4TV9B

Tubulin-pm060184 complex
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
428
structure length
423
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 170
structure length 423
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4tv9B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4tv9B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4tv9B01
3JAWA 4DRXB 2BTQB 5LA6A 5LYJB 5J2UB 5JCOC 1SA0B 4X1IB 4HNAB 3UT5A 5M7EA 5JQGB 3WGMA 4WBNB 4I4TA 5CA1A 3RYFA 3JALA 3HKEA 4O2AB 5BMVA 5FNVB 1TUBB 5J2TB 3HKDA 4O4HA 4LNUA 4X1YB 4YJ3B 5LP6B 3RYFB 2Q1YA 3V3TA 4I4TB 3HKBA 3RYIB 5CA1B 1W59A 3RYHA 1JFFB 4TV8A 5IJ9A 5FNVA 3N2KB 5LXTA 2RHHA 3R4VA 2BTQA 5LYJA 5C8YA 5LP6C 4I55A 4ZI7B 3C8LA 1TVKB 5LXTB 4U3JB 5CB4A 2R751 5EZYB 4WBNA 1JFFA 4TV8B 5EIBD 3RYHB 4B45A 4O4JA 1FFXA 1W5FA 5EZYA 5CA0A 1Z5WA 5KMGA 4EB6B 5JH7A 4ZHQA 1TUBA 4XCQA 4EI7A 5IJ9B 3RYCA 2VAPA 3ZIDA 4IHJB 3HKCB 3RYIA 3CB2A 5LOVB 5KX5B 1Z5VA 4YJ2A 4I50A 1SA0A 3N2GB 4X1IA 5BMVB 5GONA 4I50B 1OFUA 1RQ7A 4F6RA 3JAWB 4DRXA 3RB8A 3E22B 5MN5A 5IJ0B 3HKEB 4O2AA 5LOVA 5ITZB 4O4LB 4O2BB 3JAKA 4ZOLB 4IIJA 3UT5B 4X20A 5ITZA 3JASA 1TVKA 3WGLA 4ZHQB 4F6RB 4EB6A 5JH7B 1RQ2A 2VAWA 1W5BA 4EI9A 3VPAA 3M8KA 5JVDA 2VXYA 4DXDA 5EIBC 3VOAA 3JARB 5MN4A 5IJ0A 4ZI7A 5C8YB 4EI8A 3HKDB 4O4HB 2GVIA 5MN6A 4E6EA 4TUYB 4B46A 5EYPB 3M89A 4O4IA 4X1KA 3ZBQA 3HKBB 5CA0B 3HKCA 5JCOA 5IYZB 4YJ3A 5LP6A 4X1YA 4LNUB 2RHJA 4HNAA 3JATB 2VAMA 4I55B 5EYPA 5KMGB 4U39A 5GONB 3JATA 3N2KA 3JALB 3VO9A 4X20B 3VOBA 4O4JB 4YJ2B 3WGJA 5IYZA 3JAKB 4ZOLA 1FSZA 4O2BA 4O4LA 3JARA 1W5AA 4U3JA 4X1KB 4IHJA 5CB4B 4O4IB 5J2UA 5LA6B 1W5EA 2RHLA 3WGNA 2XKBA 4FFBB 2Q1XA 4M8IA 4TV9A 3RYCB 3VO8A 4TUYA 2R6R1 2XKAA 3N2GA 1W581 4TV9B 4FFBA 4KWEA 2BTOA 3WGKA 5KX5A 3JASB 1RLUA 1FFXB 5JVDB 3ZBPA 5JQGA 4IIJB 5J2TA 2RHOA 3E22A
chains in the Genus database with same CATH superfamily
2WPDG 3C8HA 2COKA 2RCNA 2Y27A 4CI9A 2IITA 4RTKA 1XAHA 4KHPB 1ZEMA 2FW7A 4QWMA 3I6IA 3DYIA 2FI1A 1BWPA 1V9CA 2YUTA 4REQA 4UDXX 4Y2JA 5CT5A 5KNCA 4R7GA 5FUMA 3OESA 1RWXA 3HKEA 2I6QA 4ZO4A 2JJQA 3RWMB 3PU6A 1ZJ5A 4FHDA 1XZQA 3T5PA 5DU2A 3LW8A 3VBBA 3TLXA 2EU8A 4C89A 3KQLA 2B8JA 2Z04A 3THYA 3COYA 1E1KA 2HVJC 2J85A 1SELA 2J3QA 4ALJA 4BIMA 1IHUA 2JGMA 4YI3A 1OCCC 5EZ5A 2J0SA 2JGDA 1HZZC 2W6PA 821PA 4MX8A 4XDLA 1FJHA 4GBGA 2OSVA 4Z9YA 4D4KA 2QVCA 4H6PA 2ZFUA 5CB0A 4N7BA 3C7DB 3VSBA 2B4KA 3FBWA 3INYA 1VLHA 2Z0AA 3ZWPA 1IBLB 4JD5A 2R5WA 4XB2A 5TT1A 8ABPA 2ES4A 5HK8A 1ZH8A 4Z1MA 1CYEA 1CNMA 2LZ0A 3CCMV 5JSUA 4PVDA 4XARA 1V2HE 3Q15C 1X14A 2IXDA 2IPMA 1ISMA 1DG9A 3FUXA 3H97A 4FFSA 4HXGA 4OBXA 4PC7A 4Y9TA 4D4IA 4LK2A 2WUEA 5FWXB 1I3KA 2I4LA 3LQ4A 4Q6BA 1Y33E 1B0UA 2O1EA 3WNQA 3QO7A 3RRJA 4A5OA 2VHQA 4UNRA 3DVAA 3O91A 3NTVA 5AD1A 1EKXA 1KTVA 2R62A 2YMLA 4BR6A 3DHVA 3V1NA 2YICA 3MWEA 4RZ3A 4Y1RB 1T0HB 4PA4A 4E5UA 2BW0A 2BGTA 1N8RW 4HNHA 2O57A 1YTFB 1Z25A 4FFMA 3JAWB 4I14A 4Q1BA 3RI3A 1I2DA 4QEKA 5I51A 1XDGA 3QMPA 3WFIA 5FPSA 5K6AC 4ICGA 2B25A 5CW1A 1N9ZA 3RNLA 4X20A 3L9DA 3BMQA 4ZCRA 3R7AA 1C3LA 1N2OA 3MXTA 2O8EA 1QPBA 5E8RA 5B37A 2EGUA 2GDZA 3FOAA 4WUTA 4F2HA 1MOFA 1ODIA 1YU9A 2PH5A 2X6TA 3DB1A 1QH9A 3M8KA 3BRCA 3M6VA 4V3BA 1A2KC 3QFTA 5DDIP 2I5PO 5IDVA 2X8BA 4JLUA 4EI8A 1YFJA 4V0SA 5ALGA 5EL0A 1WB8A 3VYTC 2HYDA 1C0IA 1R50A 1IH8A 4CEHA 1RQRA 1ZMTA 4GKBA 1W36B 4AYXA 3UJ3X 4B3MO 5F33A 2YCBA 2M6LA 3VH4A 4YMVA 2XPCA 5KJEA 2I99A 1OBFO 1DI0A 2B7LA 3B36A 1GR0A 2PUJA 4Q1FA 3ZWQA 4LJ5A 4F4JA 1PYGA 5HVNA 1NW5A 2HWUA 3QPVA 5BW6B 1J5EO 3CYQA 5IT9A 2HBZA 2WU0A 3NWOA 4AU1A 4GLBA 4IZ6A 3PT5A 4AQYB 3NMUF 4UTNA 1NJSA 1U11A 2ATEA 3CCEV 3CVOA 4C4WC 2C58A 3Q1KA 1O89A 1RPZA 1HDIA 2I7TA 1VG0B 4XR9A 2MW2B 2AKYA 3EUEA 1AG9A 3IDFA 4G1VA 5KYYA 4IHJA 1O0CA 3IS3A 4KIGA 1Q8RA 2OZVA 1SVKA 1JWAB 2GDJA 1DXYA 4J6EA 3U39A 4JI1B 1QSGA 1YL7A 2Q2QA 4JI6O 4BL5A 3QXSA 5JNRA 1XQ6A 1X7WA 3CWBH 2O7QA 1WCWA 1RLUA 3H84A 3NHFA 5K3OA 1GAQA 1KERA 2RHWA 4HPJB 3GLIA 2O8BB 1K6XA 2WB2A 5EC8A 4DV1O 1VG1A 2WE7A 1WZUA 3B3JA 3O94A 3U31A 3VR6D 1XK6A 3PC6A 5F9HA 3U19A 1TO1E 3LO5A 1XR3A 2ETNA 1IWBB 1PEYA 1RCUA 3V1LA 2N9UA 2RG1A 1JDTA 2IPAB 3BXGA 1SCUB 4KDFA 2H7CA 1QU2A 1GN3A 1WA8A 4IUCS 4YVFA 3OR6C 2ZYVX 3LX4A 5LZ8A 2QVYX 4BP1A 3PWZA 5L4LA 4P92A 2M1ZA 1T8TA 5L95A 2O8CA 2B7BA 3T8YA 3TL2A 5JO0A 2FZWA 1WUTA 1JQ5A 2OVBA 5EIHA 4J10A 1IM8A 3FZQA 3VTKA 1PP9H 3HADA 4M7PA 1M73E 2CNKA 1BRTA 3FFBA 5KREA 1G4HA 2QE7D 1DRUA 4PA6A 5LOVF 4TVBA 1QU7A 1WEHA 3E3NA 2FDCA 3I1YA 3I2IA 4NCHA 1VDMA 1UXHA 1E64A 5JMWA 2PKCA 4BKOA 2GEKA 3RV4A 4CJXA 3NVDA 4GM0A 4PGAA 3KSDO 2Q69A 5FQOA 3CVVA 1QVFF 1KKLA 4OGGA 2R48A 4X54A 2PRJA 4YA6A 1R1DA 3CPEA 3TLKA 5B64A 1F8UA 4DR7B 2WA4A 1R1BA 4X45A 2HB6A 4WFBV 3HU3A 4RKRA 4AUNA 4Z6KA 5BXQC 4C4XA 1C9NA 5HJ5A 2HDWA 3MTBA 2ZVZA 1W4AA 4QYSA 3IUJA 3JSLA 1H5UA 2VP4A 1O6BA 4J7UA 3AFIA 2I3ZA 3LWDA 1H1TA 3IAEA 4R8LA 4XM1A 1XPOA 2VTVA 5KNDH 4M7WA 1U0FA 2YC4C 4ASUD 1YJWF 4S04A 3IALA 1CY1A 1WW3A 2C31A 4XXHA 4CU2A 1XMQB 2PRIA 1YHZA 3EHDA 3H5VA 4LMAA 5EKTA 2OBNA 2C99A 4TMWA 1H5QA 1MA1A 1S0VA 2HCJB 2VEOA 1TYAE 3F46A 4DR1B 4NRDA 4S0ZA 4DQ0A 5CBGA 1V96A 3HWRA 4OKSA 4P54A 4D25A 3G2PA 4Z3DA 2PT7A 2OENG 3DZIA 1GTG1 2WTAA 5BNZA 1B41A 1GSAA 5T5QA 3LPLA 3ACDA 3IFXA 2WWTA 2WTBA 2ZSBA 3DEKA 3QI2A 2XT0A 3TLJA 3WWEA 3MMNA 2YFKA 2C61A 3RHSA 4GPAA 5BR7A 3K4HA 3W7SA 3GUUA 4MKHA 3F71A 4OQFA 4ZXFA 3IQDB 3FTNA 3MHSC 2WINI 3C5EA 1ZS9A 1J9ZA 2OXFA 4JJ8A 2FMUA 1W2WB 3PN1A 2FW1A 4KC0A 5FWNA 1SHTX 2MWMA 3RVQA 1XZMA 10MHA 4TYYA 4GKJO 2AN4A 5JZMA 1UIMA 2QD2A 3OGIB 5A2QA 3Q6MA 3M6AA 1EBOA 4J0HA 3CCLV 4ANFA 2CJFA 2YSUB 1JILA 4Y98A 2PZSA 4N48A 1J2JA 5CLGA 4YT5A 2DYSB 1T6XA 1DBIA 4DCTA 4GZLA 1XV5A 4JN6B 3CJTA 3BSSA 4KNVA 4OF4A 4ZI3A 2IYPA 4ZN6A 2WQZA 2CHTA 1USGA 2WUWE 3Q9LA 4X3CA 3GJSA 3WWYA 4DBZA 3MUFA 4DM3A 5KHJA 1A4UA 4RZHA 2I1WA 4D9IA 4N9QA 3LWNA 3MLBA 2H2IA 3ZIDA 3UW1A 1W4RA 4ALMA 4L87A 1QCYA 5U4QA 1F8GA 5EKDA 2IYLD 4NXMO 3K9BA 3VC3A 6Q21A 1QWSA 4OP1A 1ZHOA 3HDHA 5CLJA 1SZDA 2AA3A 2GEJA 3TLGA 2CFIA 5A4IS 4J0FA 3KUCA 3ZMZA 1GKKA 1QDEA 3KJIA 3H87A 621PA 4LZOA 2J9RA 1UT5A 4B3BA 1F38A 2JEOA 1H0SA 3KAJA 5SY4A 4BX3A 4KPFC 3RADC 4G1FA 2Q29A 4H7KA 2OO5A 3M3DA 4ISCA 1WZNA 4AYWA 4EGSA 1XVAA 1H2XA 2ZREA 2XXAA 3JCZA 3ANLA 1M1YB 4FHFA 4U8HA 3N7UA 4IDPA 4CCWA 1I4WA 5B1IA 1WV1A 4E08A 4KPUA 1NW9B 4LHEA 1Q3HA 1EWYA 1GYRA 5JZVA 2VVTA 1G21B 2J87A 3OJEA 2RAUA 4N12A 3EISA 3OA2A 5DSXA 3UK2A 3WL7A 2FHPA 3ZVKA 2PZ8A 1XZEA 2HSJA 2I22A 4Z0NA 3CC2F 4TM8A 3WWZA 3BSYA 2Y1WA 3IT2A 2RHHA 2AH5A 2ZYDA 4BFXA 3CX5F 3HY4A 1JEYA 1Z7BA 4JTAB 1N6LA 3ZNQA 2ZW9A 4A5UB 5JWPA 4C7OA 1MNGA 2I78A 2RK6A 2Z98A 3GMDA 4PVCA 1YF3A 3AY6A 5AM2A 2Z2KA 5U9CA 4L5JA 4OGKA 1ZR2A 1RAIA 2WZCA 4IGIA 1SCDA 1E7WA 3B8HA 3ZHTA 2Z8YA 3N9IA 2XZLA 2QTBA 4EB0A 4FK5C 4HXEB 1BQZA 4D9EA 3PPXA 1RD4A 5ALKA 3HKCB 2X23A 2YV4A 2L2QA 5B4UA 4DCSA 1VKOA 3HBMA 2W2PA 2ZOSA 4TT3D 3FR8A 4LG1A 4TT8A 3N2EA 1NVXQ 2QTSA 1FU8A 1ZN8A 1ZUWA 2PFKA 4ND3A 1TYCA 1NKDA 2WIJA 2ZBRA 1E1YA 3LU1A 3SPCA 2NP6A 2FPMA 1QE3A 3FTCA 5KLVH 1Z0DA 3RSHA 2R3SA 3EH1A 3KZ1E 4FJ0A 3ECSA 2B78A 3OA0A 5A7GA 2HXYA 3VR1A 4HWSA 4YLYA 1ANKA 3INNA 2Y9PB 1AMOA 1NWHA 3ROEA 3JYHA 2P11A 4CL8A 3CXHF 1U3WA 1P7GA 4M1ZA 2PUHA 2Q5CA 3A1FA 4MKFA 1N2SA 2FQQA 2CH7B 2IM9A 3HA7A 1IOVA 2ZP1A 3JRNA 4QOJA 2X5NA 3W3AD 4AF7A 3L79A 4A1FA 1O54A 4GYCB 4QYTA 5C9ZA 1CNFA 1DV1A 1TPYA 2GHIA 1E32A 1U65A 2F9LA 3BGVA 4RJ2A 4ZDKA 1ODLA 4JAVA 2R87A 2LIVA 4FNAA 2V7BA 3M9WA 1MT0A 2XUFA 1CLEA 3HABA 4B8ZA 1Z5NA 3E8FA 5JCOA 2CY0A 5BR8B 2JK5C 4WACA 3SR0A 1G6KA 3TG8A 1FVFA 4KH1A 1OT5A 5LU9A 3B70A 2F8SA 4WI1A 2Y67A 4ZWNA 3W6OA 1IY9A 3P9CA 2I4TA 3VPGA 4MTCA 3UJHA 2I54A 4FZ0A 5H8WA 1JS1X 3OWHA 4QDOA 1G2PA 3CUSA 2VDRB 3DBLB 3GLTA 1NS1A 2H1LA 2ZDHA 2IEGA 4MYDA 4B3JA 3L7DA 2WZBA 4C0JA 5FIUA 1I01A 3UTCA 4L76A 5FD8A 1W5EA 4NVRA 3R74A 1G60A 2HGZA 1UXKA 3G8YA 4CKCB 5AKGA 1R9NA 4MO2A 1SBYA 4FSDA 3EPRA 1I24A 4RL4A 2PY5A 4X3OA 5FA6A 5BO5A 4ZKEA 2B99A 1DBWA 3E0XA 4EFEA 2C7BA 3S40A 3V1MA 1EK1A 5C7IO 1VM6A 4K0KO 3H8WA 2JAWA 4H17A 3KWLA 4IV0A 4N5HX 2FG6C 4NZZA 5EMLA 5K51A 1NVWQ 1ZD5A 3NM6B 3VNUA 4C6TA 1L7VC 3WJQA 1J49A 4AT1A 3EG9A 4Q4AB 3DGEC 4CLHA 2ZJ1A 4MVMA 4YV7A 4COKA 3VAAA 2OXRA 1Q7TA 3W6UA 5CCXA 4L22A 1PL7A 3PXAA 5M7EA 3ZRSA 2UYCA 1QGOA 4MYRA 4Q4HA 5KVCA 3GJTA 3NU1A 4HV4A 5PGMA 2I67A 2JANA 1NU1H 1JHXA 2NVWA 2VCHA 1YRHA 2R1TB 1RZUA 3MHHC 3MWKA 1ISGA 3DLAA 4GXRA 4YDRA 3AUTA 1EFCA 3ABMC 1JQEA 3KZXA 2PH7A 1N33B 1YQWA 4IL5A 2WOJA 1ZM2A 2GJ4A 3LX8A 4ZU1X 3CLHA 5JW6A 1X94A 5J63A 3V2UA 1I2CA 1OSNA 3NMUC 3NGMA 3QY0A 5HJ7A 4J2OA 4I4IA 4JKOA 2XB8A 1V8ZA 1YKSA 2GCOB 1RLTA 1KZ7B 5BQ5A 5I01A 2O8DB 1L6IA 5A3SA 2PZGA 3LWOC 4RK1A 4BLRA 1RYEA 4U7JA 4U2KA 3HGMA 1R6TA 5I9TA 2EFDB 1S1CA 3UHAA 3CZCA 2AYZA 4CHTA 1PSDA 3FUCA 4LJAA 4DREA 4K6KA 4MVJP 2D4AA 2R5FA 1WUKS 1YB4A 2Y71A 4GX0A 4FSXA 3A8TA 1G98A 5EK0A 1Y4UA 2NXWA 4I1IA 4NDAA 4YLEA 1RACA 3RRZA 2JFYA 1SUEA 3TZ6A 3D7LA 2OY0A 3GH3A 1GTMA 3VFDA 1MX9A 4EKEA 4F6EA 5KNBA 5LSAA 3CYOA 3RYIA 4UOEA 3ZU5A 1UMKA 2GPBA 2PZKA 4NOMA 1JZSA 2BF7A 1JU3A 1DF4A 3AI7A 1DTWB 1E6CA 1H2EA 1D5CA 2FP3A 1KY5A 2NAFA 2CC2A 4BCDA 3D3EA 1NBMD 1JGTA 2ZVYA 2QAIA 4LFAO 3PC2A 3JAMA 2P2CA 3FUVA 5MN5A 1ABEA 5G4VC 4UQLA 3NNDA 2AGVA 5DLDA 1D1TA 5AI6A 2AI3A 1BOFA 4E6PA 5KSOA 3OKFA 4CF6A 2C9DA 3SDZA 3FAZA 5AI0A 3A9WA 3TX2A 4EJ6A 4MIEA 4UCQA 2RK4A 3D8NA 4LPKA 4CIVA 1P4AA 5AWFC 2EOAA 1UJ2A 1V5GA 3HRKA 4R16A 4D43A 4EABA 2NLJC 5GAPK 4ZT5A 4JX9A 3LBHA 3PX7A 1L4GA 2F43G 1DFHA 3K70C 4QLAA 4K3VA 2XSZD 4MH0R 2A7WA 3CCQV 1NVFA 5JBNA 4M37A 5A2QN 1E0AA 3VXKA 1X8JA 1NE7A 4UVGA 5IABA 3UMFA 1X8LA 2KLHA 3GHYA 3WOHA 2GCIA 3LH5A 3W0LB 2QN6A 3HH8A 3I32A 4L4ZA 1JFRA 1W0JG 3JWIA 1Z2OX 2VHCA 2P69A 4HB4A 4JT9A 5A4DA 3IV9A 2MSNA 3DYBA 2N3ZA 5GIOE 3MTDA 5CCEA 2E76B 3VDRA 2ZUFA 4ZICA 1P80A 1VG9B 3L7CA 2JFZA 5EQTA 4ER5A 1DKUA 4JVLA 5DBFA 4FB4A 3R7FA 4GXNA 2H3OA 5LGUA 4QOEA 3EPLA 2PX5A 4H1UA 2AN9A 3Q8WA 3AYZB 4MYTA 1J0AA 4OK5A 4PC3A 2JLQA 2WF7A 5HF5A 4DCPA 4IDHA 1U7HA 3G0OA 3JZIA 3SC6A 1K7XB 2G7MC 4WESA 5BOVA 3TIGA 3ZLBA 1FFAA 2EJ7A 1AF4A 2B21A 2DH5A 2X3YA 2X0RA 3QHPA 2X4DA 4G1EB 4L08A 2ZT5A 3P0EA 3QELB 3WG9A 5KTPA 3VR6A 3CLKA 3VR4D 2FVYA 4FFLA 1ZZEA 3ZDZB 1TTPB 4NR0A 4B71A 1M0WA 1IUOA 2PKRA 1AHHA 3PRYA 4HZ3A 3BKXA 1SKUA 3KSZO 5AVQA 3QMWA 1ABFA 4AZ3A 4B5LA 1TADA 1FNCA 2AUTA 2GO7A 3I6QA 4DW0A 4QYIB 5IKEA 2QWXA 3D4OA 3HEAA 5HY4A 3UMVA 4KI0A 1C81A 2QW8A 2R9AA 3K0SA 1NU6A 2CXNA 3R9WA 1ZI9A 4M55A 5CLHA 4PC6A 1MJFA 2FXVA 5DKFA 1RJGA 3ED5A 2WC1A 4YCDA 5KQRA 4NJEA 5JG7A 5GINE 2NU7B 1CUHA 2BFEB 3WGTA 1K9VF 4J1TC 1G6UA 1T0AA 5FWXA 5JXIA 2ZSUA 2QMZA 1VZ3A 1PYOA 2VPWA 4LJ9A 2WQ6A 3AOEC 5DW0A 3BB1A 4RPHA 1JXQA 4TS4A 4CRWB 3WK4A 2FGJA 2O3RA 3IIEA 2EHJA 1AKMA 1BDMA 4R83A 3WGYA 2E74B 2TMGA 2X77A 5LXTA 3J80N 5DLEA 1JHRA 1W88A 4HAIA 4JMPA 3S2IA 4DIKA 4GOOD 2YRWA 5TIIA 4YO8A 3IT3A 3D6HA 4RPLA 3UOGA 4HWPA 1J00A 5BMOA 1L9KA 1JDSA 5BYKA 3SQDA 1ZD9A 3FNQA 4WN9A 4FOOA 1QNFA 4H33A 3N0TA 4O4JA 1W55A 4FXOA 3OQ1A 4N8EA 4XQGA 5HRCA 1U94A 2H00A 1L4KA 1X3LA 2JAPA 2ZJ8A 3EDOA 3ELYA 4H13B 3GDOA 1KK2A 3PGMA 3R23A 3E81A 4LSZA 4MQ5A 5BQXA 2VWPA 3V1UA 5I7VA 5T6BA 4CUZA 4CGZA 5IWAB 1P1RA 1Q0UA 2W4IA 4ZU3A 5TEWA 4WHMA 4Z2WA 1Y4MA 2J3JA 1L4EA 4D7SA 1OX4B 1G64A 4WLFA 1A5AB 2FOXA 1X80B 4YWJA 4JJKA 3ZK7A 3BMOB 2VDLB 3I12A 1KPGA 4RIGA 4IH1A 4R71A 1U3FA 1DO8A 1V48A 2GNAA 3KM0A 5DM1A 4CN9A 4MIYA 2I4OA 4HAMA 5BQPA 4TV8F 1M8JA 3E5NA 3T1VA 4MQEB 4PPGA 3P94A 2V6IA 1IYZA 2BRUC 2W6JA 2EP8A 1VL8A 2ECFA 5ALOA 2QLJA 6ADHA 4POOA 2VTBA 4ZHQB 3C1AA 1VTKA 2V8BA 3AYXB 3PUWA 3O8RA 4PGFA 2G72A 2H65A 3WIDA 1RAFA 5E1AC 1TK3A 3OQVA 2DC1A 3RBZA 3B78A 4IM7A 4NE7A 5HNKA 4UEJA 1V55C 5D86A 3KCYA 3PE3A 4Q4JB 5EFOA 1IAVA 2Z1MA 3S0JA 2X0EA 1E6MA 3F8SA 2QRQA 4ZAYA 1YHNA 2X3FA 3COWA 3AEQA 2PZMA 5ABPA 4IJ5A 4PDLA 2YJZA 1XKTA 4C0LA 6PFKA 1YASA 2IJGX 3MWDA 3FF4A 4RDIA 3UV7A 1Q3KA 5IWAO 5I7UA 4Z7JA 4FN4A 1XRSB 5JLJA 4P5PA 3TKAA 3T1HO 4D81A 1K27A 3KVNA 1HEUA 2A0LA 1YQGA 2BAGA 3VC1A 3GLGB 4CKWA 1RXEA 3VH3A 1UFQA 5HCNA 1APBA 1FLAA 3PWKA 4RVDA 2AC7A 2AFRA 2NLOA 4IHQA 3WIEA 3TYXA 1IUNA 1XYYA 3ZXSA 4BO9A 3U44A 4GUDA 3VQWA 3ZN0A 1II0A 1M2OB 2V7QA 3LRTA 3M4JA 4PONA 4RKEA 3UMYA 1ZI6A 4PINA 5HX7A 4X1KB 2OO7A 4I5EA 4N8SA 1PJRA 4J4HA 2CLMB 3OHSX 4UPVA 3RUAA 4F4HA 3T3NA 3RYCB 1VHDA 2WSSA 3BQNB 4G25A 3WRWA 4PDRA 3GHHA 2PDAA 1A04A 3GMIA 3NIBA 1IQUA 3OD5A 1KAEA 2V9YA 4MB0A 1I5YA 3E9CA 2QEQA 3ZP7A 1V2GA 2A7QA 3GAAA 2G09A 4I81A 4JVNA 4BZQA 3JQ8B 4ARZA 2D7CA 1E3MA 2B4QA 3PEFA 4HSGA 1FPQA 2FZVA 2HJHA 4KQIA 1CFJA 2ZSJA 1EUZA 5JU6A 3OO1A 3BGOS 4HS9A 4LC1A 2MSLA 3LNTA 5DI9A 3H05A 4HCJA 4PYJA 5D3MB 2YDYA 4MUFA 4TN5A 3CMMA 4JLVA 5F52A 3DAGA 3IULA 4NYJR 3R09A 3HCPA 1CT9A 3NUGA 4LFCO 3ML0A 3NTUA 1RMTA 5FV4A 3HLKA 3TKYA 1QHSA 3QM1A 1XA0A 3EIXA 4HFJA 4MI6A 3MC1A 2PUDA 2XMRA 1PGQA 2QTGA 4HUQA 4PLCA 3PNQA 4CEJB 1JR9A 4GKKO 1K8AH 1R8XA 4XWGA 4EG7A 4K2AA 5KDDA 1BO6A 3Q11A 3RSZA 2VF2A 3TR5A 1AZTA 2H4JA 3B5EA 1ZG3A 2OTJF 1QHHA 2ZNIA 1R0YA 1Q0SA 1ZJZA 1G0NA 3OMIB 1GVNB 1GYPA 2RGNA 2X4GA 4R1TA 5EMHA 1I7QB 1RM1B 5AVUA 2NQ8A 5AM3A 3U37A 2H9IA 4PE5B 4A5SA 1RJWA 1IHYA 3PI6A 5B30A 1E61A 4IDOA 2V7UA 2DECA 2A9VA 1M75A 2R4QA 2IZ6A 3OHMA 1YZHA 4L78A 4JA2A 4Q6WA 5ALPA 4OX9O 4O5AA 5KHOC 1KJQA 1SVWA 1R4AA 3PV0A 1ZC3A 4HGPA 4GPTA 3T5AA 3QF4A 4WZ6A 1REQB 4GD3Q 4X6LA 4LYDA 1FDWA 2HXSA 1N8RH 2LBTA 2GN4A 3GQBA 3HB3B 3VSEA 3VX4A 4EW3A 4EMSA 4MS4A 1CERA 1XEQA 1MIHA 4WIAA 5JHGB 2ENUA 4YDSA 1KVUA 3RD5A 3CCEF 1K3FA 3O6VA 2OCPA 3ZRWA 3FYHA 3MJRA 3OFSA 1LPMA 3LNMB 3WGOA 3NEYA 1NUTA 1FP7A 3HJRA 2ZXWB 2O1XA 1OYYA 1W0CA 2VSFA 3SP1A 1MOPA 1FJGO 1GPWB 4GZ5A 4FFDA 2ODNA 3RVPA 3U1BA 3HVIA 3KR1A 3WL8A 1D7AA 1QC5B 1DIBA 3U9TA 5JAZA 4QDUA 4Z9AA 3PJRA 2DWCA 1E1QG 4BIUA 5LUAA 3WK6A 4RD2A 3SIWA 4I9WA 4EHIA 3UMBA 1GTL1 1W49A 2F1IA 1MGOA 3E5RA 2AG5A 1VZ2A 1CXZB 4F4UA 1FAFA 1EBUA 1D3AA 1YK0A 4FZJA 3KB1A 1KQGA 1A2BA 1KYWA 5HDQA 4DJ5X 2Y4UA 2NXNA 2KMLA 3MS7A 1U8XX 1DC4A 2O2HA 3FHOA 1XTIA 4W8OA 1OXSC 1Y9EA 4KSYA 5T6MA 3KT0A 1BN6A 4OHWA 1P73A 1SVSA 1HOTA 3D43A 2YWXA 1KO7A 4F3TA 1Q1NA 2XWQA 3JQRA 4DILA 4EKDA 3ADBA 2DPXA 1OBCA 1Z73A 4B08A 3N8DA 1H4SA 1K4KA 8AT1A 1WPBA 3JATB 3U3KA 1TYZA 1OVGA 2EG9A 1ATZA 2YY6A 4WH0A 1P4GA 2HBRA 2LP4Y 3H19A 5AJHA 1GPNA 1PUJA 1PFUA 3AWIA 3LJKA 1YJAA 3NRBA 1SG6A 3RS3A 4HDOB 4H0LB 4R2JA 3V34A 4CLXA 3BGSA 1QQBA 3PXGA 4E0BA 4YXWG 2BHTA 2JD2A 2YHAA 4PF1A 3DE4X 2XI4A 4OU4A 3FDZB 5EHXA 3OT1A 3ECAA 4KR2A 1IK4A 4GO1A 2QTAA 3BJMA 5C7OO 5KJCA 4RABA 2H1HA 4Q3DA 3B6NA 2I3BA 3M9XA 3P9SA 3CF4G 3FI0A 1Z2NX 1V1JA 3NAGA 1WXXA 1GTOA 2JGEA 3A2FA 3OE7A 1KARA 4JCOA 4JTCB 2NZUG 2OEPA 4LHZA 4N18A 4TWIA 2NVUB 3W3AH 4EBBA 1P2TA 2PX3A 4PLYA 3NC0C 4HGZA 3U16A 1VYTA 4UCOA 4NCAA 3BA8A 1U8ZA 2OCYC 3F6EX 4BFCA 1HXHA 1YA8A 3A3NA 1I4OA 2X9QA 4UTVA 2JDIA 1XF1A 2QAGA 3E89A 1PGNA 5CA1A 3CD6V 1E1RG 2VS0A 2VRBA 2XYVA 4FYYA 4OJYA 4KQ2A 2Z2XA 1KH3A 4XH9B 5GZ1A 3I2HA 4D45A 5JT1A 1SRYA 4TSFG 4DR5O 1QKIA 2VT2A 4IO1A 1T5OA 3FNHA 2CE2X 1NRIA 4PRLA 3UAYA 1ISSA 1GZUA 1QLHA 4RGBA 3WQSB 4AY3A 3AGQA 5KO2A 1NH2B 2WF8A 5CH8A 1DJOA 1TVCA 1FRVA 2Z2YA 3EPPA 3GGSA 4GQIA 2CVFA 1BX0A 4HWKA 4K35A 1GDDA 3AQIA 1NASA 3GDGA 2D74A 3ISVA 3NHKA 4L9WA 4BE4A 1I1HA 2FNAA 4ENTA 2HRCA 3PEWA 5GOTA 3VHXB 2GWRA 2VUIB 2WWRA 5LP6C 2WFAA 2A9PA 1UIRA 1CS4C 3B7PA 3L7BA 4RFVA 5EJ2A 3ZCXA 3C8ZA 3IPRA 3PGXA 4TS1A 4IQ0A 1HL3A 3E15A 4HNGA 5ECGC 4BNYA 3IKMB 3WL5A 4JBHA 2VBIA 1XN1A 4BB0A 1K8YB 5DN6A 1O6CA 1S9DA 3DNPA 4O2LA 4BO6A 5AQ1A 5JCXA 2AR0A 3I3SR 4R1QA 1VGQA 4Y6QA 1Y1RA 2CL7X 1ISRA 4N21A 4Y2RA 1D6JA 3K9SA 1CW2B 3ILHA 1KHTA 1Q83A 4W6QA 3AVYA 1E1CA 4U6NA 3GFOA 4DYLA 4YK7A 1CIVA 3FMFA 4W9NA 4DNPA 4U7HA 5C2JB 3MCVA 3R9XB 1IFXA 1V8FA 3L6BA 4Z8XA 4YCCA 2HDHA 3AUYA 2OAGA 3BCRA 1HYGA 3ZK8A 2R70A 2D3WA 3W5CA 1W4ZA 3DEZA 5C1BA 1M7BA 2B5UA 5KX5F 2IHNA 3HU5A 4KPGA 2HP8A 2W2KA 1BMFD 2ZG6A 1GGHA 3OIWA 3VR5A 3VTFA 3A1DA 5C8VA 5K5EA 4ZOLB 2QAJA 2WKRA 2B6NA 3IKEA 5ED4A 3NKFA 3R0VA 3C3YA 5AMXA 4QTUB 3OPYB 4ZGGA 1SUBA 3INRA 5C5CA 4V24A 1IXBA 1RQ2A 4G5YA 1YKFA 2HNBA 4P9NA 2AFVA 4KAFA 4TZKA 1J25A 4MVWA 4RYLA 3LHDA 1UXIA 1PUXA 3OEED 4TL7A 3FI9A 5HCIA 3ZN2A 1GL3A 2VRCA 1M6YA 3DFUA 3DFFA 4PO9A 4DY6A 2AW9A 1MA0A 4H4EA 4J7AA 1IQ0A 1KAOA 5CM9C 2PUGA 3L43A 2QJTA 2NO9A 2N04A 3GBPA 4Z9BA 4PYOA 1ZH4A 2IT1A 3CINA 3WWDA 4E5PA 2FK8A 1O95A 2ZYSA 1Q6IA 4ZMBA 3QHDA 2JCSA 3MEQA 4ABMA 2MR5A 2H59A 1M2WA 1OYOA 1YQEA 2BEKA 2O07A 4HNAA 3BD6A 4AMYA 5BSFA 1ADFA 4ZARA 2HUPA 2ZUUA 4K5QA 1I0LA 3S02A 1XTSA 3PD1A 3GA7A 1RQNA 2ZDGA 3MWFA 1C1XA 2IKQA 1QYVA 3PIIA 1LV7A 1Z34A 1NBHA 2H8GA 3G0IA 1PL0A 3REOA 3ZDEA 3OQPA 1GFSA 2PNFA 2X5KO 4AK9A 4AMBA 3BE5A 2ZI4A 3PDIA 2AZMA 4MHTA 3Q9SA 3I92A 4C82A 1RFGE 1ZGCA 2YJ6A 2RQ6A 1JJBA 4O8ZA 5EUMA 4B74A 1TMKA 3QVGA 3VR4A 2WD9A 3H1BA 2ZU6A 1UANA 4C4TA 3LHKA 3TTTA 2CDAA 3V8EA 2YRFA 4MWEA 1QOQB 2ZSEA 3BGDA 3E4CA 1PV0A 1OV9A 3E22A 2V7EA 2ZBQA 2GYUA 3I9KA 3ZHOA 1V5WA 3JX9A 4H3SA 4EHNA 2QIPA 1HDRA 2H51A 2V9CA 2Z4RA 3KOZA 3ND8A 2R6FA 1GN6A 2AJLI 3F6MA 4JUFA 1Q0TA 2W2OA 3DKIA 5BZBA 3PKIA 4DPMA 1EUDA 2JI6A 3ZY6A 4BAUA 2AQIA 3V4DA 3WG7B 2JS5A 1KK3A 3C4QA 2OLJA 2EJVA 3NO4A 4FBGA 4C5BA 3EPKA 4Q6GA 1FFDA 5COBA 5K4HA 1MPXA 1ZNQO 2IUFA 4HAXA 4DA8A 2HNAA 3H1PA 2X8AA 1RWOA 4E1VA 4EPXA 1BW9B 4O4HA 4LWOA 4HVLA 2IJIA 1Z0SA 2BD0A 4PG4A 1KP3A 3VTIC 3I1FA 1T3LA 1LRKA 5B58T 2HKIA 1L5HA 1NZFA 3ZWNA 2D5BA 5H6RA 1IN4A 1QG0A 4Q4CA 1KL7A 1XRNA 4JXZA 221PA 1DQSA 3O82A 4G41A 4LKRA 3ZMSA 4YJGA 4ZV9A 4CLEA 4ENSA 1B73A 5AVYA 1ZJYA 4PLVA 2PKYX 2ZE8A 1P1KA 3L92A 4OHOA 1LK7A 2QE6A 4PBSA 1U8TA 3T4XA 4UZSA 3PDJA 1W5FA 4F96A 2GJSA 5CA0A 1AR1B 1JQBA 1E2LA 2J6HA 2EULA 2AJTA 1IUPA 1PBNA 2FOLA 2J32A 3D54D 4DQKA 2HRYA 2CB0A 2JCVA 4HQRA 1J9EA 5CJJA 2CVHA 5FCDA 1YDXA 2XQIA 2Y1LA 4K9SA 5A4MS 4HVTA 1I1OA 5E79Z 1N2XA 2R1VB 3ANMA 4QQNA 4UHDA 1XVTA 4GT1A 1G55A 4PG5A 1O4WA 1VLJA 2ONCA 3I05A 1V1MB 5SV2A 1E5LA 1XI2A 1XVVA 1USUA 3C87A 3DM5A 4RY0A 4BU1A 2XCIA 2LJ2A 2XUPA 3RC2A 4DR3B 1YJ9F 1QC5A 3RTAA 4P35A 4UVDA 5BWBA 1NI8A 4KKVA 4S05A 3K0EA 4KGZA 3A1EA 2MMCA 1KOJA 2JLWA 4KLAA 3TK1A 2ZXEA 1KFCB 3MA0A 4HYOA 2ZXFA 2G0TA 1V4NA 4I8DA 3KZKA 2OT5A 5I7EA 1P9WA 4EB6A 2OIGA 1N5DA 1OREA 2JHGA 1PE0A 4XIGS 1S7GA 1XTVA 2DHRA 4L3WA 2F93B 4A6DA 4W4LA 1W5BA 4I1PA 4EG5A 3K9NA 1X87A 3L49A 3FB8C 3VVCA 3EVDA 2BFNA 5AK3A 5DK6A 1D2NA 1UOEA 3NDJA 1TU3A 3GT0A 4BJ1A 5C8YB 1E96A 1JLRA 2EBUA 3L93A 4L3OA 3U4IA 3RBXA 2C2WA 3SQWA 1GPMA 4RJLA 1HEYA 2QMHA 2Y76A 4B48A 2DBVO 2PTHA 3DBOB 4GL4A 4UNIA 2X9NA 4WK0B 4DIEA 3FCEA 4YRIA 4JS0A 1YR8A 1HDEA 3KZNA 3TMKA 2XIQA 5TMEA 1N57A 2GUWA 3G82C 5IFLA 1M5TA 3AESA 3E2IA 3PSAA 3ES9A 3C39A 3TOCA 1R6AA 4MPTA 5CDSA 5GVSA 2SKEA 2B35A 1O97C 5E9WA 2NR5A 3ZRVA 1K73W 1M34B 3ZKWA 3SC2B 2FMTA 3I0MA 3TINA 4DQVA 3UMRA 5ADWA 5FULA 2XB9A 1REQA 2WSSD 4J0GA 2XTJA 4N0DA 3L07A 1N7JA 3DYVA 4OK3A 4US0R 4ZJUA 3UBTA 4RQUA 3PL5A 4CPDA 4NMHA 1J1IA 4RDHA 1NURA 3ESQA 3FWYA 4IFTA 4FI3F 4BVKA 3UFXB 1B74A 1HTBA 4CT0A 4Y0NA 4FS8A 5KOHB 4CQLA 3A6DA 2I3AA 5CFOA 1OH7A 1RABA 2C2YA 2QMYA 4AN1A 1UPUA 5GONF 3EY4A 1R0BA 3PR2B 4BLQA 4DSAA 4D9MA 4N1AA 4N5LA 5D00A 4A26A 4DY4A 3JQAA 4C06A 3NBUA 4PR0A 4WX2B 3MUOA 1LVHA 3VR2A 1OQAA 4RZ2A 4GC9A 4PTLA 1FLDA 1VI5A 2ENWA 2IYVA 4PNZA 3V7FA 1N6KA 2PYZA 3BL8A 1KMMA 1LUAA 2DYKA 2YXDA 2Q3MA 2JBAB 1IBKO 1BFDA 2DFPA 3L40A 3HEMA 1JPJA 2E89A 1Q1EA 3PPYA 2A9FA 3BGIA 2W8BA 1NONA 2IH2A 1IXMA 5CVVA 2GARA 3K0TA 5ULLA 1G7CA 1GXSB 1G42A 1ML3A 2WDZA 5CT4A 3JWHA 2ONKA 1EVYA 5H5NA 5TPWB 3ROZA 1YIAA 1YR6A 1QMGA 3RFTA 1YACA 4E31A 1MQSA 3ITDA 5FNVA 3FKQA 3L18A 3R4VA 1QIKA 2JHCA 5D84A 1L8QA 3D64A 4ZVMA 4ESEA 4BNTA 3GXBA 3DB2A 2P2YA 4IVPA 4MVJH 1TYEB 3AG2B 2O14A 4W63A 5DT9A 4TWJA 4B2IA 4REQB 1SGWA 2HLHA 3ZOPA 5EHIA 1XO1A 3GEBA 4DC1A 1Z8NA 1IOZA 3QO8A 4FVTA 4TMXA 4MKRA 5EMMA 4BJHB 3LDCA 4C4PA 4PXAA 3QEOA 2V3VA 2PYJA 4KAXA 4UVHA 3D0KA 3D36C 2CXTA 2JLBA 1H65A 3ANTA 1N33O 1U99A 3MQ2A 4R7ZA 1QYCA 1RBQA 3VGPA 3ZV6A 2D2EA 1VHWA 2ZJ7A 3HYRA 5CLQA 2CGNA 2OORA 2VTDA 4BMVA 1BVRA 1S5JA 5IF3A 1P9RA 3K9AA 2VYVD 1PR3A 3GTZA 2B30A 2XQKA 4FMPA 4HFMA 4KP4A 4I8IA 4JJEA 4ZZ1A 1Q16A 3DM9B 3K72B 2AV6A 3GLGA 1LW7A 1NV8A 3BMNB 1R5JA 1GAJA 2IDJA 1SVIA 4ITVA 4YWHA 4MV3A 4R69A 3WDSA 4E5YA 5IRCD 4ONEA 5ITZA 5DHFA 3TW8B 5HY1A 2FYUH 1ZD4A 2NXEA 2P4HX 3U3JA 2NP7A 3DQQA 1BGYH 1M2HA 2COUA 4GU5A 3R7LA 2IS2A 1A2OA 2ZM6O 1PLLA 2P79A 3FCCA 3WIVA 4QM6A 4EG8A 1PAUA 4RD6A 4ML3A 3ESRA 3RVJA 1KBHA 4QU0A 2ZRGA 2P2ZA 2SBTA 4MQ4A 2WU8A 4G1CA 1GTZA 4OSOA 4OOFA 1EM8A 1K4DC 1XG5A 1QGYA 3EIEA 2WJGA 3ZZ0A 4MKXA 4ZOEA 3ABIA 1SHJA 3P4YA 1L8DA 1GIAA 1EXWA 1G8JA 2QRLA 2F7SA 4H1VA 4R5HA 4WKNA 1V16B 2WHEA 4YCLA 3QA9A 5CD1A 3E83A 1U2GC 2C5GA 2HTEA 2W42A 2W5UA 3CG0A 2RB9A 4MVJA 1K89A 2K2QB 2RH8A 4JELA 1YK1A 4MV8A 1U0JA 3GYBA 3QITA 3A0BZ 3KQSA 1BHQ1 1FDIA 1XQ1A 4KL8S 4DIDA 1JIKA 3K73O 5JD4A 4DR5B 1TEVA 2FP4A 3SXPA 1T8SA 1KDVA 1THTA 1Z2DA 2ONZA 4P1ZA 2E3CA 4XDHA 1V1MA 4B3TO 4BHTA 3NZEA 3QRWA 1JB9A 2C8VA 5FUXA 4D5GA 2PE5A 4FYVA 4PZUA 2OYRA 3W1WA 3TIVA 3VQTA 3FAVB 4F7DA 3EFOA 3W34A 2QTWB 1IZZA 3TZKA 4A8JC 4YAJA 1XX6A 3S7TA 3ESAA 1KKUA 5KQMA 4MUMA 2Q45A 3IRVA 4MI9A 4TQ9A 5THKA 3UG6A 5DGIA 1PNOA 4Y3UA 3GGDA 3FVTA 4JYMA 2OYCA 4CV0A 3GMTA 1KFKB 2HA4A 5KS2A 3U7FB 4B6RA 4UNPA 3TIIA 3OU6A 3CUEF 5TR9A 1FX0B 3ELCA 4JQCA 1ZQ1A 1T0KB 1COWA 3L0IB 3RN4A 1TVEA 3M3HA 4FR5A 4FXPA 4P82A 3C48A 1MP0A 4MEJA 2PMFA 4OIFA 1ODCA 2J6BA 2WD7B 2PCLA 3ZOKA 5D6NA 5DNDA 5HFAA 1YJXA 2W6QA 1E5TA 1WZCA 3VDQA 3LI2A 2Y1XA 3HJGA 4XFJA 4C1BA 3PX3A 3DVQX 1HLGA 4CODB 3CTMA 5KVSA 2FZ5A 4Q7QA 1ZUNA 2PXXA 2LPMA 5AVZA 2C5BA 2PJRA 4WKCA 2AQ8A 4D6PA 4JBNA 4AJNA 1TJNA 2Z9BA 5JNVA 4Q93A 3LX6A 5K0NA 1WU8A 1BE3H 3T7IA 2ONYA 1S2NA 2VDQB 3LLSA 5BXYA 2IPXA 2FSHA 2ZOVA 5CFMA 3CVYA 2MSWA 1LXCA 1G8FA 1KS9A 2XBUA 1K33A 1U0HC 4EHAA 3C5WP 3U3ZA 5KYTA 1ZRMA 1JQDA 2VK1A 3GARA 4CEIB 4G2NA 5GAJA 5K2OA 1F2UA 1K5GA 2FPIA 3AUUA 4FFOA 3PQ8A 1VHLA 2I8CA 4FEEA 4R2HA 3SGIA 3PFIA 2FV8A 5ICEA 2NNLD 1QJ4A 5I9SA 3P7MA 1U0EA 2I3DA 3K1JA 3EXFA 1HM5A 3R3WA 1T0PA 1Q81H 3HZZA 3OCWA 1FE8A 3KC2A 4HLUA 4EUSA 2CXHA 2WU3A 1F6DA 2ITDC 3OZXA 4H1TA 2I4NA 4YMSA 3L1IA 4OCZA 5FXMA 4BFVA 1RYDA 1EWVA 4TYWA 3LK6A 5E3IA 4DEYA 1CJUC 2DY1A 2FEOA 2H3HA 1V7PC 1WY5A 1PWHA 13PKA 2YUIA 3VOUA 1CJSA 2JHFA 2Q73A 3N74A 4PW0A 3S1LA 4GW3A 3I76A 5FOVA 5CDYA 2WWYA 2DLCX 1XRGA 2UYYA 5AR1A 3KB2A 3PUHA 1J8YF 4L8YA 1K7YA 2BKLA 5IT4A 2CHUA 1CRPA 2QZSA 3QV2A 4IUDS 4AJKA 3FJOA 2QJWA 4BN0A 1SBIA 1NI4B 4TWRA 1A0OA 1WXQA 3G2QA 2O2DA 5IAJA 1YB7A 2VJOA 4WECA 4XB6B 4R54A 4ND8B 3OTGA 1Z38A 3SF8B 3GD5A 4LFCB 3GAFA 2R00A 4GC5A 1JG2A 3EZXA 1R3JC 5CK5A 3Q7RA 4B79A 5BN5A 4RA9A 3HBJA 1E2JA 5EYPB 1O95D 3VTAA 1KEKA 1C9YA 2RDCA 4LGCA 2JAXA 3J7AU 2A0FA 2GHRA 2Y0IA 1L1RA 2BLLA 2OM6A 3D59A 5LHIA 3O5AA 4M1KA 2CLSA 3P52A 4MO9A 2CYBA 2ZRMA 4YJ3A 5TC4A 2I2WA 3O8QA 5CU7A 5E0KB 1WCYA 4PAOA 4IY1A 3UCSC 2W2KB 1OV4A 2HR3A 3RGBA 5HF9A 4PNHA 2FAXA 1ZVVA 1D2DA 2FSVA 1SZCA 4NABA 3SPGA 5CLLA 1P7YA 1FOEB 1X1QA 1P1JA 4CVNA 5BN4A 1A7AA 3FKJA 2IZOA 1E3DA 2GZMA 1OZ0A 4O2BA 3LFHA 4ZO6A 2MOKA 2GN0A 5AKIA 4QRDA 4N47A 3HI6A 1G3QA 3F97A 3OAAD 4JQYA 4RM3A 3CC7V 3GRZA 1L5WA 3WP0A 4RWUA 2ADPA 5MHTA 5M2QA 3M34A 4UBJA 4XDYA 4UU7A 1G5HA 2WWVD 3S2ZA 3VDMA 4B32A 4E11A 4ENWA 3BA1A 3OQNA 1SCJA 5I9LA 2BEVA 3D6FA 3CCUV 1E3EA 3HVUA 4X93A 1F23A 1FK8A 5FWYB 2YMQA 3IQHX 4Z7OB 2Y69C 3RNOA 3JD0A 1WPGA 4B6FA 2CF6A 3CUTA 5JJEB 3MTGA 4MR9A 3TOZA 4IIDA 1Z3IX 4YNBA 5KAFZ 1EK6A 1U3GA 1SXJE 2RKOA 3UK6A 1I80A 3TM5A 3THOA 3UT5A 4DS3A 1R0CA 3BJRA 1UF9A 3IC5A 4PSDA 2DR2A 5CYPA 2LP7A 4UU0A 5KUMA 2H5EA 3RYFA 3VYSC 2ZS8A 4DV2B 4R98A 4BQFA 1JYFA 4OLAA 4QJ5A 1KAGA 1NQOA 3LUAA 2Z1TA 1LX6A 3EE6A 3D6UA 3K1YA 3NBQA 1KZGB 1JDBC 4X90A 3KVYA 3ONFA 5DGCA 4MB6A 3DE7X 2FFAA 2CVLA 4DCNA 3G02A 1HPLA 1V16A 4Z1VA 1Y66A 3GGGA 5BOSB 3LOQA 1S1MA 5LC1A 2FPGB 3C3XA 1SC6A 2YV5A 3CWCA 3NHYA 5DX8A 4F9TA 1EGMB 4LZAA 2FX2A 4Q21A 5ALFA 1LS1A 3AR6A 1ZD2P 1MZFA 2WA1A 2N42A 3BIFA 4BMSA 1IMJA 3INTA 3TSOA 3D5QA 2ZE5A 4XASA 4B45A 1SUCA 1ZJ6A 5AM1A 4MP8A 1U2EA 1ZJ4A 4IRXA 4WKBA 3RG2A 3TQIA 1AK9A 1M83A 3AI3A 4B81A 4DBVO 3HAXD 3IT0A 5JMTA 3ZLJA 3FRHA 4DDWA 1QR8A 2EATA 3X1MA 4J1NA 1H3EA 5IJ9B 3A1CA 5K3SA 4F2PA 4RTJA 2NZJA 4EKNB 3A6ZA 1JHQA 4J94A 1XMSA 4B84A 5FOWA 2X1HA 3BMNA 5B3JC 4MWSA 5BMVF 1X1BA 3CKMA 3DMGA 4IPTA 1EXVA 1CUSA 5A4FS 1EUCA 1TMOA 4YJHA 4K3UA 3LWPC 2A0YA 1CK4A 2R6JA 1A5SB 1G1AA 2LCIA 3BILA 1K3TA 2DBRA 3QBVA 4HLQB 4RWEA 3L75H 4FM2A 1MXHA 3L71H 1YKGA 1BRMA 1P0CA 2JIZD 4F38A 4Q3LA 3ROPA 5HOQA 4AM8A 1PBTA 1OC4A 1U5BB 3MGCA 1T8RA 1F17A 3I8OA 1ES9A 1BT8A 4MUEA 2A78A 1G66A 2FWBA 5A4KA 1AGNA 2ZUSA 1EUYA 3H6KA 4JEHA 1PZEA 4XR4A 3O03A 2FUEA 3I72A 3U1VA 5A03A 3CVUA 1TKCA 3BG5A 3OEHD 1PZFA 1S5HC 4JI1O 2IHJA 1F6BA 2CBZA 3HR7A 5CB8A 5GZ3A 1KMNA 3IPLA 4L5IA 1E9FA 1QLEB 1XTKA 2AXPA 1OJ7A 3G6WA 3O31A 3R0XA 4LTNA 4RFLA 3UJAA 5ITVA 4HN9A 1YI2F 1EVEA 1FNMA 2ZWMA 4L7QA 1XWIA 5ILQA 3QZUA 4H16A 2JIOA 3JVEA 1L7MA 5E4FA 2ZDIA 5ARDA 3NM4A 4DCMA 4GGPA 2MQEA 1AI7A 1AS3A 1D5WA 4TMZA 3RFCA 3J7AR 3OZEA 1MEOA 1G8YA 2PIDA 1C4WA 4P4SA 2W11A 3KXIA 3UK0A 3AY7A 1T13A 1E66A 2PGAA 5CVUA 4DUZO 3RBVA 4O4JF 4LF7O 3PTLA 4CQMA 5H81A 1A5BB 3NX4A 2OT3B 3P2YA 4LF4O 3ZVMA 2J3IA 4IMIB 2GRAA 5A06A 1SCBA 3NTLA 2YWRA 2HSEA 3L8CA 1DWPA 5BYJA 4B8WA 4QGSA 3QEKA 5FBHA 2GPSA 3H3JA 4O63O 2CNOA 4RS3A 3M89A 4BLPA 1SXQA 1NBMG 4A27A 4XLTA 2C5FA 1H69A 4XWAA 5K0CA 5AJUA 1A32A 4EFDA 2R11A 1Y1SA 5CNJA 1DKRA 5LIPA 1Q7RA 3PD0A 4LBYA 4ZYTA 3RHTA 3IXQA 1V8PA 5KNBD 3WLEA 2WJHA 3JQAD 3DR3A 4Y2QA 1O94A 2PGLA 3GW8A 4MW4A 1OW3B 2QU8A 4QJFB 1WMFA 4YHHB 3HL0A 1RLIA 3NTXA 4GRAA 3X1XA 1JECA 1Y74B 1R00A 4PSVA 3UA4A 4DCUA 3HB9A 4EQ6A 4F4IA 2ZUEA 4B3GA 4LWSB 4NTZA 5B4TA 4RJJA 5I9BA 4AKSA 1JJ2U 1YR9A 3VR5H 1D0SA 3BQ9A 3ZG6A 4ARUA 2H9YA 1LBTA 3UAZA 5KHHA 2YWFA 1P5HA 2HPAA 3N0WA 4N40A 3NW9A 4Q4AA 4BC1A 1Z28A 1TJ4A 1A27A 1WSBA 1ZK1A 2JKYA 1TA9A 4M46A 2J46A 4QU8A 4URUR 4YRRA 3U7QA 3ASOC 3KB6A 4B0OA 2IGTA 4H08A 4YQFA 3VZDA 3RK1A 2V6JA 1O6FA 1FTNA 4EJ2A 2A06H 4GXQA 1AKQA 4G8BA 3VV2A 1X52A 2X0FA 3MCQA 3OO0A 4O59O 3FETA 3DUFB 3K08A 1C0EA 3FPJA 1WPRA 3N1UA 3Q5GA 4L8GA 5CW2A 2XAHA 4EKIA 2C2AA 1TI7A 2ILTA 3P71T 3H42B 5F76A 2QRKA 4FZ3A 3NTQA 4GPIB 2AWOA 4JEIA 3OX1A 1U1DA 3E2EA 3CVWA 2AGAA 1RZVA 4NVPA 1MZVA 2DLNA 3EDQA 4JVMA 4NSNA 4UNNA 1T2DA 3VH1A 4AS1A 2X0LA 4MQUA 1MC8A 3CEPB 1XQVA 5DNVA 3VU0A 2ZB2A 2Z9DA 3I83A 5G0WA 5H02A 5F7XA 1ZWKA 1XZLA 2EBHX 2JBAA 2JGDB 3QU4A 4BPRA 1MABB 1P7ZA 1C7RA 3VPBA 1BAPA 4CR8A 1TPZA 4G1UC 1TKAA 2H4YA 4HFNA 1XKQA 3PJGA 4R8SA 4RXMA 1VCIA 3DUWA 5LLSA 1JBKA 4FIPC 3LQ2A 4X5OA 1WUIS 4A2PA 4OD0A 3FJYA 5LB4A 4JP3A 1DTSA 2MYTA 3CD6F 3BA9A 1F2UB 2FPIB 2H1WA 3P9IA 3QMMA 1J2RA 4PZZA 4ZREA 5EQDA 1P2GA 5DWVA 2D0IA 4B76A 2J07A 4YAEA 3SI7A 4JT8A 3QKUA 3BUSA 2XEDA 4JUIA 4NH0A 5KIAA 3D4NA 4EF6A 2C5AA 3SS9X 4F91B 4KXVA 5LLDA 5JRDS 1E0JA 4ZYWA 3DT9A 3OPYI 3PK0A 1EZJA 1O87A 4I2NA 2G9VA 2MMGA 5T7BA 3QBDA 1GUAA 5JVDA 5BN5B 1YCFA 2BM0A 1TE2A 4GMGA 1YAHA 4KN5A 4N65A 3V4OA 3PC7A 3SZRA 2WALA 5E9QA 2ZYWX 5JSKA 3IDOA 2MCFA 5HOEA 1ENOA 5MGNA 4KDCA 5B2FA 1Z8DA 3EDCA 4DO2A 3GT7A 1EZVH 1H2FA 2PQ0A 3M83A 3Q3EA 4GOKA 2AQHA 5EAIA 4BW0B 2QQFA 1R7RA 1FP6A 3BSWA 4P81A 3RS9A 4D8WA 3FX7A 1DBSA 1R0SA 1WVIA 1MV5A 4PIMA 1WHSA 3PNOA 1OH5A 1BE6A 2FQXA 2AJCA 3CZMA 3L6DA 1ZSPA 2VAMA 4HDSB 4K9DA 4R9RA 2R8ZA 3GRFA 3MRSA 4S1OA 4TTQA 1E9CA 5C5IA 4R1OA 1H2AS 4JUCA 5FI1B 1Z82A 2DFKB 4TTTS 3DV2A 1UWKA 5K8UA 5FTNA 3L0CA 4LVUA 2VKQA 3S1AA 1PJ2A 3RO7A 1SQBH 1B6GA 1L5VA 2F4NA 2ODWA 4LXIA 4BNGA 3FZEA 1ZUD1 2QA5A 4P4UA 2ASVA 4JYCA 1XRPA 4UU8A 4U7DA 3OD4A 3PLRA 3N7AA 1EM8B 3U7IA 4LH7A 2GH1A 2LW1A 3LYBA 2VT7A 2XMCA 4JL6A 2UZ3A 2AXNA 2PTGA 3AUAA 2FW6A 1Z45A 3E3AA 4MJLA 2JASA 3PJSK 4M99A 4Q03A 4YB8A 2FLWA 4MQBA 1P4HA 2HMTA 2QPLA 2X9LA 3RSGA 2RHCA 1XCJA 4JENA 1ARZA 4LI0A 2Q4RA 3LHSA 1BTOA 5EWLB 1TT7A 3OIYA 1N2CE 4ZYZA 1GILA 3QELA 4NPHA 3W7TA 3GEGA 2GJAA 1Z56C 1GM5A 3U3RA 4ZQGA 3KWMA 5IFKA 4AG6A 2W6JD 3W90A 2YZGA 2G77B 3CNOA 2EJUA 3E5MA 4XVHA 1N2BA 4DNXA 3DXYA 3EUFA 3GPIA 4FWBA 4XWWA 2GN8A 2H2FA 1Z29A 2DUJA 2QTVB 4E5VA 1JEDA 2H52A 3O9ZA 2O5VA 1X9HA 1YDEA 3CW8X 4F86A 1TUEB 4O1HA 4PHGA 1EX1A 4L16A 1CS0A 4KDEA 7GPBA 3H2GA 4QICA 4BNDA 3I01A 1Y81A 5LZ7A 4ZI7B 4HAVA 4V1CA 4G65A 3TW8A 1CQJA 5I7WA 1RWWA 3Q5EA 1H0RA 1XD2A 3R6DA 4LOKA 4XYLA 5G4UC 3Q3IA 2RGXA 1EFRA 1YIJV 3WQBA 3N53A 4AZVA 1NKVA 4C08A 1YQDA 1R4MA 2D2IA 1C41A 5E0OA 5JH7A 4LY6A 1JJVA 3K9CA 2R85A 3LPMA 3MCUA 4G89A 4WZBA 5EGNA 1YJ9V 3TLMA 5JC1A 1NV9A 3H5RA 4DUYO 1VRWA 3Q8HA 3GG2A 3HYSA 4IDAA 2XOXA 5K01A 3GLIE 4XJVA 3VNVA 3Q9UA 3I53A 3Q40A 1H6BA 2XUIA 4BV3A 1CKEA 4ZQFA 2BGUA 3E9NA 1CY0A 4YJ2A 3IBFA 3QK7A 6REQB 4HZUB 3N27A 3DZ8A 3WLFA 4F5WA 2Q7XA 5C18A 4NQZA 3WPWA 4F6RA 2XTZA 4MR9B 2HJWA 1ZL8B 1Y9DA 3DP9A 1ZQ9A 3E2MA 2VCYA 3BMQB 3F8TA 1RWQA 3AW8A 3OJLA 4WADA 5A6SA 2DHCA 2DRIA 2DE0X 2EARA 4LX0A 2OFFA 1N3IA 3WO0A 2NQ2C 3G6EF 4A0GA 3A2NA 5BY1A 2UXCO 1EFTA 2KLBA 3DVRX 5FA8A 4LRSB 4AKGA 4TXMA 3E9DA 5KHAA 3JU3A 1GG5A 4AC9A 1QGDA 2ZIEA 1J8QA 2EZUA 3EYAA 1ZK2A 2OC9A 4I3HA 4IIXA 2QTCA 3UYKA 4QT4A 4M9XA 5AKEA 2IYRA 1U3CA 4BGEA 3HBNA 1F5SA 2ERYA 1CJCA 4CL3A 2ZRLA 1QJCA 3CR3C 3R7SA 1Y98A 2ZBVA 3EOBI 3RLFA 3P3NA 1AI4A 1QK3A 1SRRA 2FWAA 3ZDXB 4BRZA 2O3SA 4WOPA 5EWJB 2W00A 2YHIA 3Q6IA 2X8WA 3OTQA 4LYJA 1VIBA 3NVIB 1ZGHA 3V6LA 4LUCA 4L0MA 2I55A 2B2CA 5BSMA 3IMFA 3WA7A 2ZLBA 4MCIA 4MQEA 5DNAA 1U80A 1Z15A 4F06A 1R4NB 4DB4A 3MWLA 3ZHRA 2B1QA 5AW7A 5BXZA 5HR5A 5JIBA 3O74A 1XREA 3B1VA 2FXIA 3GVPA 3TIXB 5I8PA 2CV2A 1GNLA 4IJUA 4EGCB 5BP7A 3TRKA 1NMZA 5KX5A 4TKVA 5LNK6 1VE3A 4G4SP 2Y1FA 1FMLA 1T2UA 2HRQA 1GMGA 4DV6O 2IZ0A 2VJKA 4XUGB 5J1TB 3HXQA 5BQFA 3T7RA 1BJKA 1V8DA 2ODQA 4BV9A 2HSZA 3FE2A 5DHSA 5E6SA 2C42A 4WCVA 4EEZA 2OP0A 2W0FC 1GA6A 2FETA 1BEEA 5ELMA 3B48A 4OQEA 3TRFA 4O0MA 2PJDA 4R0MA 4L2IB 4ZIRB 1JIVA 3W3ZB 4EB3A 2HTFA 2BGJA 2ZS7A 1J8VA 4MS3B 2XUMA 3SZUA 3I6YA 1IV1A 2Z30A 1L5NA 1YUBA 4FW8A 1FTQA 1Q6YA 1S8OA 5BSRA 3HY6A 3BIWA 3EXG1 4YN3A 4E2ZA 1WZIA 3VNAA 3P9YA 5HJEA 3CRCA 4FINA 4C3UA 1FLVA 3FPHA 4EVSA 1BYUA 2N75A 1F2DA 3B3GA 3FYUC 3CJRA 1VQ5F 1PW7A 4ISBA 4PRZA 5K0TA 1DCKA 5MDHA 1JHMA 4EFBA 3L4JA 3KEFA 2I80A 2PUTA 3HE3A 2RC5A 3IA2A 1DB3A 3HU1A 5E7JA 5K3DA 4DV6B 4DE5A 3SXJA 5C5EA 3HC7A 1U1EA 2FR0A 4BCBA 3GNQA 2C1XA 2QTRA 5DCUA 4ER0A 2WG1A 1PM9A 1DKQA 4QXQA 3T9DA 2F8LA 4EY3A 1Z2CA 4YJKA 4EZIA 1DAFA 4XGIA 5HFLA 2YIJA 1K6MA 2BMJA 1PK8A 2A0WA 2C4TA 2OTCA 3KPVA 5B3AA 2GNOA 1GNSA 1T0UA 1QZZA 1V45E 2I76A 2L0XA 3F5SA 4J7ZA 5GV7A 4AQDA 4BFWA 4ZK6A 4NMLA 4QREA 5FPKA 2B20A 5TY0A 1EXNA 3UIEA 1OHHA 3W7WA 2HCTA 4XUCA 1GDTA 5TJHA 3UTDA 4XDKA 4PHZA 3TAHA 3TUZC 1QFJA 4BFSA 4NQRA 1M4UA 1HRKA 2Z8YM 3STHA 3EAGA 1ODKA 3OE7D 4ZRDA 4D79A 5I48A 4KI7A 3ONDA 1N32O 2E1RA 4JT2A 3AR5A 1OH8A 3A70A 3N76A 5JEDA 5F2EA 4ZIBA 3D8TA 3EF0A 3B53X 3HVKA 4BBPA 4C03A 4CM4B 3D6NB 2YOFA 3D7NA 3LWQC 2W98A 4L75A 2JDID 1YI2V 1SUFA 4UUOA 4O4HB 2J0EA 1DELA 4FKMA 1QIEA 3LWBA 1F48A 5I7FA 3SHVA 3DXRB 3G1TA 3GZNA 5F2OA 5K0BA 3QJYA 1THGA 2F9ZC 2DJVA 1NJIW 1XE3A 2Q1TA 1RYBA 2QT1A 3JXEA 1ACMA 4PV1B 5LGNA 3FGOA 1SOMA 3IQEA 4JFAA 4R1UA 5G40A 4JXKA 4OYHA 4LNUB 1AXEA 4JJZA 4AMVA 3EHBB 4B7XA 3KEOA 1U28C 3VX3A 1OIXA 2LCAA 1GZ7A 3KSRA 4G63A 4PRKA 4JJ6A 1GQOA 1TLTA 2OO5C 4TMVA 2TS1A 3HBAA 3NIWA 5ENZA 3U6KA 2AW3A 1TAEA 1MIOA 1EP9A 3WL3A 3VKUA 2AK2A 1NRXA 4L8LA 4NCJA 3DZJA 4EP1A 1ZHHA 3KFVA 2EX3A 4HFRA 2FUG6 5AW9A 2GPYA 2CH7A 4UXNA 1L2TA 3D4IA 3NDPA 3MRXA 2JI4A 2A5LA 2I1QA 4C30A 1PLJA 2WIFA 5GTHZ 5CX1B 1OZGA 2LO1A 3IMKA 2D7DA 1VPWA 2ZCVA 2ZPUA 4GBJA 2EX4A 3BHIA 1O94D 4JZ2A 3FYSA 4M8NE 4C2BA 2JCBA 1M1NA 3EMKA 1I7FA 4YFVA 3WI7A 3MCWA 5HQ3B 1ZZGA 4V3CA 3UENA 3PYLA 5H9CA 2JA2A 3MGAA 2RBEA 3PQ6A 3K14A 3NNNA 4LRUA 3WLAA 3HV2A 1V8OA 1OR8A 4U8GA 1V4BA 2IF0A 3GCZA 2P6NA 4GYYA 4J41A 3RRYA 5IBCA 2BHLA 2O7NA 4B34A 4ZK2A 1N3LA 4K46A 4P0TA 4IUBS 2CLDX 2UVPB 5LP6B 3PI7A 4UASA 4E21A 2JVIA 3QVVA 4BRUA 3FD8A 3L9WA 5JNWA 1HDOA 1L0NH 4OI1A 4JJ4A 3EOAI 2R7KA 3UEOA 3UICA 2Z8ZA 3G7SA 2N05A 3H4VA 5E9AA 2GLTA 2NUTB 4N3AA 3AB3A 5C8YA 1J95A 3VCZA 4J8PA 1GL7A 3UM9A 1UR5A 3ZTWA 3TLGB 1QV6A 1EYZA 2A3NA 4OB6A 3UPUA 2XMDA 1B3BA 3BK7A 4MB2A 2CLCX 1FZQA 4TVOA 3T3MB 4YRSA 4R2KA 3CNNA 3KHKA 3EMVA 1JEJA 2C7VA 3EWAA 3NXSA 2NN4A 4JH0A 5DNEA 2YC2C 3WDKA 1OMOA 1QHIA 1QH8A 2QJOA 3KD2A 3NALA 2NO1A 4HTAA 1NBWB 5DV9A 3O38A 4RIEA 1X7OA 4OMUA 1SBNE 1GSHA 1ORHA 1E79D 1PR5A 1CS0B 1R0WA 1J9GA 1SOVA 2ATIA 2NV0A 2YFHA 1Y3BE 2YJ4A 1GO1A 2VRZA 1M90H 4MP6A 2X8LA 2P2SA 2WT4A 4I0XB 2VJYA 3RE1A 3SBDA 2ORWA 4JJGA 3AG6A 1C2TA 2G5TA 4BP9A 3FN4A 2B2NA 3ASZA 4GRDA 5GONA 1BD4A 1U7TA 3R5JA 4AY6A 2C4KA 2DYYA 1Y7IA 1E1DA 1H8HD 1VE7A 2PX2A 2Q21A 3QE3A 1VSUA 4X7PA 2ZXUA 1DT9A 3TQRA 5CXXA 1CY4A 2LCQA 2XRZA 4WE3A 4QTXA 1QQ6A 4YMGA 1XNGA 4ZOLF 5AK0A 3TZCA 2O2GA 2VDUE 4V0OA 2HU8A 4BGIA 1BJRE 1NY5A 2B8EA 3UJNA 3WYDA 1C0KA 1HO3A 1KSJA 2SKCA 3DOFA 3I45A 5FI0B 3H4MA 1GRRA 4HEA6 1AHIA 4D8YA 4JLWA 1TCBA 3WB9A 2R6DA 4UDOA 1EVKA 4JOSA 1OV6A 1SB9A 4NZMA 4EDHA 3FIUA 4DG8A 1M7HA 1YVUA 2I2DA 5B7QA 4MLPA 2VHYA 3UY4A 4MARA 4MAAA 3WWCA 3ZKWB 3RVSA 5JV5A 3OW2U 1K1EA 3AHEA 5JEEA 4EYQA 1CB7A 2QU7A 5CFQA 2I8LA 3GFGA 3IP8A 3UJPA 1JD1A 1W1UA 3A05A 4IJWA 3ZIUA 4KO1S 2Z5UA 4R3NA 3DDOA 1GL9B 3PVSA 4OL9A 2SKDA 3TEMA 1FSGA 1GGMA 5FL7A 4FFVA 2VKTA 4BDTA 5LBUA 2NU6A 1W4LA 1AILA 2MK3A 5B1AC 2A8YA 2HMUA 3OGCC 2DWUA 2PGDA 1KD1H 3CXUA 3VSAA 2HF9A 2WQ7A 1Q17A 2FPKA 5AVKA 4N6OA 1UBTS 2SCUB 4B83A 1I4EB 3AZQA 4QL3A 2EBFX 1N5OX 1MPTA 1ZICA 3W7UA 1S02A 3AKEA 3FUUA 1Q77A 2WSYB 3IBYA 1KP2A 4DLXA 4DNOA 5K4GA 1ZTEA 2JFUA 2N47A 1AHPA 1HTWA 4LEIA 5CT8A 4IEIA 1IBCA 1QG6A 3BIJA 3SDBA 1L7AA 1TQ6A 4H0NA 4Q20A 4IDDA 4BAYA 1XXHE 2QRZA 3FHCB 4KE8A 4QPJA 1RZ3A 1VSVA 2WIGA 1PGJA 3GLHB 3ZDQA 4DWWA 4BQPA 2O9JA 2NN3C 1IN1A 1JLMA 3CLSC 4G8JA 1NVAA 1ADJA 3LDTA 1K0FA 3I37X 2HA6A 3OZ7A 4IKOA 4A92A 1ORQC 3TWOA 1W48A 3RUFA 1GZVA 3HSSA 5H83A 1H23A 4D7TA 4RFSB 2ZF8A 3LY5A 1FZTA 3A4VA 3HSKA 4K9QA 2N1BA 4XIJA 2EQ5A 3HCEA 4AWXA 1P31A 2ZS9A 4P22A 1ENZA 2WW8A 2OBLA 3IURA 4P4TA 2YI9A 1OXVA 4H27A 4Q39A 4I7EA 4YLGA 4CMHA 4EA7A 5JPDA 5BNWA 3VA7A 1PT5A 4Q1AA 3G17A 2F00A 3J80M 1VJ1A 3L7JA 2GEFA 1VKNA 1VBFA 4H9GA 3H5TA 2OVFA 3H7IA 4HGYA 4NC9A 5SZHB 3F5FA 3OM3B 3GLUA 4UEWA 3TS1A 3BDVA 5F77A 1MAWA 3HUDA 4K6FA 2J5BA 1A9RA 2XHZA 3IODA 1JMYA 8LDHA 2QGFA 5IS2A 2EZOA 3QE2A 1UBSB 5J5CA 2YYEA 2C8JA 3G68A 4AIIA 2P6UA 2QN9A 2AR7A 3B6JA 4NNOA 1B4DA 1OIWA 1Z6XA 4TRMA 4EFNA 2NU7A 4XCQA 2HQBA 5BV0A 4WEOA 5CFNA 2E4YA 4IV8A 1DJLA 1MF7A 1UXJA 4ID3A 4L57A 2CWWA 1E3TA 3JPWA 2LFSA 2D7JA 2ZQYA 1OCRB 3LTEA 5EE3A 5L4SA 3M4YA 4H7PA 4UM9B 4D57A 5EJ5A 4E7PA 1B6SA 1QU3A 1AVMA 4DG5A 4IJQA 1Q1QA 3ZJZA 2ZODA 5A7FA 5KTTA 1SKMA 3HEBA 3THYB 4E14A 1YVWA 1G9XA 3WXBA 7MHTA 5ESDA 1IZ7A 5A5GA 2RMKA 1SCNE 3JASA 3L8GA 3ZS8A 4DMUB 2XKKA 1I3CA 2OUIA 3WRVA 2IS6A 4LP8A 1PNLA 4RANA 5AIBA 2Y92A 2Z1FA 4BIOA 1AK1A 1J7JA 5C5DA 1O9GA 4P5EA 4KLCA 4S24A 5DPMA 1KQFA 4KB5A 2FG7C 3AERA 2XNJA 1NBIA 1IZ3A 4FLUA 3BE8A 1S72F 1JV2B 4IICA 5G41A 3ABMB 2G4CA 4EYKA 4EYOA 1C4XA 1LDEA 3L8DA 2GXSA 4N82A 4CLDA 3RFUA 1VGRA 4QDTA 3OPNA 5DZSA 1MW8X 1OCCB 1U2TA 3KKYA 2EZ9A 4MV0A 1T8WA 4B40A 2C4HA 2E18A 4KMOA 4MUIA 4G86A 5FV7A 1Y82A 3IDSA 3SC3A 4FCWA 3SS7X 1N1EA 3DLHA 2V59A 5LQAA 1ZI8A 1BFKA 2H8KA 3KYCA 3M5WA 3TXSA 5HBRA 1ZL8A 1YMQA 1OBOA 2EILC 4I55B 2Y6VA 3L4SO 3VKWA 1JA9A 4NMWA 1QIFA 5B1OA 2WM8A 4JC4A 1QO9A 4L73A 4A15A 2Q5ZA 3AF4A 3HRHA 4E46A 4ESHA 1TAUA 1UEIA 1VJRA 2MT9A 5IUKC 2YX1A 3FMVA 2VHVA 3OUTA 1GPAA 5ERYA 4GNKA 3WHKA 4Y6LA 1ECGA 2O2YA 2CMKA 2PX8A 4ZI5A 5GIPE 3RLIA 2H4HA 2FA9A 3D6MA 4F1KA 1UBRS 1DFGA 2DKFA 1X8KA 3M6XA 3TBFA 1Z0KA 3WJ2A 4RULA 4IJ6A 8GPBA 4N9WA 4P9OA 1GZ4A 1N5JA 1UKCA 1UPFA 5DGDA 2JH3A 5K0GA 1UBKS 3KBBA 1DZIA 4TTVA 5FOUA 3PR3A 2E9SA 4JV5B 2GTIA 1K2WA 2H1VA 2H85A 1L7EA 2R6AA 2V54A 3O1LA 4GH5A 3H1KH 3O9OA 1P84F 1CQJB 1U2PA 3AWDA 3CNBA 3MFYA 4KK3A 4XB1A 2OD7A 3TDNA 4BT2A 2GTHA 3JQBA 3KQYA 1Z35A 1J33A 2PCJA 1AI6A 2ZGVA 3CO0S 3LG2A 4RY8A 4BVTA 1KYXA 3ITKA 5H80A 4JZGA 1QQAA 2FQ1A 1FNNA 2BZ1A 3DO8A 1XMPA 1G20E 3QXGA 3CURA 5L7WA 2PS1A 2GAFA 2F3QA 2IGBA 1JLKA 3BYZA 1H38A 1R0RE 3D8BA 4RD3A 4A0HA 1CUYA 3UAXA 4D5EA 3HYTA 1DC7A 5L3BA 3QJ5A 1CLIA 2R9RB 2FWRA 4JP1A 3UC9A 1RHUA 2F9MA 4J7KA 3IVAA 2ODPA 5CHYA 1RQPA 1Q6UA 4C7XA 4G5HA 1NVTA 5CA1F 1O8BA 3CEAA 3N2KB 3IB3A 1FYDA 2VDWA 3F3KA 4NR1A 2FZLA 3X1JA 3NORA 3V8PA 1L5SA 3LAWA 5DASA 1NYLA 4YP6A 2M32A 1SEPA 3KL2A 5LCXA 1FDUA 2F4VB 2AW5A 3RUIA 3A6PC 4BQIA 2GVDC 2XDWA 3P2OA 1TECE 2P6MA 2XRMA 1IBRA 2FB9A 5LJIA 5B1YA 2QX6A 4JDUA 6ABPA 3AKYA 3H65A 4IDNA 1C7ZA 4GFDA 3OC0A 2GD2A 1YS2X 4BVRA 1E77A 3AI1A 3CNQS 3G9TA 3KOYA 3ORYA 3TL6A 5ADUS 3KSMA 4LCEA 3BMOA 3QYAA 3S4YA 1HDXA 4HDKB 1DXQA 1N2GA 2EBWA 2XF8A 3QX8A 1LC3A 1X7ZB 1W94A 2H5LA 3DSQA 2QJFA 3AUKA 3JQDA 4PY2A 1XNHA 5TQJA 3AO0B 5CFRA 3N2GB 1G5RA 1P29A 3OUSA 2ADMA 2ID4A 5AI8A 1AV6A 2FP4B 5JLAA 2GI4A 2OECA 3GJ4A 3IOEA 4C2TA 1D0VA 1RI5A 1XL0A 1ZCFA 4NY1A 4RF2A 1V4VA 3CUKA 1YMUA 1UPTA 3DMNA 3BXZA 3SWWA 5I9NA 2B1RA 2REBA 3I2KA 4EYSA 1K9SA 1EG2A 2FFJA 2H4WA 4I9FA 4R51A 3ZBHA 1DAHA 1K08A 4P3YA 1PWZA 4ZANA 4IHJF 2HUNA 2Q67A 3ASNB 1E7MA 1FU7A 4F72A 1F9AA 4HVCA 5FWYA 2FFBA 5LQRA 3HXTA 1DPFA 3OE4A 4YV2A 4B82A 2GV9A 2V65A 2O5EA 3K0FA 4WESB 3STLC 4BLWA 2TRSB 1CUCA 3G2LA 2VQSA 5GINC 1JDVA 2AG0A 4PELA 4JI8B 3DMDA 3OSZA 1NC1A 1Z6AA 5K0LA 1TLLA 3LE8A 2VF7A 3O8OB 3LVFO 3TW6A 4H4CA 1FYEA 1PNVA 4X1YA 1QIHA 3OECA 2PF4E 4MQMA 4QFMA 4TRRA 4US1R 3GN2A 1E5XA 4XGKA 1B2LA 1EAMA 3SR4A 4QOHA 5KZMB 3ROMA 2C9OA 3UQYS 1VPDA 1MR3F 1D4ZA 3AHDA 2E87A 2BSXA 2CNLA 4OU5A 1O96A 3KYJB 4DRZA 1KZ9A 3DHWC 4G5SA 2BN4A 4XJSA 4YCNA 1M1YE 4MUGA 1G16A 5LA6B 1M3SA 1RJFA 4ENRA 3H16A 3HGTA 3M1AA 5JS2A 1P7CA 1CEZA 3FNBA 2DOSA 2HQ1A 5LA6F 2F3SA 4EFLA 4F3NA 1S3JA 3GNLA 4R7CA 4WNYA 1OFTA 3NC4A 4MLCA 4FYPA 4BNIA 3MN1A 2WTNA 3K92A 1I33A 2XMPA 1OWOA 1H2WA 2D0DA 3TBKA 1Y5MA 1KKDA 4X65B 1EAYA 1ZSVA 2J9FB 2NMUA 2VAVA 1JALA 3AB7A 3FDIA 4L0CA 4LMPA 1KMCA 3COPA 1KGSA 3H86A 5AXAA 2O3TA 4X64B 4LSGA 4AN0A 4GZMA 1DLBA 2K9PA 1JOYA 1K5HA 1MJGA 2GD0A 4CMEA 4KITB 3DDSA 3HXOA 4Z1MG 1CZHA 4EY8A 3QI7A 3D8CA 2QY9A 5JISA 1L7OA 3GLQA 4ETWA 2ESRA 1C8BA 1OXUA 4ZQBA 3C0KA 1EN5A 1IZ9A 1F51E 2L35A 2N74A 4I4TB 1L7PA 1N2HA 2JFQA 1K34A 1NI4A 4HDMA 2EP7A 1RA4A 2QUHA 2EFGA 2QEXF 2TSYB 3PXBA 4S2EA 5D1NA 3UCXA 5HTOA 1P2SA 1V7ZA 3PYXA 4GOJA 4I3GA 2BTQA 2WVGA 3KYBA 1WR8A 5FF9A 4CFSA 5F1PA 4F3YA 2IU3A 4I55A 1E7SA 1Z37A 2ZJ5A 3IH5A 1R10A 3DLTA 4GDMA 4HQKA 5TMBA 1WIWA 5F9FA 4M1OA 1V43A 2QAGB 4RPJA 3HP4A 3ICCA 5IN4A 1WBDA 5EQFA 1W1IA 2W2TA 5B6PA 4HAZA 4JI7B 4IS3A 1Y76B 1T2EA 4ZHQA 2C1ZA 2ABWA 4O3MA 4DR2B 3R8XA 1VIMA 2DETA 5JAPA 4Q66C 1QHFA 3R6LA 4GICA 4OI4A 2X6BA 2O8FB 1Z6GA 2QP4A 1ZLYA 3HB7A 5GW7A 4WNAB 3V7NA 2MU1A 2PD4A 2R00C 4GP7A 1QCEA 1AXRA 2HMWA 2IH4A 2XDAA 5DX1A 4ZHVA 3N0RA 4S2UA 4D8XA 5LWHA 2Q0AA 2GGSA 3TQCA 1XJ5A 1IN5A 3H0KA 1RWNA 2DX7A 4QUKA 3HKEB 2BUCA 5LOVA 4F60A 4KX5A 4ME6A 4ZQEA 3ROTA 4FWTA 2UU9B 1DX6A 1LBQA 2QTMA 1WDKA 1AKTA 3K0AA 1YL6A 5DHQA 2VF5X 4ZHSA 5A0VA 3SVTA 2ODMA 1BZKA 2HRRA 3D7MA 2XAAA 3M4NA 4OGLA 3N8GA 4RD1A 5E2IA 3ACBA 5DF1A 4P3KA 4B09A 3RK4A 4ZGWA 4BNVA 4MUJA 4QYXA 4HWTA 1EHYA 2OPBA 5AW0A 2P7IA 1DAKA 3KKMA 2FSGA 4OHFA 1PPJH 3OZTA 1OLOA 2O2SA 3EGDB 4CMGA 1W9HA 2OCHA 1ETHA 3UGKA 3GGOA 2REQA 4M7OA 1QQ5A 5G0VA 1Q2XA 2GAIA 1FBTA 2VPYA 4UEOA 4PFQA 3ENZA 3R6GA 2VK4A 4Q00A 3HVRA 3ABKB 4RQOA 3NEAA 5HCUA 3BTOA 2JATA 5LGTA 3AZPA 3OWXA 4IFEA 1V3QE 3BULA 1LGYA 2A92A 3ORRA 2AOUB 4OMDA 3USCS 2R6HA 2GBLA 2D1QA 3AIIA 2A35A 3FZGA 1G1MA 1ZAKA 3I4FA 3RIYA 4DLAA 4ES6A 2V1XA 3JATA 5HW0A 2BLNA 1TCAA 2QNIA 3EZ9A 4ZEXA 3ICQB 4H7DA 1ZNWA 3E8GA 3EASA 2AX3A 1P33A 4CQNA 3HMKA 4AUKA 1K06A 5ALUA 2PAFA 4OXSA 2ZAMA 3H5AA 4ZVRA 1NJ2A 2BP7B 1PUIA 2FKNA 2RHRA 1W581 4D8VA 4B75A 5C8DA 3P20A 1XHEA 1GCUA 3JYLA 3CX6A 4HH1A 1LNSA 1Z62A 2QPAA 3GZ4A 4NCNA 4U1RA 3SJUA 4EHJA 1EIWA 2PSSA 4AQ7A 1QHTA 5DEOA 2LUOA 1LKZA 4J4BA 1B26A 4M98A 1N0UA 3RM3A 2VDPB 2LE0A 3BORA 1EINA 1UBGA 3ICXA 3OD1A 3O8NA 2W4MA 2H1CA 4MDYA 3N0XA 4RQAA 4W7IA 4WW0A 3II6X 4BVLA 3G59A 2PANA 1MA3A 5HF6A 1C1XB 1GK9A 4D4HA 2YY5A 1YJ5A 1YR7A 2VLBA 3LQ1A 1DRWA 5AW5A 3RIEA 3OLVA 3L0DA 2JIZA 1KJ9A 5KI6A 4JYZA 2GX6A 1FQOA 1X7WB 2I87A 1G20B 3S2UA 3NVKE 1LTKA 3BAAA 3BHMA 3L3BA 4MMZB 1M1UA 4RY2A 3I9V1 3ZCSA 3IHTA 2E5LO 3O8LA 1O97D 3KLBA 3OW2F 4YJ3B 4MS4B 1EK5A 1JT9A 1M5UA 3H4TA 3NWPA 4UUAA 3W4KA 3VVBA 4X9XA 4UB8Z 4A8HA 1NVUQ 2WAXA 1WTCA 2PVPA 1KO1A 4HUQB 5JROA 3HJNA 4CEJA 3GA5A 3VZSA 3Q3JB 1XNQO 4MGEA 3WGHA 4CBCA 1CJKC 4MCHA 3S8EA 3RKSA 2VUTA 2Q5HA 1ENPA 1IULA 2JLUA 2B9EA 4YX9A 3LQKA 4MV4A 3R8FA 2VP3A 2HYIC 1E3SA 1NUPA 4RLSA 1ZOSA 3DC2A 4ID9A 2QAGC 3E05A 3SX2A 2XUZA 5DE3A 3SF0A 2ANBA 2WP0A 2FF7A 4XW2A