G2IA 4ZKDA 1M56B 4QT4A 4LVCA 4XDZA 2Q29A 2Y1DA 2WALA 1KMHB 4JI3B 1OYWA 2WUEA 3KIZA 1TD1A 3STHA 1KA9H 4DC0A 1HT1E 1V8ZA 1MO6A 1B0PA 1UBEA 1WDTA 2NXWA 2C4MA 4JIGA 5CA0F 1G4UR 1E1DA 3HR7A 4UUJC 3WGJA 4RKQA 3JQ7B 4B71A 1KIFA 2XOXA 3OOJA 1LTHR 3LPCA 1N2HA 5I9MA 5BOSA 4U8HA 5FP0A 3HCBA 5JXJA 3LL4A 3DBHA 2BR3A 5C1IA 4DUGD 1QDLB 4BP8A 1B43A 4BO7A 4TMXA 2PUVA 2F64A 4MVJF 5EHNA 2DMXA 3A2LA 5JBNA 1T3SA 1S9DA 4WFBV 3S2GA 3HO8A 1GO3F 1UC5B 4DYLA 3O3NB 2RNBA 4N21A 3OC0A 1XP8A 2XBMA 3IE2A 1KHHA 4KOAA 4X1IA 2CWWA 3UH1A 2WQZA 3S3XA 3QVKA 4Q5IA 3VNQA 4IMJB 5IRCD 3MJRA 4JP1A 1R6XA 3K04A 3DMFA 4PI2A 1K0UA 1A4XA 3FUXA 3O8OB 2JJYA 3CLVA 3TTUA 2CHTA 3F9IA 3VTZA 1FY2A 1GGHA 1XL0A 2HP0B 2QNRA 3E61A 3WA7A 2ZE7A 3LBHA 1E3TA 1FZQA 1K5DA 1MENA 2A4KA 2GX6A 4ED9A 2B94A 1TDJA 2DYRC 2FDXA 3DEJA 5KJEA 4N9WA 5NLLA 5JS8A 3MM4A 1RKXA 3LNTA 2Z8YA 3BSWA 1VQNV 2CD9A 4JQCA 5DEDA 1L4NA 4CCAA 5EZ5A 2WLMA 1U99A 5HQ3A 1AOXA 3OFND 1ZCZA 1WWKA 2OFPA 3K7EA 4I66A 1I2ZA 4MS2A 2FMHA 3B7PA 3BREA 1YULA 2CVOA 3CGGA 2HY7A 5GJVC 1WP7A 2BBTA 3KL4A 2NYUA 1B6QA 3I3SR 3UV6A 2FMFA 2J3LA 4E5UA 4FZJA 3HEBA 1OB5A 3ICPA 3APOA 4K3AA 3P19A 4OYHA 4IIJA 3W4KA 4B3RB 1JLKA 1WLYA 2Y1GA 1YC5A 1XTIA 3ND9A 1F0NA 4WA8A 5FD8A 4LJRA 2NXCA 1EBFA 5EMMA 3LQ1A 3ZI7A 1HOXA 4I4TF 1II9A 3H4TA 2XAJA 3P9PA 1T9ZA 3OE5A 4O59O 4R1SA 2B8NA 3AEZA 1O54A 3FJ1A 2HF2A 5D7BA 3PQ8A 5FTWA 4M54A 1QPGA 1GK9A 4X7MA 4LZAA 2JGUA 1U0LA 4DCMA 4TM7A 2WINI 2XZPA 1A3CA 1FIUA 2QGZA 1S2MA 3O38A 2I65A 2XSZA 3VI3B 4AJ4A 1O9HA 4K6MA 1WP4A 5BN5A 1QYDA 1DBWA 2GEKA 3DDZX 3E27A 5C1DA 3Q6MA 1R3KC 1NQ5A 4FFWA 2COKA 4URYR 4WK2B 3SIPA 4D9IA 3CFYA 4MKXA 4R2HA 5FPPA 3NOQA 1YS7A 4DQDA 1NS1A 2PAAA 3SBXA 4JQZA 4WRRA 4GU5A 3RI3A 4B75A 5FHRA 1WCV1 1Y76B 2I3GA 3MWFA 4NJEA 3QVNA 4BV2A 3DFUA 1JDTA 2BN4A 3NC0C 1DK1A 3KQQA 4HFRA 2P8JA 1P4RA 3QP9A 2AIFA 3B6JA 3UMGA 4YYZA 2CGNA 5B66Z 4C82A 3RV3A 5C2JB 1NAHA 5MGBA 1EVQA 1HURA 2EZTA 1E1RA 4JENA 4ASUA 1L3IA 1EVKA 2XQFA 3W9UA 1AKUA 1LPAB 4OGQB 1QYWA 1GUFA 4ARBA 5HP8A 3EODA 1U0RA 5C1BA 5AW0A 1Z4JA 2C95A 2FVYA 1XNRO 1ZN2A 4FYJA 2ADFA 1U7WA 2HHCA 2P0YA 4X66O 1JKMA 3S0WA 5BRAA 1I3KA 2Y1XA 3PEVA 2OA0A 2WA2A 1FXSA 1Z33A 3QUCA 3ZHBA 4K0KO 1ARZA 3EA4A 2BAGA 4U7JA 3ZCCA 2HDWA 3G3EA 5F2NA 3M84A 2I78A 1DX9A 2PX6A 2Z6AA 1EB9A 1FFEA 1VQVA 4LJSA 4MLDA 4DEXA 2IOYA 1D5NA 2Q4PA 4BWVA 4ZRNA 1I9GA 3WMXA 2YMQA 2Q1TA 3MCAA 2RN9A 3AC0A 1HPLA 5AKJA 1WKBA 5G3YA 3CLHA 1CY4A 3D6AA 4Y7CA 4XSGA 5B2ZA 4BPBA 1W0CA 1ODCA 2PGXA 4WOKA 1TTQB 1VG9B 3EFOB 4NTWA 1Y6JA 5AYVA 5L3QA 3FMVA 1YS9A 2HXSA 4QTXA 1VQLF 3HB0A 4LYDA 2NPOA 4IGKA 3VSEA 3VX4A 4ER5A 5B57C 2HRYA 2KS6A 2P2CA 2YUAA 5A9SA 5FO0A 2GCNA 4I2VA 4LSWA 4BLPA 4C4PA 1T9GS 4JT9A 2I34A 3IQGX 4KB5A 4ND5A 5F51A 5DLDA 3PKIA 4HNVA 5BSKA 9ABPA 3ZWVA 1RWOA 3ROFA 3S02A 4QNNA 4YIKA 4X3MA 3EZFA 3DLAA 2Z1TA 1LWNA 1HDRA 1NXPA 1VJ0A 2D59A 5AG2A 2IUEA 4TLEA 2A1UA 3ASZA 3RRZA 3U16A 4G97A 1KU9A 3SGIA 4YJ3B 2JRIA 1T6XA 2E5WA 4Y2RA 1CWUA 1N7HA 1WL8A 1N5KA 2OHWA 2QSJA 3NIDB 3RUCA 3EBOA 2X3UA 3PFWO 1GPAA 1FBTA 2YWHA 5HPYB 1W36B 1PW5A 3QRWA 4RH3A 3L46A 3KKYA 2ZYGA 2ZT6A 1ADBA 4PYOA 2FAXA 3G9XA 1KKLA 4RIFA 3OTQA 4AUNA 2R6ZA 4W5RA 3M8KA 4EG4A 4CS4A 3ZP4A 3T7AA 1TUBA 2MSWA 2RI0A 4CRWB 5LBTA 2OCBA 3FVWA 2JA2A 2RJNA 4KLCA 4PBRA 3JU3A 3TFWA 2CN1A 4BT7A 5DV9A 2PE5A 4MQEA 4JNCA 5CGQB 3W8NA 1SEVA 3TLJA 4DT1B 3WGIA 3BD6A 1C7FA 4KL8S 4ZVRA 1D2CA 5B6PA 2QAGB 4XSVA 2Y48A 2GBCA 3APQA 3DH0A 4FIZA 2VKTA 1P1RA 2XRZA 2DTXA 2D62A 3RVYA 2DYSC 1NJIW 3UZUA 4F4IA 1K9VF 1AM4D 2FN3A 2BGTA 4O2LA 3G80A 2AIZP 1X7XA 2J87A 4C7VA 1JCHA 4F96A 4F6LA 4HH1A 3CCJF 3O9VA 5JATA 1RA4A 4HXFB 3L77A 4M88A 4QDUA 3RN4A 1M2NA 2YV4A 5DXJA 4YJ2A 4KXVA 2Q4OA 1TJ4A 3M1IA 2E85A 3DFIA 1AK2A 1URPA 3G49A 4HWOA 4CKBA 3R1IA 3A1NA 3WU2Z 4BBPA 3H3JA 1QQCA 1ATIA 1D4ZA 1M5TA 1W5SA 2QR2A 2KQXA 3L7LA 3O73A 1R5BA 3ELWA 3ND5A 3JWPA 4G67A 2GEFA 4L27A 4PZEA 1EDEA 1JIKA 5KYUB 2OTLF 2HSJA 1GFIA 2PWAA 1ZH6A 1BVYF 4X3OA 3CCBA 2ZIVB 3QVUA 1BT8A 2F43G 1CUHA 5AVKA 2E5FA 4Q03A 4C29A 2NT3A 3HVJA 1FYXA 3PNQA 1E6UA 3T1YB 3MJHA 4QOHA 2IXFA 3CXCF 3AI1A 4TSKA 4HNSA 4DHEA 1LTQA 2QN3A 1WR8A 3AERB 4AMZA 3CO0S 4GPEA 3VTKA 1NVFA 3FLBA 3LPAA 4RY2A 2NQ2C 2ZM6O 4N0DA 3SS8A 4WBSA 2H7CA 3CRZA 3U17A 1GADO 4Y98A 5A2QM 1YRQA 3ZS8C 3OX2A 1Q5OA 1Q7YW 4YP0A 2P65A 3V4PB 3C6YA 4AD8A 2W6NA 2ODEA 2F9FA 5IYDO 1MH1A 1YNOA 1AZSC 3DT9A 3I5MA 3M70A 3PGLA 5ABPA 1R0KA 2VF4X 5E9WA 4PZDA 5K05A 3N53A 4HO1X 2FMXA 4TLBA 4TTSA 3LFTA 4YJFA 2DT4A 1IV3A 4PYLA 3GDHA 3SZ3A 3WGZA 1R9GA 3DDUA 3R3SA 1FTQA 2FJUA 3GT0A 3U13A 3DGFC 3CVUA 4D98A 1BXKA 3DE2X 4QVIA 1QIEA 3QJYA 1VI5A 4E3ZA 1ZA2A 2ZUVA 1S8NA 2P5TB 2NTNA 4JI0B 3CHYA 4EYQA 3MCUA 3FVQA 1ZSPA 2SKDA 1QTRA 3KB2A 3TOZA 6ADHA 5HYVA 4PO1A 3R0XA 2Z3YA 4GWKA 1HO3A 3OOEA 4GLJA 5IM4F 5DLQC 5KSPA 1NJIH 5KTMA 4LFCO 1YJ9F 1ISPA 1QV9A 1Q8RA 2CEKA 2QZPA 3Q7SA 4YUAA 5ADHA 1RXWA 4ZDJA 3C87A 1X3LA 2VP9A 3ELBA 3RKRA 5IJWA 5JJIA 3K0BA 1S4QA 3M6UA 5FT9A 4ANFA 2CL6X 2AHOA 3BTVA 1ZBQA 4PSDA 4PZ9A 3ACBA 3ZN0A 1BOOA 4Q4AA 1SOMA 4EENA 2SICE 3CM0A 3D36A 5F12A 3D81A 1F0PA 3MAGA 2CHQA 5LQCA 1XQ9A 4ZCLA 2J5RA 2E75B 5FYQA 2HLNA 2ODPA 4OYLA 3CKLA 2G0TA 4MKFA 3A4NA 2VP0A 4F3YA 4B4WA 5KO2A 4QXPA 4WUVA 3SQMA 2A5YB 5DRYA 1R74A 1MFZA 2ZBGA 1DDGA 4RJTA 1JEDA 1NLUA 2O9JA 4MYRA 2HA7A 4GBMA 2K2WA 4RYLA 4X65B 1CZKA 3L8DA 4FNAA 2PZ8A 4PRYA 3CJRA 3LUFA 2RKOA 1Q11A 2X0JA 3PDIA 4KLAA 4L8GA 3NRBA 3W5AA 3UHPA 5J2UF 1XHEA 2EKDA 3CEMA 3GEPA 3QU7A 3C9SA 3JD2A 4WZAB 4LW8A 5G4VC 3NHLA 3I2JA 4N5LA 1BIFA 3ZS9A 4TMTA 3CXHF 2NMUA 4KAJA 4WJZA 4IXDA 1UPXA 2GXUA 4IDCA 2GCPA 2I5PO 1H7MA 1ID1A 4YCNA 4KMRA 4PCLA 2YYEA 1ZRNA 2FSFA 3EASA 1QZUA 2Z6VA 4DW1A 1N2EA 4WLFA 4DRZA 2XF8A 3DZCA 3EEOA 1NRIA 1Y48E 2N47A 4WCFB 2WA3A 2BP7A 3AKYA 1EFAA 1XQYA 1A5TA 4PZAA 4H3HB 4W9NC 1TJNA 4XD7A 5DX0A 3T1OA 3JARB 1OCCB 1AK1A 2BKLA 3CIOA 3IVRA 5GGYA 1AMUA 4F8EA 3PA8A 2B4AA 1OYOA 4AVYA 3N2KB 3P0JA 3T54A 1QONA 1U7XA 2IS1A 4XYMA 5GONB 4JTDB 4YP7A 3QUSA 2GEDA 2FSHA 1GPKA 2G40A 1M93A 2Q5QA 4AUKA 1BCCH 3TG2A 2E5LO 2ORYA 3OZEA 1T8RA 2NVUA 4NTZA 3AEUA 1V11A 3HNPA 5TMDA 1JHOA 2BBOA 4J6EA 3HCEA 4MUBA 4EKNB 1Q20A 1NDQA 1VF6C 1TLFA 2X0NA 3KJQA 3L06A 3PITA 4NEQA 4AWAA 1B6RA 2VLBA 3GG9A 4LY6A 4RFSB 4EMBA 2V4DA 4CNQA 1JRLA 3TD9A 1Z88A 3EZLA 4LYYA 4OP3A 1ZUWA 5THXA 3KB8A 4E6PA 1RYYA 2DFNA 2ZKLA 2BF4A 5KLVH 2A9VA 2CBGA 3JWEA 3W4JA 3NONA 4EBFA 1IY1A 4EWLA 2DG2A 4M87A 1WABA 1ZOPA 3TR6A 4P0QB 3RU7A 4P93A 2VEOA 5DGCA 1ZIDA 4NZYA 3V1MA 3P26A 2GFQA 1T9KA 3HFJA 1XLTC 4N1AA 3HBLA 3LO8A 4L4RA 2COUA 1HDIA 4NZMA 4ZCQA 1QE5A 2ZUFA 1S72V 3BN3A 4Q37A 2WWWA 2A0LA 4CNBA 4ZOCA 1REQB 2E49A 1J1ZA 4JJ8A 1V9SA 4KVGA 3RWMB 2BSQA 4QVKA 5K0FA 2JJQA 1N2GA 4PHTA 1XL1A 1IHYA 3OZBA 3I5UA 1VQ4F 3IUYA 3S8YA 5ALLA 2B78A 3CRW1 1GU1A 5KQRA 4HH0A 2GPSA 2R6DA 2VJCA 1I32A 1BXGA 1UFOA 3ONFA 2XODA 3CCUV 2XY4A 4QXRA 4MV7A 4FFKA 5LOVB 1ZW6A 4WZAE 4QIWF 4AJ9A 4YPVA 1BX0A 1WDKA 4UJ5A 1NYTA 1RJ9A 5B7PA 2YWFA 3PENA 3AESB 3GJXC 4GEKA 3GLKA 4BDTA 1KJZA 4YMHA 1Q44A 1QFJA 4I19A 3L4BC 3W8RA 5LVAA 2ZVPX 3K59A 4QU5A 4KX5A 3LKDA 3UUEA 3JQBC 4KW7A 4OGKA 1MRZA 1NQTA 2PZSA 2C31A 3HJAA 1IHUA 2JJ1A 3L3BA 4NBVA 4DSOA 4O2BA 1UKVY 5B6JA 3LNNA 2ASEA 3I42A 4BQNA 5B2EA 3DZIA 3FB6C 1IHOA 1RVV1 4W7IA 2ZUWA 2ZYUX 4Q9NA 4K87A 3BDVA 3ZWKA 3DHEA 4B76A 5LNK1 3UJHA 5L4LA 1N5JA 1W5BA 3G2JA 5ENZA 4D9MA 1IAVA 1VE5A 4MRMA 4NBNA 4R68A 1IE3A 2IX3A 3AGKA 5MN5A 1F38A 1DMRA 1F20A 2FN8A 2H1HA 3IS3A 4KQKA 2QRKA 1B93A 2WSSG 1RBYA 4YHBA 2REQA 3OBYA 3JYOA 1RKBA 1L5YA 1MPXA 3OJCA 1FRQA 4KI0A 4EUEA 1I3OA 1YJBA 1GTOA 2QQEA 3FPLA 3HB4X 4UB6Z 1QD9A 1TO6A 2IOHA 3CUSA 4EJ6A 2Z1EA 2V1XA 4L3OA 4L4UA 2BM0A 1KH3A 2V45A 3IOMA 3FYEB 1KYVA 2P68A 4L5YA 4U6SA 3RC3A 4Z7OB 1CQXA 5CVJA 4CF7A 1E9DA 3UYLA 4CHTA 1K5QA 5A7HA 3SSAA 3WK9A 4DMGA 5A1TA 4LTMA 3R5XA 3DHYA 4AP9A 1M6WA 3GGCA 1S5LZ 1ZG3A 2C29D 2P5YA 3BIOA 4W9NA 4LX0A 3RFXA 5C18A 5FL3A 3E8BA 1F8XA 4RIGA 2XTZA 1L7MA 2AD1A 2V55B 5C8YF 3U09A 1M6VB 4MQ5A 4YRZA 3BFRA 2O3UA 4MGIR 2C9OA 1UOOA 2LD4A 4EGQA 2WF8A 1X74A 1V55C 4NESA 4G4XA 1E4EB 3Q9LA 4XUDA 2FN4A 5E6SB 5JMPA 4O2AF 4CJXA 4Q4HB 2P4QA 5G3ZA 2VWKA 4FX5A 4XPIB 1RM5A 2C9MA 1NYLA 5I4KA 1SCJA 2EG5A 2BO1A 1LPSA 2X86A 1YR8A 4DR4B 2P3LA 3F5QA 4YWHA 3F0DA 3GLRA 3U39A 5JC1A 2BCCH 3FCUB 1XALA 2IY9A 2WWRA 4R3NA 5HRCA 2P90A 4FILA 4C2AA 2KG7B 5EMKA 2DPGA 2IXEA 3H75A 3GJ5A 3NBQA 4OPMA 3TRKA 1GXSB 2QN8A 3QKIA 4A2WA 1U3FA 3E23A 4YCBA 1JIVA 1F2TB 3GLHA 5G40A 2ZCJA 2H1RA 1WPXA 1YRLA 1FLAA 4FOTA 5TT0A 3U5ZB 4YQEA 3DMDA 2CL7X 2WHPA 4DG5A 5IKXA 3KFVA 2CSUA 3I55F 1DJOA 4QDKA 4REQA 4UCUA 1R37A 1EAMA 1Q74A 3VYTC 2A9QA 3QFHA 1SVNA 2Q4TA 1SS3A 3GVPA 1MX9A 3DDOA 3MELA 3NJRA 4P5DA 3R20A 5EE0A 1ST3A 3ZZ1A 1NHWA 1BE6A 5A5FA 3QUQA 1CSEE 1E9RA 1N6HA 4FGLA 1K68A 3RB8A 3P0ZA 1OTHA 1QK3A 1Y7PA 3JZAA 4QJBA 5J4VA 2ODAA 2P8SA 3NMUF 2YJTD 3WSTA 1M66A 3UJ9A 3NTOA 2OBXA 4EYEA 1JIIA 2HG5C 2YOGA 4XCXA 4LI0A 4ZOEA 1LVUA 1O94C 3EWIA 2B20A 2D13A 3OP1A 3B4SA 1FU4A 3CO5A 1P3DA 2MYUA 1EJBA 3B1XA 1PD3A 4NTXA 3QX7A 1E2LA 2W00A 3T4UA 2BCGY 2QZSA 3OPXA 2DJ5A 4BKOA 2A33A 3PLAE 1P7YA 2LKDA 4HNGA 1AUOA 3EGCA 4LJ5A 5KPJA 3UBTA 2C7QA 1YR2A 1N5RA 1WZIA 3A1UA 3TE7A 1AV7A 1UM8A 5JCPA 4D0SA 2GV9A 1SC3A 1X8LA 3TDKA 1ISFA 3TI9A 8GPBA 3H1FA 5CTAA 2J0VA 2G4CA 1PGPA 4H44B 1U9ZA 1T5SA 2YXDA 4O2RA 2JIZA 3MTIA 1UFIA 2X0LA 1YJWF 5GIOE 2FFHA 1E3QA 1MB0A 2PIDA 2W6JA 1DX4A 3I30X 1U8XX 3L0BA 2VHUA 5FJJA 2C1XA 4ESHA 5GTDA 4N23A 1Y4AE 3HVUA 4IX1A 5HIIA 1P7ZA 1XCJA 2HPVA 4RHEA 3WYFA 3GBSA 4RDHA 3KQNA 1CX9B 4WKNA 4EG5A 3FLAA 3PCTA 2IPMA 1F9EA 5B1AC 1TIBA 5KVCA 1YFKA 1GRVA 1WSWA 3KR1A 4UZSA 1NUUA 5DHUA 2P1ZA 1WKCA 4JSRA 3IEIA 3OLCX 4ZAYA 1LZKA 4B08A 1XRSB 2RH9B 4S2EA 1ADYA 4GS5A 4MVOA 4B3FX 2I66A 4QG3A 4TRMA 2IZ6A 2R60A 1PJ8A 3KQMA 4D8TA 3OEHA 4GKAA 1YTFB 5CGZA 4R7GA 3D6UA 4EI2A 3LUAA 3GJ7A 3U7FB 1EWQA 3KM0A 3FR8A 1P2VA 1GGJA 2IXAA 1YJNV 1XU9A 1XRMA 1G2IA 5IAEA 1W73A 3DKRA 2MMCA 1FW8A 4B7EA 1V1JA 4K8RB 4QQNA 3CCMV 3ZR4B 2OBYA 1U98A 4YV7A 2PO5A 4QWMA 5DBGA 4Q1BA 4UDOA 3NAMA 3F49S 3UWKA 1USVA 4XQEA 5HMLA 1A5SB 4H9GA 2XBLA 1JXQA 2XCQA 3QKWA 3FOZA 1XUOA 5EXXA 1YTUA 2OHFA 5CFQA 2O2YA 4MGZR 4YY3B 2WU3A 2AH5A 3EVBA 3KVRA 3GY0A 4QSMA 4B2YA 3NBXX 1JMYA 3SMVA 4WINA 3EOAI 4PXYA 1UJ2A 1L7NA 1WUTA 1JECA 1F2VA 2CFOA 1G9SA 2Q9BA 2V9ZA 1DJLA 2O8NA 3AT1A 3HNOA 4MVJD 1J7KA 5KYYB 1F4VA 1TUIA 4WNIA 3I5AA 3RKUA 1PYGA 4OF4A 1IVSA 3I4LA 3WXBA 2N75A 4LI3X 1UKCA 4B83A 1X7HA 3DMHA 5HUQA 3IA2A 3PLRA 3B53X 1NG1A 1O3YA 2W71A 3IAEA 3ZDQA 3SJBA 2V6FA 3PUWA 3O31A 4UBMA 5CPFA 5DX1A 1YIOA 3T3HA 4G2TA 4FI3F 3KTDA 4RMGA 4DA7A 3NANA 2HP8A 2YJ5A 5BORA 3G6WA 1I5RA 3I0ZA 4YJGA 1FXKC 1UMDB 2LVBA 5JPIA 4XGIA 2VK2A 4QTUB 1DRUA 5KYXB 2V5AA 2R47A 3TUZC 1JFSA 1QANA 1LNQA 4PLCA 4QD3A 1T9BA 3NM5A 7AT1A 4AI8A 3SJQC 1Y8QB 4PE5B 4ARAA 4G0QA 3WYAA 1OGYA 4GX5A 1BX3A 4NHEA 5K99A 2CF6A 3REOA 1ZRSA 1EGQA 3HMKA 2DTDA 2BEWB 3O03A 4MR8B 3TKLA 1NE2A 3QWHA 4BQEA 1FFYA 3T2MA 1ZAUA 1R12A 3KOUA 3D1JA 5E4YA 1VG0B 1R8XA 2F8SA 2Q2NA 2YS6A 3AKCA 3G88A 2CNDA 1I6MA 3IAUA 3RC2A 2HDHA 5EKUA 3TB6A 3WLHA 2KSQA 2A9FA 2GETA 2IYTA 1VL0A 1WCWA 2JLSA 2WAAA 3E5NA 1XO1A 1SBTA 1VCIA 3C3MA 3HCAA 3AJEA 3OF2A 3ZJZA 5J9FA 1VYVA 3CY6A 2BBWA 3ZGNA 2C59A 5KC9A 1T0IA 3BXGA 5KJCA 3AVOA 4KR2A 3DYVA 4CM8B 1U2RA 3K72B 4I4NA 1FQOA 4BMVA 5B3LA 5K4AA 3C4VA 3DFKA 1VBNA 2XUPA 2YN2A 5A6VA 3MDSA 1EFLA 5HXZA 4WF9V 1Z4LA 4Q20A 3I39X 4EY5A 5L3RA 1P7BA 1TZMA 1U94A 2FR0A 3NC1C 1BHSA 2KB1A 4MW3A 4DZRA 3OUTA 5TPWA 5KWSA 1J2UA 3AY0A 2FW6A 2LGWA 2PKXA 1N5MA 3BTOA 2ZDGA 3KSZO 5HE9A 2KGWA 4BRWA 3P9QA 1B00A 1DSSG 1QPBA 4PLZA 4UTRA 3WPXA 4WZBB 3RC1A 2HUPA 3CX6A 3AEUB 1SXJA 1TPZA 1ZK3A 2R5NA 4P81A 5CCDA 4H7EA 3ZQ4A 4H7FA 1RP3B 1I1HA 4JT4A 1C29B 1K66A 2K6GA 4RZXA 4F72A 2Y1KA 5CM2Z 3A0UA 4Y2UA 4IYJA 1WDLA 3DB2A 3DDWA 5JSZA 1KNKA 3N2KA 1RI1A 2HX0A 2EATA 2JJ2A 2LRHA 4LQLA 5DP1A 4A0HA 5AM4A 4ZCRA 4YHHO 5BQXA 5C4IA 3QSGA 1WLEA 4RGVA 3W9YA 4ZIRB 3ESBA 1AHIA 1JQBA 1MJNA 1LDMA 1NX9A 1NOKA 2SBTA 3L49A 1NR5A 3FYIB 4HK4A 3LGAA 4JJ4A 4PPYA 3W6UA 4EB0A 2Z57A 5CDYA 5AVSA 5EKSA 4YJHB 1V6AA 4CEIA 1PV1A 2X9NA 1THGA 1MPTA 3GUYA 4YRNA 1E66A 1ND5A 3IR7A 5EJ9A 2QA5A 4URZR 3QXXA 1TU3A 3U9LA 3MMPA 1R4ZA 2FP4A 2IBSA 1DKPA 1E2PA 2VPQA 3K5IA 4FYWA 4MIEA 3JZMA 3THXA 3LT0A 3CC7V 4I1PA 1MXHA 5C51B 2BT4A 3CG6A 1CBUA 5I5EA 1ULAA 4XUGB 4X92A 1L8LA 1Q0LA 1QU9A 4KWCA 1LI4A 2M1ZA 5CR9A 4ZU1X 2D54A 5FAXA 1YI2V 4BB6A 2O54A 2XMBA 1SD5A 1E60A 1JFVA 1JFRA 4P3YA 4ZO8A 2B37A 2QRVB 4H0NA 5HDBB 3S0HA 1IQ0A 3GT4A 4L3VA 4YP9A 3RAGA 1V1RB 4FSHA 4WJLA 4X7BA 4WEOA 4JI4B 2GS9A 4NYJQ 1LUVA 1U5BB 1ORTA 1XZLA 2PM8A 3DA8A 5GPBA 3TB4A 1GPNA 4ZZ1A 2P9CA 4OPAA 1H2LA 1Q3TA 3K9BA 3T5TA 2ZBEA 2B9EA 5IVDA 3VR2A 3GLFB 4RK1A 5B1YA 3DC6A 4U7GA 5EEGA 1XQWA 5JAPA 3U7HB 4K28A 1CY8A 4L74A 1MU0A 4D4HA 2UUOA 1KEEB 4F2GA 5EJ4A 1UP7A 1CG6A 2QLNA 3IUBA 5EINA 1VQ7V 1RTKA 1ACJA 2CY0A 3E5HA 2DFVA 2EWWA 3KDAA 1EQUA 1DF5A 3CPQA 1R1BA 3BUSA 2HLDD 1T4BA 2I7VA 3KZCA 3TTTA 4MS1A 4FLUA 1XXHB 2EHJA 1UFQA 4DLTA 1JFLA 1K5PA 3Q88A 1U3TA 4G2NA 4HBGA 4J7AA 1TPYA 4NSNA 4PM4A 3BCCH 4LH7A 2VRBA 1NVMB 1SH7A 1R88A 5IYBO 2BGNA 2OFWA 2V7PA 3Q0EA 1Q14A 1SEPA 1QLJA 1QIJA 1FRZA 1YQGA 2I8AA 3O8NA 1G2PA 1GNVA 1VP3A 4JAVC 4B73A 4CM8A 3KOXA 2YZKA 4TWBA 3RSZA 3FCAA 1CE8A 3UK6A 3LDCA 5FEMA 2I3ZA 2JASA 3DVAB 4L9AA 2F7SA 1N0IA 5JRZA 3B2NA 2O8EB 4INAA 3QU2A 3CXUA 4YRFA 1C9JA 1HL3A 4QQ8A 1ZM3A 1YIJF 2IVZA 1YCHA 3OP4A 1HDOA 1VMDA 1O4VA 5G0UA 1Y8RA 3V34A 1UODA 1GGVA 1QIGA 1YJ8A 2YNMA 4ZA2A 2YIBD 4DIKA 2VJBA 4ZIBA 2VAPA 1Z7BA 1JG3A 3NHBA 4HPXB 2V58A 4RZHA 5EC2C 3HAXD 2PL5A 3BXXA 1BDIA 4DAOA 2PWYA 1E3LA 3AWIA 2WFLA 3QSYA 1YKSA 4NYKA 5KA5A 2PL1A 1SXJC 1NM5C 4X20A 3EGXB 4JT8A 4MVJE 4FQ5A 3UK2A 4Z0PA 3RVSA 4RTOA 3AVTA 2VBFA 1H4TA 4YALA 1Z0KA 4IJKA 4M0PA 3PGVA 4QRHA 3LZDA 2FOIA 4UZEA 3HI4A 5T7BA 1RE0A 4TL9A 3WLMA 2GTHA 4C08A 1XLWA 3H8WA 4YI5A 2HEIA 4GECA 3DTYA 4NABA 2I2AA 4QDJA 3H8SA 3NOVA 1MTZA 4P86A 3JSLA 1D2RA 2PSFA 5BN4A 2JZOA 3JAMA 1GU0A 1V1MB 4IG4A 1AURA 2X0KA 4BIOA 4FFBA 1DLIA 1K7YA 1KYQA 1COMA 2OGTA 2A0KA 3GDOA 5IM5A 1KWKA 1YL6A 4Z3DA 3RF6A 2H1LA 1MBZA 3ZU6A 3K9AA 1V7QA 5GANK 3FNQA 3CUUA 1EX1A 1H2RS 4GDMA 3Q40A 3KHUA 4U7PB 1B73A 3ZCXA 3UJPA 4NY1A 2AWNA 5JYEA 1U7DA 2EEZA 2XMDA 2Q7XA 1WOMA 2BE7A 1V5IA 3NP7A 3QPAA 2OC4A 4G0OA 3DP7A 3TIXB 2RGNC 3KCQA 4JC8A 4EF5A 2KYRA 2C8JA 1P61B 1U0EA 2WJZB 4JBHA 1JG1A 2HTFA 1R2QA 1ZOLA 3JWIA 4JJIA 4KGDA 4Q3LA 4ZVOA 4DCNA 1NVUQ 3B1WA 4AKEA 2E21A 3W7SA 4LE0A 4RKRA 4ID3A 4OOFA 4ZAXA 1PL6A 2EZ9A 2FF7A 1PD1A 1RLOA 4HZUB 5D5QA 1T0PA 3COYA 4GYCB 3DM5A 4FD3A 3O3CA 4JKIA 2H4YA 4RMIA 4UBIA 1Q3EA 3KWLA 5ALNA 3RQSA 3ZY4A 4BUCA 1ID8A 5JFTA 4ZHQB 2P4KA 1L8QA 1EK2A 1OA0A 4ROSA 3LQKA 4DUPA 3D8SA 3SDLA 7YASA 5MN4A 4JJGA 1CW2B 5DHFA 1QSGA 1X9HA 4J0IA 3FIJA 4ZT5A 4A8HA 4F9GA 1JE1A 2BJVA 3CC7F 5HXUA 2OD9A 2YY5A 1QMGA 3E1SA 5A4MS 5LQAA 2FV8A 1N5IA 3H84A 5GADl 2ID4A 1H2KA 1UQUA 4N6NA 1Z74A 3AV0B 1VQLV 2WTXA 3NVKE 1E79D 1XXHE 3KEFA 4JMPA 2J31A 3LRXA 4R01A 4WFFA 3WRYA 1YRYE 3NHSA 1FPQA 4CL2A 3WLEA 3RSCA 1R0WA 1WW8A 4IJWA 4KQ1A 4JYYA 1IPAA 1A8PA 1SCNE 4BB5A 3K5OA 3R77A 4LSMA 3R0JA 3DDCA 1ONSA 3LWOC 3T4EA 2ZYWX 1JYSA 2HM7A 2PMWB 1Z2GA 4XYLA 3CVJA 4I9HA 3RBXA 2QZJA 5F3DA 2CZQA 1AI5A 3R8CA 1VE7A 4TV9F 4DV2B 3FCEA 1W94A 4DIDA 1XZEA 4JH0A 4OO3A 5K4HA 4HX9A 1B42A 1KEWA 3NALA 3SYAA 5KKCA 1J4AA 5IC5A 4B4OA 2DFPA 1UPCA 5E3HA 2B9ZA 5ED4A 4DWVA 3CCVV 4PQFA 5HKOA 5IKMA 2VR1A 4PAOA 1IPEA 2RHBA 1K8AW 1SVKA 3FA2A 4ZRDA 1HMPA 1X7ZB 3PS9A 4MKRA 2TMDA 4OXQA 3TZQA 1XMPA 1GMGA 2CC2A 2IFTA 2J09A 4DR2B 3U3JA 1P5ZB 1E5TA 1CUUA 2VG8A 4LDJA 3ND7A 1BDJA 3NTUA 4ACAA 1CJTC 4ACBA 2JIZG 1R4NB 1QOZA 4J7XA 3HVKA 1A71A 3MINB 4TS4A 4FLMA 1MG5A 5A9TA 3WB9A 6NULA 4ZOLA 2KB0A 3CUYA 1T3LA 3M8AA 2H7YA 2C96A 1YCFA 4CLXA 4CKEA 1XMJA 1R0LA 3LHFA 2H2HA 1X59A 1USUA 4S3MA 1PL7A 4LKOA 1I13A 1IDSA 5COQA 4FNMA 3RBAA 3U3ZA 3FI9A 4ZVPA 1M75A 3BRWA 4GKBA 3QH4A 1LF0A 4PF1A 4AYXA 5E2BA 5IM4A 1QPZA 2ZE8A 2OBFA 2Q50A 2J32A 3TLGA 1NT2B 1GRCA 3C70A 4MRNA 2IEBA 4ZICA 3NLLA 4ZODA 5KYWB 3BOSA 4RJ2A 2AF3C 2CFRA 2N04A 3MQFA 3KLBA 5J2UB 3D31A 3GTZA 1V7CA 2XB9A 1FDIA 5AJTA 1VH8A 2O4UX 2QQ5A 4AO6A 4BTEA 1W85B 2QUZA 1UWLA 1CUGA 2CVHA 2O7QA 3H86A 9LDTA 1EFVB 3UGJA 4D92A 2Y67A 4BYGA 1G3MA 5L3VA 1ZJ4A 3B6IA 3N4ZA 3K0AA 3X1WA 4ZT7A 4YRJA 4TLCA 3WL7A 3D0RA 4LR3A 1VB5A 3FOCA 4IS3A 4MQBA 1AO0A 1TVKA 2RBGA 1II8B 2V74B 2L42A 5P21A 2PYJA 3BPSA 2HJ9A 4GH5A 5CLIA 4Z4GA 3QF4B 4PZPA 5AP9A 2A14A 1QVFF 1QHSA 1IXMA 3AVWA 5I8PA 1O87A 3IAXA 4I9FA 3TVTA 2EF0A 4HHEA 5IJ0B 1KZ9A 2CXRA 1EINA 1Y42X 3FD9A 2VUSA 3NNNA 3L7AA 3EORA 2ZJ8A 4LV5B 1XJWA 1AUQA 4ZO9A 3BS4A 3G82C 4OMDA 3I6ZA 1T35A 4NF2A 3ZQUA 4DRYA 1R6VA 2J67A 2OCDA 3AUUA 1NR7A 1V8OA 4BN0A 4C0KA 3JYHA 4PZLA 5KS2A 1IEQA 3Q8WA 3EVZA 4E5MA 4EYKA 2ONKA 4AZSA 4BE9A 3C6XA 3RIEA 2X41A 2QTLA 3SYNA 2ZYDA 4FZ5A 2XUAA 1MX1A 2HMTA 5CU7A 3NTXA 4Y6QA 3DUFB 3QVVA 4PC7A 1WVIA 1WX1A 2YVKA 3I53A 3JYQA 4MPTA 4BTLA 1I80A 3HJNA 1ECJA 2K4MA 3NTQA 4NAHA 4XFJA 1OAAA 4B8ZA 1XCBA 3K1YA 4KX3A 2H9AA 4G5QA 3J81k 3Q98A 1A9OA 2NU9A 1Q3HA 2C4TA 3GRYA 4NICA 3RUFA 4IQ0A 4KPFC 4E0BA 4IRUB 2WLKA 2CTWA 5EZSA 3QWIA 5H83A 4BO2A 4OI0A 1WVGA 3T99A 3CCMF 4P2BA 2DYSB 3D2AA 4DV0O 2FP3A 5BRNA 3ZLBA 5ITZB 4HL6A 4AS3A 5LXTB 1AXEA 4MJ3A 5B7QA 2EYQA 5I7EA 1S2OA 1NWCA 1X8JA 4A2QA 5JNWA 2KLBA 2P2NA 5E1MA 3C85A 5DEIA 2WD9A 3WE7A 1ORWA 3OQJA 3FTEA 4IIYA 4NL4H 4NU6A 1VRVA 2BEJA 1Y3AA 3AIIA 4JASA 1WXEA 3EISA 3ONNA 1Y7LA 3RYIA 1VJ1A 5TY0A 4QYIB 4W5NA 4TMVA 1BHO1 2G1JA 1FFWA 3IQZA 2IXDA 2G25A 4L6IA 4M7PA 3QFSA 2DMRA 4YUYA 4J80A 3CRNA 2O6LA 1E5DA 3HRIA 4CL3A 2I4NA 4KC0A 3NHMA 2X23A 1LCIA 2REBA 2ZT7A 2IOFA 1CRWG 4OUKX 2AG1A 2GCGA 1F6WA 3SICE 1NBAA 3LJKA 3LX4A 3GQBB 1UDWA 1EP1B 1M8PA 3AHIA 3M81A 1Y4ZA 2I2CA 1A72A 4WLNA 1TO1E 4PI0A 1N57A 2BFBA 1SQSA 1WP9A 1AS2A 2O2IA 1D4FA 3N76A 4RVDA 3TS1A 3VQTA 3ETDA 3D3WB 3NNDA 3OQIB 3CP1A 4E21A 5FNVA 3PIRA 2YMPA 3ZHTA 3WWCA 4ABYA 4CM3A 4DABA 3N8HA 5EESA 1E0DA 2ZDHA 4HWSA 5B2FA 2B33A 3QVXA 1VP9A 5IS2A 3OG9A 1FXKA 2V7TA 1ZFNA 4J2TA 1KP9A 2BI8A 5LIRA 1NLMA 2VO1A 2Q4DA 2VP5A 4W99A 2Y69C 1N32O 2Q5CA 3LBFA 3R5KA 3RREA 3V1NA 5E2AA 4AT1A 1RMQA 3HP4A 1P75A 4DCTA 1ZHOA 1Y82A 4TS3A 4XWOA 1UINA 3K9GA 4FWBA 3UJ3X 3BGOS 3OOWA 5K8LA 3F78A 4TMYA 2CL5A 5A05A 3ZE1B 4JL8A 1PR3A 4IIXA 3L82B 1F2UB 1TW2A 4HGPA 4IIGA 2FX3A 5JCJD 2N1MA 1LDBA 3EH2A 2OECA 3U62A 4DBVO 3EIUA 3SJBC 1J8FA 2FX5A 1NNUA 3SZLA 4BKPA 1T2AA 3D6MA 3FW1A 3AIOA 2XTJA 1NX6A 2ODBA 3ICEA 3T7RA 5AVYA 3OAAA 4L2IA 4MUKA 2HP3A 2VWQA 4FWTA 2H0RA 4M9CA 4ZI7B 3GLIE 2P2DA 2W6PA 2XAFA 2MWMA 2W2OA 4NLLA 3UWSA 4PXSA 2B25A 2GHTA 3BM5A 5IT9A 3GELA 3NIWA 3RRMA 4II7A 4D6TH 3ZXXA 1FP4A 2MDTA 1KZ7B 3PHCA 3AI7A 1C4KA 1MAUA 4DMFA 1Y0BA 4CIXA 3IIEA 2DLCX 1WUKS 2HFEC 1RU3A 2FZGA 3CPHA 4C4ZA 4P1ZA 3B8MA 4DE5A 2O57A 2EFJA 5JS7A 2VGNA 3KJHA 5G4KB 4Y6PA 3R44A 3OUFA 2PUGA 4A0SA 5EKDA 3AR9A 4LGYA 4Y7DA 4LWSA 2UUAO 2DF8A 2GAJA 2ZAIA 1NURA 2YJ4A 3C5VA 3FGPA 4BZQA 2HOQA 4HAOA 3EXIB 1I8TA 4YP6A 2CDCA 5E3JA 3QFCA 4Z5XA 1ESDA 2O8DA 1EH5A 3TRHA 2Z01A 4WE3A 1XDWA 1QOQB 2BGKA 2WE7A 2XNKA 5BVGB 2CE2X 2Z8XA 3HUEA 1VQKV 4DBLE 2QRZA 3WNZA 3BMNB 4ZI7A 1ZJJA 1XWIA 2D0DA 5EIBC 4FEAA 4G56A 4H1VA 4WY5A 4UCXA 8ATCA 4N41A 1VP7A 2FQXA 2BD0A 3QELA 3BPZA 1BH6A 4Q21A 1GAJA 3BWCA 4DUGA 2B36A 3HDGA 1OH6A 5EJ2A 5CM8B 2BY4A 4J1QA 4RHXA 1F2UA 2RJ3A 4HUTA 1G8YA 1ZD5A 3OM9A 1Z17A 2C77A 2WTBA 1W4AA 3FAKA 2MQEA 3NGLA 4L16A 4LGVA 3D3KA 4DWJA 4E2YA 3LHSA 2LQTA 4P08A 4BQPA 2XAGA 4KHPO 1TZJA 1OZ0A 1GQYA 2PJUA 2RI1A 2F1RA 2QTNA 4U0JA 3VAZA 4CMGA 5AOVA 5CDGA 1U4OA 5HILA 4W7HA 4V39A 3OZWA 3ZHOA 2YEVA 4MTLA 3E3NA 3LDFA 1S2DA 2N42A 4P22A 4LQCA 5L7YA 3FB5C 2B4TO 7GPBA 5KQSA 1JPJA 2OVBA 4LZPA 4XEHA 4AMGA 4E7PA 4EL0A 1FZTA 3B40A 1K8AH 2XVXA 1NBHA 3E84A 4EM6A 3NM6B 1AZWA 3C98A 3LYHA 4EFEA 1VQ9F 3OIGA 3QNUA 4RNDB 4KSYA 1O8CA 3ISVA 2AG8A 1BRMA 4IILA 4ZT2A 1TLTA 2R7KA 4BDSA 2AMYA 4TRJA 2IS4A 1OC4A 3HCWA 2X1MA 3TD6A 4DIEA 1UWCA 2HT6A 2R8BA 1QCEA 2IUYA 4Z2WA 4DR3B 2OGWA 3B1VA 1IG3A 2Q07A 1P39A 3VZSA 2OO5C 1AP6A 2G3YA 2HCBA 3E7PA 2OP1A 4FQ7A 4L8YA 4JI1B 1I1NA 3B6MA 4I3GA 3Q3EA 4LWZA 3U1TA 2HA2A 3C3CA 5ARBA 3T5BA 4BNMA 5I9NA 3HZHA 3GWKC 2BF7A 2Q69A 1UBHS 3DZFA 1M83A 3ABMB 2G9VA 3MK31 5J2TF 4JTCB 5T41A 3TO5A 1OAOA 4FHCA 5JLJA 3CN9A 4C8IA 2BM8A 2X7XA 3GYBA 4Y0AA 5IUKC 2J0SA 2QL6A 4OJYA 3QY0A 1MZFA 1KSHA 2WA1A 4FYPA 3M6XA 5AICA 1VF6A 1HLDA 5CXUA 3RDPA 1P17A 4MV0A 2YIJA 3ITDA 1YU9A 4AILC 4HYQA 4G0VA 4DCGA 2WG2A 2RHGB 2V6BA 1GY8A 1VQ9V 2IH1C 1ZUNB 1MB4A 2BV3A 2DQ4A 2E55A 3D8NA 4XUCA 4JV5O 3W9SA 3FCCA 2H1SA 4JJFA 3WNQA 4DUYO 3AINA 3F8TA 3UKJA 1NV9A 4PAGA 5TE9A 5BR7A 5I7HA 1KNJA 3SEFA 5BY1A 1IU9A 1LJ8A 4XRRA 1R18A 1E63A 2VYVD 9MHTA 1VJTA 3GLSA 2WM2A 4GYWA 3QBDA 4Q3BA 4U8GA 3EMKA 1XJQA 1PWYE 4W5HA 1MC1A 1AGPA 1H4SA 2UAGA 4S24A 4D5GA 3TXSA 1ZI8A 1NQXA 4QJ3A 2BFWA 1RWPA 3ADOA 5CTJA 3G23A 3PNBA 3W05A 4F3CA 2UVQA 3GIDA 2RKBA 4PWTA 3O9ZA 5ALHA 3T9DA 4FUTA 3UATA 2FR8C 3NJ4A 3BMCB 3PFIA 4G1VA 2LIPA 3SLGA 1J09A 4CT5A 1Z7GA 3HLKA 4JI6B 1FDWA 3D2BA 3WC4A 1M4UA 3D7MA 3L84A 4PQRA 5IKOA 1V2HE 2V0GA 2JGDA 2ZOVA 4OP2A 4UCRA 4ONEA 5JJNB 3R7FA 5IAKA 1W581 1K9MW 2ZDIC 1WPGA 3MHPA 1QVAA 3MLBA 3OQMA 1PJLA 2VUUA 3H05A 3GFOA 4FJ0A 1S2NA 3NWPA 5TC4A 5KDOA 2JAQA 1RYFA 2XNDG 4HQRA 1V35A 3IJPA 2UUCO 4TM8A 4DNQA 2H2IA 1XJCA 4R1NA 3HJWC 5FR2A 4KRFA 2R9AA 1CB0A 2WIKA 3B8EA 4MUMA 1W6RA 2XQGA 4L4ZA 4TS1A 2Y9MB 4OQZA 5IYZB 3ZIDA 3G67A 1N34B 4O4LB 1FMTA 1PR0A 3LU1A 2R751 1QDEA 1RHRA 1XWWA 1SQPH 3BGIA 2OM6A 3MXTA 4MVUA 1H23A 2Y1EA 5FQNA 1DEOA 3OQBA 2IITA 2SKEA 3CW2A 4QOEA 1EHCA 1ZSYA 5JAUA 3PICA 1YUMA 1DIBA 1T3TA 1ZGHA 2R48A 3C7DB 2B6NA 3G2QA 3Q11A 4GICA 4M9XA 2PUSA 2LBWA 3ROKA 4IJQA 2VNJA 3FNGA 1OXBB 4MDYA 3KR2A 4KE6A 1N8SA 2O8DB 1KO1A 2R6R1 1GGKA 1TVMA 2B5WA 2JIDA 3RA5A 2YC4C 4N3CA 3G79A 3KJGA 4AX4A 3G7NA 3GZNB 3HMQA 3B5EA 2ROQA 2PA0A 4CQMD 1W85A 2ADMA 3FZEA 4OXNA 2G9IA 4JB8A 2IUFA 4RDIA 5JJ5A 1HDEA 2IBMA 4RX1A 2HRCA 3PWTA 3OAAG 2QTTA 2ZPUA 3R7WA 1WPBA 1K4DC 2K5UA 3K31A 4LFBB 3QUWA 4LUCA 3ODPA 4HZGA 3D4NA 4PRLA 3FM9A 4TUYF 4DYHA 2G0NA 3EVAA 1M6HA 3H0CA 3DTUB 4FUQA 1QO9A 1KOLA 4J76A 1P2SA 3AYXB 1VQOV 4QNRA 1K89A 3GGPA 5LA6A 4HDRA 5AW5A 5IZCC 3DUFA 3VXKA 2JVKA 4MW6A 3OOHA 4TTJA 4KGXA 5EE9A 4EG8A 3DSRA 4NOLA 4IV5A 5EJAA 5CITA 4R2KA 1YO6A 2EWMA 1GFZA 5K51A 3RC9A 2AXTZ 3O74A 1KK2A 1M2WA 2Q9LA 4FHGA 5KJFA 4GXNA 1FFBA 1XTBA 4CM6A 3T41A 3STLC 1ZZEA 1I5YA 4Q82A 1YK0A 1EQ2A 1N33B 3BWDD 2LCFA 3IVXA 4N3AA 4YUZA 2P3SA 2FUKA 1XPRA 3TKYA 5A4IS 1U7UA 3CYPB 1I94B 2VK1A 5FI5A 2IZ0A 4BE7B 5F2VO 5F5LA 3COVA 3HJBA 4LXIA 1PFWA 5FI3A 4JX8A 3DEZA 2PUFA 2DLNA 2YXEA 3CZ9A 1Y4SA 4JLKA 4IIFA 2ZYAA 3ASNC 3F3YA 3VKGA 3WJ7A 2O2CA 2V7UA 4HB0A 1EXVA 2VJQA 3LC1O 4U7WA 4MCIA 2B8TA 1OA1A 3QX9A 4GUAA 3VH3A 2RGUA 1QVFU 3KYCB 4DNOA 3ESDA 2HWKA 3AEQB 5EK0A 4W4TA 3G6KA 2BOBC 1T8TA 3NHUA 4OHFA 2X6QA 3ZDYB 3KCXA 4XGNA 3TEMA 1B23P 4POAA 5KYWA 2C0CA 3OZUA 5CJJA 2YYAA 3VGPA 2DWDC 3R6WA 1IXBA 3ON5A 4JOBA 4D02A 5ANRB 2WTAA 5KYGA 2NU8A 4PEVA 4IIUA 4OXXA 1RM0A 1Z38A 2IEDA 3IUSA 4BKMA 5JG7A 4AZVA 1A5ZA 1J2YA 3THRA 4TLAA 1OX4A 3COJA 3CC2F 4OD0A 2QZ4A 3RJ5A 3BG5A 1C3XA 1TVKB 5BR4A 5F64A 3DG9A 3OJ0A 3V8VA 1K4YA 2F8LA 4TLLB 1OCCC 1JQDA 1NUTA 2NLOA 3PQFA 1RRMA 2ETVA 3EUWA 3H9GA 3ZIAA 2GN1A 5J5CA 4M49A 4B5CA 1H6BA 1U04A 4K9OA 1P31A 4YIPA 1C3EA 1J22A 3JX9A 2KSDA 3F74A 4BO3A 2PJRA 3P9NA 3KV3O 3AFIA 1MAWA 4J3FA 3GLHE 4GC9A 4RANA 4U6QA 1QZXA 2IZ7A 2AIRA 3COSA 2PYLA 4BO6A 4RTPA 3CXRA 3R7AA 2RK6A 3SBDA 1OCOC 3CCJV 1SBCA 5EYPA 5HKKD 2X8JB 1Y5LA 3VYTB 1JNYA 1JQEA 1M10A 3LBAA 4IR7A 5M2QA 3ZH2A 5EI5A 5FUMA 1S77D 2ZWIA 2JS7A 3NI2A 3PUVA 3SQLA 4W8GA 1WPRA 1WXWA 4IG9A 4RU1A 3VHLB 2E18A 1HDJA 2X58A 1ZHHA 5A06A 1YMVA 3S8EA 3KXDA 3UPDA 5TPZA 1L9XA 4MZDA 3E35A 2I4OA 3LUCA 3AF6A 2OYCA 1FSPA 2C8LA 4X8LA 1Y9DA 4TOIA 1L8XA 1Q7RA 1Q6HA 1GVHA 3AEXA 2AKAB 4X54A 4X91A 1G8JA 1QH9A 1Z39A 2EZUA 2B92A 3O6VA 3OEYA 1SB8A 2EW8A 1EUDB 5L3EA 4B40A 1IOVA 3MBOA 3WL3A 1IIBA 4E08A 4MEJA 2AJDA 1DKNA 2QD5A 3WTCA 1R0RE 1I24A 3I6BA 5I9IA 1NDUA 2O8EA 2Z1FA 3Q41A 2ZWAA 3DLIA 3M2TA 1UMCB 5GV7A 1SZXA 1JEQA 1U81A 5T3YA 1WXGA 4OI1A 1GD1O 2DJVA 3ZOKA 1TYEB 2WM3A 5T67A 2BLLA 2ZI5A 1FDOA 1NF9A 2YKGA 3DL4A 3RIHA 3B09A 5ISMA 3ZKWA 1XSEA 1FYEA 2HRZA 4EFBA 4G5GA 1L9KA 2BZGA 3KT8A 4F2PA 4PLFA 4IL6Z 4LTDA 4UE3S 3AHCA 3O4JA 4LKRA 4BGVA 1JR2A 5JPCA 3G0IA 4PA6A 1G7CA 2W2KA 5DE3A 5CT9A 3VAAA 4J90A 5LJLA 3W6PA 3EGDB 2GXSA 3G0OA 4F84A 1QH0A 5G4UC 2CB9A 2XHZA 1RM4A 2WYUA 3AL3A 3AK4A 3C8MA 2QM3A 5A5VA 5JNUA 3IGFA 2FG7C 3QO7A 2PGAA 3VIUA 3WBFA 3M4SA 1LKZA 3QG5A 3FSGA 4FCTA 4A2PA 1YBVA 1B14A 5FYDA 4Y0NA 1H0SA 1YJAA 1N9KA 2A7WA 4QNMA 4Y2GA 3D2CA 1X25A 2CJWB 1EVZA 1KQGA 1Y9ZA 4AQYO 2A58A 2PXCA 2CW4A 3A6JA 3D8TA 3IIIA 3JQAD 4IV0A 4JUBA 2IHNA 1QQ7A 5I8WA 2QAIA 4W4KA 3NG1A 4RXTA 4AJPA 3GIWA 4BCBA 4DJTA 2BEVB 3O90A 4MULA 1MP0A 4QIHA 3TZLA 1TRKA 4HATA 1PT7A 4LDZA 2CVPA 2PBLA 4RHYA 3W90A 3ZNNA 2ZZMA 5LQDA 3IQIX 1F17A 1V47A 3C9RA 4OAPA 3M82A 2BUCA 5BN3A 5IVKA 1SUEA 2IU0A 2C78A 1XV2A 2VDQB 3DOIA 3AFOA 1C2TA 3K73O 3TNDA 3WKCA 1V48A 5E2IA 1AB5A 3CPWF 1NMEA 2H4WA 2AI2A 1YZGA 3L0DA 3CB4A 1EVJA 2IU4A 4HPJB 5CVDA 2XWQA 4CKCA 2DUUA 4Y0VA 1SXPA 4FFMA 3H19A 4C7OA 3AZPA 5BQ5A 1BCRB 3FZNA 1ZXLA 2J4CA 2W8BA 2Q6IA 2INGX 2HW8A 3RQIA 1IAQA 4JI1O 2XUJA 1W40A 2IIQA 1JT9A 1M1ZA 3E9RA 4K9NA 4COKA 1C30A 3DAYA 1D2DA 2F59A 3U81A 1MIOA 4HUQA 1C9NA 3UK0A 3CR3C 1NW3A 3A3YA 4MVCA 2VDJA 3AEKA 5DZSA 3EVTA 4DOMA 3OM1A 4PS0A 4E2FA 1CYEA 3PD7A 1ZQ1A 2IYFA 1ZUNA 3ZWXA 4GPBA 2GYWA 4R50A 4DIUA 2QD1A 1XEXA 1QIHA 4NXNB 4ZT6A 1YCIA 2WWYA 2WW8A 1ZVQA 5IDJA 2FPSA 1YJXA 1TKBA 1TA0A 2QKCA 1CT9A 1LD3A 5CHEA 3C8LA 2ZBDA 4MP8A 1HX7A 1XZQA 2Q62A 3EY4A 1L7BA 1H2MA 2OFXA 5MFZA 2G1PA 3RIGA 2MT9A 3ADDA 3KQOA 5A0FA 3JARA 2G63A 3DBLB 3DO5A 1VQMF 4HYEA 4Z9BA 4H13B 4DR4O 1LTKA 4UUQA 4R0VA 3EXHC 5EJMA 4ARUA 4TMWA 4FPXA 2RHMA 3A4VA 5BSRA 4MTGA 4JP5A 1AD2A 4Y18A 2Q5HA 1ML4A 2GRAA 2P35A 4KZKA 3GFRA 3L04A 4OYYA 2XMQA 1ISGA 2WD7B 4MUHA 4D82A 3GRRA 3ZE2B 3VPGA 4XEUA 3UHJA 5TF0A 3HJCA 1F8YA 1ULTA 3RFFA 5ES4B 2ZQMA 2NNLD 3WIUA 4CFZA 1ZAKA 4A5SA 3H9EO 3TAXA 5JRJA 4BL5A 5KHLB 2NNUA 4Q6GA 1LK0A 1U6KA 4X41A 3DV0B 1KJ9A 1T4CB 1U1EA 1XD2B 2VBIA 4Z54A 4CKCB 3ZW8A 4C0WA 2PPLA 2NV2B 1RM1B 3OEED 1YOVA 3JVVA 3ZE8A 4QM7A 3L07A 3DMTA 2Q8QA 2GAOA 3BA1A 4QYIA 2XT9A 4PFJA 3RYIB 1P4GA 3OKPA 2C3PA 2BTEA 5D5PA 3THWA 1YI8A 1U1DA 1VKZA 3G2OA 4RO0A 5DW3A 4EO7A 1KAQA 5IMBA 3MRVA 5BUZA 3F0TA 1MAVA 2C2OA 3OCCA 4ENSA 3L1JA 1SXQA 1F3LA 3ILHA 2BR5A 2YXBA 1JHPA 4I36A 5JZMA 1IK6A 4IMRA 2Q2QA 1COWG 3F7TA 1CY0A 4W8OA 1YBMA 4WN3A 2WIJA 3L6OO 1WPQA 1QU7A 1P9LA 2WU8A 3I1YA 1AUPA 2ZJ1A 3LHIA 1NJFA 2EGGA 1B8NA 1FPOA 4RM2A 1Q0ZA 2QY6A 4J7UA 5BYAA 3H5VA 2BFEB 3JATA 1Z8FA 5ICCA 3IKTA 5DIZA 4KDCA 4GLOA 3V8QA 2P6RA 4BAUA 4EJ2A 3D8CA 3ABMC 1Q15A 1TTPB 1OCRB 1YA6A 4LOKA 1XTZA 3NRJA 4YRCA 5F73A 5GVSA 4V0QA 2ACKA 3NBYC 4MB6A 5JDCA 4C81A 2ZGVA 4G4GA 2J9XB 3ES9A 4LXUA 5EL0A 3K6SB 1V4NA 1HFKA 3P2MA 4IEFB 3E22B 2HA6A 4ZOLB 4AROA 1AY0A 4I9NA 4KKVA 1NN0A 3AUSA 1DAKA 4I5IA 1K8ZB 4MR9A 1JU3A 2CDAA 1GN2A 5LNK6 1KI9A 1C0KA 5GZ6A 2ZR3A 2Q3HA 3IPXA 5CT8A 1NOIA 4QGPA 5I7AA 4X0EA 1PNQA 3RTGA 4BNXA 3HM9A 2N0SA 4GZ6A 4YQFA 4PG7A 2JH3A 4KI7A 3TZCA 1J0CA 1MA3A 4LN1A 4RSMA 3REQB 2Q6OA 2TECE 4Q7LA 5HIJA 4B48A 4BV9A 4UTVA 4TKVB 5KDLA 2FN9A 2MYNA 2CXXA 1DAPA 1ICEA 3CIFA 2Q3MA 5DEOA 5TQVA 1H3EA 1Q7TA 1PZGA 2HRRA 3KHKA 1NFRA 1U31A 2X8BA 5KVVA 2BGGA 2BGLA 3RS5A 3G8DA 3P9YA 4CTMA 1N78A 1A8IA 4ZI7F 1Z18A 3ICXA 4CTNA 2F1IA 1R0CA 5E1BA 1QGZA 2AA3A 2B9VA 5BV8A 4BN5A 5BMVB 2N3ZA 4P9OA 3BCHA 4UVEA 1LBQA 2Z2KA 3K32A 4L02A 4IINA 3TG8A 3L8FA 4LF7B 1NSYA 5DHPA 1PLJA 2O0LA 3BCRA 2FFJA 3E86A 1YOBA 3H5IA 3NWJA 1LQ2A 3OPYI 1V45E 1U3PA 1JAZA 4I1RA 2P1DA 3SJZA 3V48A 1HC7A 1LNSA 2GO1A 3PF9A 3PV0A 4E22A 4R8SA 5A4DA 1FUYB 3OT7A 3AKDA 3QEMA 4MUGA 5DBFA 1X2EA 5EXDA 3M1AA 1QG0A 1IBRA 3NHYA 5H5NA 2QW1A 2YR0A 3CD6F 5IK2A 2YIAA 1JJ2U 2JIZD 3M89A 4JODA 2P6UA 4PAQA 3ABLB 3EWSA 3GWZA 3SEQA 4K1XA 4X3CA 3WLQA 2A7QA 3ZE6A 3PFGA 1EUZA 2QT9A 1T9GR 3CPEA 1T13A 1WMFA 4FHZA 3QG1A 4XARA 5AJVB 4NE7A 5CT6A 3ASNB 1Y7IA 3IOBA 3K0EA 4PSVA 5JQWA 1H9CA 1Z29A 2VQEB 1T8WA 1ABBA 3IEXA 2AHRA 3H97A 4R51A 2VZEA 2C5LA 2M6KA 4DDVA 2FQQA 1U7PA 5LR6A 4BWGA 3D3NA 2ENUA 1U2TA 5CA1F 4F9EA 1J8DA 1Q7GA 1IBCA 4IF6A 2GK4A 3LWBA 2C1EA 1QHYA 1E3EA 3C1OA 3LO5A 5ENDA 4YXWD 3L4KA 1KYOF 3B3JA 3EBPA 4WD3A 4WZBA 5LPNA 2FMTA 1L7EA 3CX8A 1I01A 3L4SO 4MYCA 3V1LA 1GA6A 3H8VA 2H29A 2Z4SA 4Q3DA 5C32A 1E0KA 4GYYA 4PYIA 3IKVA 3JQFA 1JH8A 4DYDA 2D2XA 3P30A 1U2SA 1TMOA 2DT8A 2FQWA 4LNUA 3H2BA 3R0IA 4C78A 2IDKA 3WGMA 2VZLA 4Y9UA 1S76D 4K6KA 4DR7O 4A7PA 1X7YB 2JZCA 3BHMA 2OOSA 3U3XA 1P77A 2DQKA 2X0RA 4HKTA 1QE0A 5BUSA 1KBOA 2O06A 2UZ0A 3E4CA 1P4HA 3EIEA 3HEAA 3HDTA 5AJHA 5JVDF 3HKEB 2IKQA 1NP3A 3AO0B 3O8BA 4RTLA 4LOAA 1FFXB 1AQLA 4AS1A 3A6HA 1JXOA 1HTTA 3EG9A 4XPZA 1R5OA 3TECE 4TS9A 2OC9A 2RGAA 4K9DA 3STYA 3TAUA 4RK5A 3R6GA 1OOEA 4PYKA 5ULLA 1OE0A 2XHEA 5LQNA 4EYSA 4F3KA 2VIIA 1XAHA 1IHXA 2ZJ7A 3D0KA 3FDIA 4UHCA 3P4EA 1X86B 3BSFA 3H8JA 1MB2A 3I9NA 3JQAB 3MLAA 3O26A 2H2WA 3MRXA 2I2BA 3U1VA 1N5DA 2I3AA 1Q1QA 2QTGA 3A1FA 2MOKA 2R7NA 2CUGA 2XUIA 3F7MA 4P4SA 1H9BA 4EB3A 3KT6A 4EHBA 1C0IA 1NZDA 3CX3A 4YV1A 3JCZA 1G98A 4PO8A 4YJKA 5JALA 2XYGA 3OHMA 1EK0A 2A0UA 3FTNA 2HS4A 3ODGA 1YNSA 4J4HA 3HP7A 1FXHA 1PZNA 4GLLA 4PG4A 2ADPA 1OI4A 2XMGA 2ZT8A 2G07A 2VDPB 3C3PA 1M6EX 3BJEA 4JHXA 1N5OX 5KUMA 5CXSA 2DTEA 3CC4F 1J00A 3EXEA 2FPOA 3TLEA 5CBHA 3GU3A 4Q4HA 4BNUA 1V39A 1YRWA 1FFXA 1Z4QA 3DEHA 4TWJA 5DHQA 3CF4G 4L85A 3AB8A 1YE3A 2O2DA 3O4HA 4GSLA 1O0BA 2H9IA 3ABRB 1E4YA 4RCVA 2JDID 3HA7A 4KH1A 1T4GA 2QYOA 4TQUS 1DEAA 3KWFA 1HE5A 4OLHA 4ZC1A 3RARA 2J9FA 4ZCIA 1QQAA 1RCFA 3MTAA 3EBLA 3H5NA 1RJDA 3TH5A 5KYYA 3I62A 5DYTA 4BMPB 3EG5A 4FLXA 2JH8A 3EY9A 3S2SA 2IV3A 2EKBA 2DQSA 3IMGA 6REQA 3LKZA 3E89A 3S2FA 2FG6C 1DJQA 2C5SA 4RJKA 4CLOB 3B6KA 4BNTA 3PDWA 3DLTA 3WLKX 2O8CB 4RC9A 4U7TB 3KXPA 1THZA 4JI4O 1T1GA 3LDUA 3LOPA 2XXBA 3BMQA 3E9DA 4QXOA 3NAGA 4WVFA 5LLTA 4IW3B 3UXYA 2HJGA 3IHKA 3WS7A 1CF9A 4TWIA 1UP6A 3AGQA 4TLDA 1IDOA 3OTGA 2K1EA 1A95A 1NHGA 4OK3A 4Q1EA 4C0LA 3I23A 4OHPA 4J3JA 4D42A 1RZ3A 2BMAA 3CLUD 4EECA 4BLSA 1WV0A 4I08A 4NARA 5GGXA 2GASA 3FOBA 4G4WA 5EC1C 1DWOA 2BGMA 3OZSA 3PP8A 3GHYA 1G16A 3QHAA 3R6TA 4GWLA 4ID9A 1ZH4A 1NVPB 5THKA 3F8WA 2ZF8A 3O85A 3ZCTA 5KHOC 2EIHA 4NI5A 5TX7A 3M4YA 2HJFC 4K8ZA 1B8VA 2XITA 1ANKA 4M3NA 1VPLA 2RAFA 4BNHA 4C88A 4CUJA 4YRAA 2JAUA 3DVQX 1CDEA 3EFHA 1K3FA 2XPCA 3PGJA 1G5PA 2ZIOA 1FJXA 4B7CA 1JQ3A 3BRSA 4HEA6 2J6CA 3BH0A 3UWMA 3V8EA 4MWZA 3ZU2A 2OSVA 1WUJS 3H18A 1JP7A 2IEAA 4NULA 3PT5A 2WDPA 4IDHA 3A2KA 1F2TA 5CBFA 1UAYA 1YS2X 3PYMA 1L5ZA 4IS2A 4PGMA 4QE3A 4WZZA 5D3ZA 4WK0B 3O4VA 2PRKA 4G1MB 4K46A 2NV6A 3WQQA 1M72A 4PDMA 3VX3A 1I6WA 5HFLA 2XF2A 1N2OA 2QTBA 2YFYA 5I5GA 1U7TA 2O14A 4HMPA 4LJAA 4PJ0Z 4JJZA 4E1BA 2JLZA 3PF8A 4QQRA 2NVUB 4CV1A 5BR8B 1QJCA 3LUHA 4Q1VA 5DGXA 4C6HA 1FFHA 1VBKA 1GP2A 4H7DA 4DIBA 1G8GA 4QAQA 1Z62A 2ZG6A 2AJCA 4MQ6A 4RAQA 3O1LA 1KZGB 4WKGA 1XUQA 2VYND 1X7PA 2H9YA 3UAXA 3MJTA 4PTYA 2Y8EA 1GH6A 1QWSA 1CNMA 2ZRIA 3RRBA 5K0GA 3EA0A 4IIVA 4CH3A 1TC2A 3HJTA 3SCZA 4P83A 2HDNB 1NM5A 4HGNA 2GZHA 3N07A 1VL2A 3U26A 1GSHA 1OCEA 1N8RH 1RRGA 2MSEB 4DPKA 1UBTS 4BB0A 4HLUC 4EJ0A 1C3OB 1XAJA 1XTPA 2BTQB 1EUCA 1QFZA 2DERA 5K5EA 2X5XA 1EI9A 1H8HD 1GCAA 3SR0A 1YIAA 1D1PA 3FR7A 3QITA 4HC4A 4QELA 5IDYA 4DR6B 2P27A 3ZY6A 3BWXA 1B06A 1JWBB 2HPAA 4I0WB 1NVTA 4EGSA 3VU1A 5C8YB 4Y8VA 2FEOA 1JEOA 1KMNA 5FOQA 3S4YA 1XI1A 1NRWA 1CK4A 2OBLA 3Q4HB 1XWFA 2I2WA 1KKDA 5FFNA 1G9XA 4TTVA 3M3PA 2NZVG 3LDGA 4KACA 4M9RA 3X2EA 2JG3A 1N2JA 1I7NA 3O4RA