4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
3TD5A 5EB0A 4ZHYB 3S0YA 2ZF8A 1R1MA 3LDTA 3WPWA 4ZHVA 2K1SA 4G4VA 3S0WA 2LCAA 3OONA 2HQSC 3CYPB 3S0HA 4RHAA 4G4XA 3S06A 1OAPA 4ZHWA 5EB1B 4B62A 4G4WA 2L26A 4G4ZA 3CYQA 2ZOVA 3TD4A 3TD3A 2KGWA 2ZVZA 3S03A 4R40B 3KHNA 4G88A 3IMPA 4B5CA 2AIZP 4ERHA 2ZVYA 2N48A 4G4YA 5EAZA 3S02A 4PWTA 2MQEA 3WPXA 2W8BC 2LBTA
chains in the Genus database with same CATH superfamily
1JY8A 2R751 1M90H 2QEXF 3LDTA 4HNAB 4BY9D 2B33A 2VXYA 2ZODA 3WGLA 3LWRC 1NQ3A 3P4EA 4I4TB 3MBMA 4X20A 1T0KB 1W55A 5AVMA 1K8AH 3MCAB 4O4LA 3KIZA 4G4WA 3NMUC 4G4ZA 5GONB 5EYPB 4TZZA 1H7MA 4WBNA 5GIOC 1S72F 3N2KB 1KNKA 5JCOA 3ELCA 4C8EA 3KE1A 5JH7B 5FNVA 5JVDB 1QAHA 1TUBB 5C8YA 2HP3A 4NWOB 1Q81H 2UYKA 3CPQA 3MCQA 4BT5A 2OTLF 1FFXA 2WALA 4O4LB 3WGNA 1W5EA 4M8IA 3LMEA 4XCQA 4BT2A 1W41A 2EWCA 3S03A 3M1XA 1RQ7A 3ZO8A 5HP7A 2ZVYA 1VQMF 2MQEA 2H8EA 4I55B 5CA1A 3TD5A 3VO8A 4IIJA 5FNVB 3B6NA 3NK6A 3HKCB 2CHTA 3OONA 3WJPA 4TV8B 4B45A 5ITZA 3MQWA 1KQSF 1UI9A 3E1YA 5LOVB 1M1KH 1VQ6F 4F6RA 1VQOF 1CN7A 3NVIB 3KJKA 3J7AR 1DBFA 2ZOVA 2FC3A 3J80M 5KX5A 3HTNA 2VGMA 3JARA 5BMVB 2CSLA 3V3TA 1RLGA 1IPAA 5LA6B 5J2TA 3VI6A 4ZHQA 3CCLF 2JNBA 2Z1UA 3UT5A 1J7HA 2BTUA 3LWPC 1KNJA 4U39A 5GINC 4LNUB 3QHDA 4BVSA 3CPWF 1YHQF 4O2AB 3NVKE 3S06A 4ZHWA 1ZWZA 1IV4A 2RHLA 3JASB 3C9UA 3HWUA 1H47A 2IG8A 2HS4A 2P6YA 3D54A 3G71F 5LYJA 3VTIC 2Z01A 5EZYB 3IEWA 1W42A 3IMPA 4O4IA 4NQ3A 3QUWA 1VH8A 3N4ZA 2LBXA 4IHJB 5EB0A 5HWEA 4TUYA 5IJ0B 1Q7YH 3F0EA 4G4VA 3CXCF 5IJ9A 2LCAA 3L7QA 2HS3A 1JJ2F 5FLXM 2CW4A 2H6LA 2UZHA 3GYQA 5IT9M 3JALA 3O85A 3F0DA 4O4JB 2RHJA 3CMEF 5HXZA 2RHHA 5IYZB 4DXDA 2CWJA 3OBWA 3CB2A 1VQPF 3CCEF 3LYBA 2HRYA 3DDNA 3ZOPA 4YJ3B 3VYUC 1UFYA 4EI7A 2UYNA 3RYHB 3GHZA 2K1SA 2ALEA 2ZAUA 1SDSA 3WGKA 3IKEA 5IJ9B 4EB6A 1VQLF 3PAFA 2BO1A 4U3JA 4ZI7A 1XHOA 4X1YB 2L26A 1JFFA 3T80A 1FNKA 1VQ8F 3VYTC 2KGWA 3CMAF 3RYCB 3V7QA 1W59A 1OFUA 1SA0B 3M4SA 2LBTA 3CCMF 4EI9A 3NK7A 3JAWA 4BT6A 2G9IA 1YJ9F 1XV2A 3JATA 1KC8H 4ZHVA 5J2UA 3SIVA 1X25A 1JN1A 1YIJF 1Q8RA 1K9MH 5MN6A 1RQ2A 1FSZA 2KTUA 2HVYD 1W3EX 4X20B 5EB1B 4FFBA 5GAPK 4BT7A 1FNJA 5HY0A 3CCRF 5LXTA 5LP6A 3IKFA 1JFFB 2IQQA 1RLUA 3G4SF 2YYEA 3ZP4A 3K2XA 3PLAC 1W5AA 3RYFA 3KHNA 4WBNB 2HS0A 3VMFB 3CD6F 3N2GA 3VYSC 3WPXA 3E22A 2UYPA 1COMA 1YI2F 5HY1A 3C9RA 5CA0A 3BYQA 5EO3A 4X1KA 2OZBA 3FBAA 1VQVA 4BW0B 1SZQA 5C8YB 2UYJA 4DRXA 1GO1A 1W5FA 1FFXB 3CYQA 4X3MA 5JQGA 5LXTB 3WJQA 3ZP7A 1U3LA 2OTMA 1VHAA 4C81A 4RQOA 4G4YA 3ERNA 2Q1YA 3I55F 4C8IA 5MN5A 5CA1B 3ESJA 2HP0A 3HKBA 3K14A 3I7TA 1K73H 2RB9A 1CLIA 1CK2A 3LFOA 4IIJB 3K0TA 4BT4A 3HJWC 2CVLA 5ITZB 1ODEA 2PHNA 3CCQF 4X1IA 2VGNA 4F6RB 2QA4F 4EI8A 3CCJF 3TD3A 5DCVA 1YQNA 5KMGA 1QVFF 1DT9A 1XBIA 5JQGB 4ERHA 3HKDA 5KX5B 2BTQB 3OW2F 3JARB 1N8RH 2BTOA 3D01A 4O2BA 5JCOC 3F0GA 3CC7F 3JAMM 5J2TB 1YJNF 2CHSA 3RYIA 1R1MA 1U3PA 4ZHQB 3G6EF 3SIUA 3F6MA 3UT5B 2H8CA 2VAMA 1TVKA 3ON1A 1VQ9F 1JD1A 3C8LA 3WGMA 2AMTA 5G4VC 3JAKA 3P0ZA 4X1IB 4X3LA 1GX1A 5LP6C 2Z1EA 4I50A 3RA6A 5CB4A 1VQ5F 1VQ7F 4YJ2A 4TV9A 5KMGB 4G88A 2VAPA 3IR9A 5LYJB 3KJJA 3MDOA 4O4HA 4O4IB 1GO0A 1U43A 4O2BB 1U40A 3VOAA 1X7OA 5B8FA 4I4TA 1IV2A 4TUYB 2PMPA 1GZ0A 3N4YA 3RE3A 3DC2A 1T0AA 4LCKA 2GVIA 3LWOC 5GONA 3WXMB 1W40A 2QI2A 1KD1H 1VQ4F 2I6RA 3JALB 2Q1XA 5EWRA 4YJ2B 4R40B 4TV9B 3I56F 3N2KA 3P10A 1QD9A 4B46A 5JH7A 1W57A 1IV1A 5HY4A 2ZF8A 3OBYA 5JVDA 1TUBA 1X52A 3WPWA 3FPIA 4BT3A 1Q86H 2UYNB 1NMUB 5HP8A 2HQSC 1IV3A 3VCZA 1W2BF 3S0HA 3WJRA 3CCSF 3R0PA 4BVRA 2Z1FA 4EB6B 1NJIH 2OHWA 4BVTA 3FD5A 3LWVC 4U3JB 4ZI7B 2GZLA 2ZVZA 1VQNF 3K12A 4ZOLA 3U0OA 3C9SA 2N48A 4I55A 2F9ZC 4E6EA 3LWQC 3HKEA 3GTZA 3HKCA 1W581 4TV8A 3JAWB 5LOVA 3JATB 5A2QM 1E7KA 5J2UB 5G4UC 1Q82H 4G4XA 1OAPA 1ONIA 4NUTA 3J81M 1YGYA 3VOBA 4C82A 4FFBB 3TD4A 3FD6A 5EIBD 5BMVA 4BVQA 3WGJA 1PF5A 5LP6B 2DT4A 5GANK 2AIZP 5LA6A 3AGKA 3RYFB 1VQKF 3D00A 3CC4F 4ZOLB 1RA4A 2KTVA 3E20B 5MN4A 2W8BC 3N2GB 1Z5VA 3S0YA 3HKEB 4C4WC 3E22B 4LNUA 2OTJF 2DYYA 3FFMA 3QTYA 3S0WA 4O2AA 3CYPB 2V9YA 5CA0B 3JASA 4X1KB 3I3FA 1W5BA 3CC2F 4B62A 3Q8HA 4DRXB 5FJ4C 3VIUA 5EZYA 2Z1TA 3CG6A 3JCMM 1QU9A 2IAFA 3RA5A 3S02A 4IHJA 2HX0A 5IJ0A 4ZHYB 5EIBC 3IEQA 4ZK7A 1YJWF 2I6DA 2HP0B 3HKBB 2QTPA 3M84A 4RHAA 3CCVF 4KWEA 3CCUF 2YXZA 2NMUA 1X7PA 4O4JA 5HY2A 1QVGF 2GLZA 5IYZA 4C8GA 3C9TA 1Z5WA 1YITF 2RHOA 1H48A 2LBWA 5EAZA 4YJ3A 3HKDB 3RYHA 2FGYA 4HNAA 3F0FA 5GIPC 3RYIB 2VAWA 1TVKB 1XRGA 2CZWA 4X1YA 1PXWA 1VK3A 2HRUA 3JAKB 5EYPA 3V4DA 3EORA 3RYCA 3JVHA 4I50B 5CB4B 4B5CA 3HAXD 5HXUA 1SA0A 2R6R1 2AIFA 4PWTA 3V7EA 4O4HB 2KG4A
chains in the Genus database with same CATH topology
3TD5A 5EB0A 4ZHYB 3S0YA 2ZF8A 1R1MA 3LDTA 3WPWA 4ZHVA 2K1SA 4G4VA 3S0WA 2LCAA 3OONA 2HQSC 3CYPB 3S0HA 4RHAA 4G4XA 3S06A 1OAPA 4ZHWA 5EB1B 4B62A 4G4WA 2L26A 4G4ZA 3CYQA 2ZOVA 3TD4A 3TD3A 2KGWA 2ZVZA 3S03A 4R40B 3KHNA 4G88A 3IMPA 4B5CA 2AIZP 4ERHA 2ZVYA 2N48A 4G4YA 5EAZA 3S02A 4PWTA 2MQEA 3WPXA 2W8BC 2LBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD5 A;  5EB0 A;  4ZHY B;  3S0Y A;  2ZF8 A;  1R1M A;  3LDT A;  3WPW A;  4ZHV A;  2K1S A;  4G4V A;  3S0W A;  2LCA A;  3OON A;  2HQS C;  3CYP B;  3S0H A;  4RHA A;  4G4X A;  3S06 A;  1OAP A;  4ZHW A;  5EB1 B;  4B62 A;  4G4W A;  2L26 A;  4G4Z A;  3CYQ A;  2ZOV A;  3TD4 A;  3TD3 A;  2KGW A;  2ZVZ A;  3S03 A;  4R40 B;  3KHN A;  4G88 A;  3IMP A;  4B5C A;  2AIZ P;  4ERH A;  2ZVY A;  2N48 A;  4G4Y A;  5EAZ A;  3S02 A;  4PWT A;  2MQE A;  3WPX A;  2W8B C;  2LBT A; 
#chains in the Genus database with same CATH topology
 1JY8 A;  2R75 1;  1M90 H;  2QEX F;  3LDT A;  4HNA B;  4BY9 D;  2B33 A;  2VXY A;  2ZOD A;  3WGL A;  3LWR C;  1NQ3 A;  3P4E A;  4I4T B;  3MBM A;  4X20 A;  1T0K B;  1W55 A;  5AVM A;  1K8A H;  3MCA B;  4O4L A;  3KIZ A;  4G4W A;  3NMU C;  4G4Z A;  5GON B;  5EYP B;  4TZZ A;  1H7M A;  4WBN A;  5GIO C;  1S72 F;  3N2K B;  1KNK A;  5JCO A;  3ELC A;  4C8E A;  3KE1 A;  5JH7 B;  5FNV A;  5JVD B;  1QAH A;  1TUB B;  5C8Y A;  2HP3 A;  4NWO B;  1Q81 H;  2UYK A;  3CPQ A;  3MCQ A;  4BT5 A;  2OTL F;  1FFX A;  2WAL A;  4O4L B;  3WGN A;  1W5E A;  4M8I A;  3LME A;  4XCQ A;  4BT2 A;  1W41 A;  2EWC A;  3S03 A;  3M1X A;  1RQ7 A;  3ZO8 A;  5HP7 A;  2ZVY A;  1VQM F;  2MQE A;  2H8E A;  4I55 B;  5CA1 A;  3TD5 A;  3VO8 A;  4IIJ A;  5FNV B;  3B6N A;  3NK6 A;  3HKC B;  2CHT A;  3OON A;  3WJP A;  4TV8 B;  4B45 A;  5ITZ A;  3MQW A;  1KQS F;  1UI9 A;  3E1Y A;  5LOV B;  1M1K H;  1VQ6 F;  4F6R A;  1VQO F;  1CN7 A;  3NVI B;  3KJK A;  3J7A R;  1DBF A;  2ZOV A;  2FC3 A;  3J80 M;  5KX5 A;  3HTN A;  2VGM A;  3JAR A;  5BMV B;  2CSL A;  3V3T A;  1RLG A;  1IPA A;  5LA6 B;  5J2T A;  3VI6 A;  4ZHQ A;  3CCL F;  2JNB A;  2Z1U A;  3UT5 A;  1J7H A;  2BTU A;  3LWP C;  1KNJ A;  4U39 A;  5GIN C;  4LNU B;  3QHD A;  4BVS A;  3CPW F;  1YHQ F;  4O2A B;  3NVK E;  3S06 A;  4ZHW A;  1ZWZ A;  1IV4 A;  2RHL A;  3JAS B;  3C9U A;  3HWU A;  1H47 A;  2IG8 A;  2HS4 A;  2P6Y A;  3D54 A;  3G71 F;  5LYJ A;  3VTI C;  2Z01 A;  5EZY B;  3IEW A;  1W42 A;  3IMP A;  4O4I A;  4NQ3 A;  3QUW A;  1VH8 A;  3N4Z A;  2LBX A;  4IHJ B;  5EB0 A;  5HWE A;  4TUY A;  5IJ0 B;  1Q7Y H;  3F0E A;  4G4V A;  3CXC F;  5IJ9 A;  2LCA A;  3L7Q A;  2HS3 A;  1JJ2 F;  5FLX M;  2CW4 A;  2H6L A;  2UZH A;  3GYQ A;  5IT9 M;  3JAL A;  3O85 A;  3F0D A;  4O4J B;  2RHJ A;  3CME F;  5HXZ A;  2RHH A;  5IYZ B;  4DXD A;  2CWJ A;  3OBW A;  3CB2 A;  1VQP F;  3CCE F;  3LYB A;  2HRY A;  3DDN A;  3ZOP A;  4YJ3 B;  3VYU C;  1UFY A;  4EI7 A;  2UYN A;  3RYH B;  3GHZ A;  2K1S A;  2ALE A;  2ZAU A;  1SDS A;  3WGK A;  3IKE A;  5IJ9 B;  4EB6 A;  1VQL F;  3PAF A;  2BO1 A;  4U3J A;  4ZI7 A;  1XHO A;  4X1Y B;  2L26 A;  1JFF A;  3T80 A;  1FNK A;  1VQ8 F;  3VYT C;  2KGW A;  3CMA F;  3RYC B;  3V7Q A;  1W59 A;  1OFU A;  1SA0 B;  3M4S A;  2LBT A;  3CCM F;  4EI9 A;  3NK7 A;  3JAW A;  4BT6 A;  2G9I A;  1YJ9 F;  1XV2 A;  3JAT A;  1KC8 H;  4ZHV A;  5J2U A;  3SIV A;  1X25 A;  1JN1 A;  1YIJ F;  1Q8R A;  1K9M H;  5MN6 A;  1RQ2 A;  1FSZ A;  2KTU A;  2HVY D;  1W3E X;  4X20 B;  5EB1 B;  4FFB A;  5GAP K;  4BT7 A;  1FNJ A;  5HY0 A;  3CCR F;  5LXT A;  5LP6 A;  3IKF A;  1JFF B;  2IQQ A;  1RLU A;  3G4S F;  2YYE A;  3ZP4 A;  3K2X A;  3PLA C;  1W5A A;  3RYF A;  3KHN A;  4WBN B;  2HS0 A;  3VMF B;  3CD6 F;  3N2G A;  3VYS C;  3WPX A;  3E22 A;  2UYP A;  1COM A;  1YI2 F;  5HY1 A;  3C9R A;  5CA0 A;  3BYQ A;  5EO3 A;  4X1K A;  2OZB A;  3FBA A;  1VQV A;  4BW0 B;  1SZQ A;  5C8Y B;  2UYJ A;  4DRX A;  1GO1 A;  1W5F A;  1FFX B;  3CYQ A;  4X3M A;  5JQG A;  5LXT B;  3WJQ A;  3ZP7 A;  1U3L A;  2OTM A;  1VHA A;  4C81 A;  4RQO A;  4G4Y A;  3ERN A;  2Q1Y A;  3I55 F;  4C8I A;  5MN5 A;  5CA1 B;  3ESJ A;  2HP0 A;  3HKB A;  3K14 A;  3I7T A;  1K73 H;  2RB9 A;  1CLI A;  1CK2 A;  3LFO A;  4IIJ B;  3K0T A;  4BT4 A;  3HJW C;  2CVL A;  5ITZ B;  1ODE A;  2PHN A;  3CCQ F;  4X1I A;  2VGN A;  4F6R B;  2QA4 F;  4EI8 A;  3CCJ F;  3TD3 A;  5DCV A;  1YQN A;  5KMG A;  1QVF F;  1DT9 A;  1XBI A;  5JQG B;  4ERH A;  3HKD A;  5KX5 B;  2BTQ B;  3OW2 F;  3JAR B;  1N8R H;  2BTO A;  3D01 A;  4O2B A;  5JCO C;  3F0G A;  3CC7 F;  3JAM M;  5J2T B;  1YJN F;  2CHS A;  3RYI A;  1R1M A;  1U3P A;  4ZHQ B;  3G6E F;  3SIU A;  3F6M A;  3UT5 B;  2H8C A;  2VAM A;  1TVK A;  3ON1 A;  1VQ9 F;  1JD1 A;  3C8L A;  3WGM A;  2AMT A;  5G4V C;  3JAK A;  3P0Z A;  4X1I B;  4X3L A;  1GX1 A;  5LP6 C;  2Z1E A;  4I50 A;  3RA6 A;  5CB4 A;  1VQ5 F;  1VQ7 F;  4YJ2 A;  4TV9 A;  5KMG B;  4G88 A;  2VAP A;  3IR9 A;  5LYJ B;  3KJJ A;  3MDO A;  4O4H A;  4O4I B;  1GO0 A;  1U43 A;  4O2B B;  1U40 A;  3VOA A;  1X7O A;  5B8F A;  4I4T A;  1IV2 A;  4TUY B;  2PMP A;  1GZ0 A;  3N4Y A;  3RE3 A;  3DC2 A;  1T0A A;  4LCK A;  2GVI A;  3LWO C;  5GON A;  3WXM B;  1W40 A;  2QI2 A;  1KD1 H;  1VQ4 F;  2I6R A;  3JAL B;  2Q1X A;  5EWR A;  4YJ2 B;  4R40 B;  4TV9 B;  3I56 F;  3N2K A;  3P10 A;  1QD9 A;  4B46 A;  5JH7 A;  1W57 A;  1IV1 A;  5HY4 A;  2ZF8 A;  3OBY A;  5JVD A;  1TUB A;  1X52 A;  3WPW A;  3FPI A;  4BT3 A;  1Q86 H;  2UYN B;  1NMU B;  5HP8 A;  2HQS C;  1IV3 A;  3VCZ A;  1W2B F;  3S0H A;  3WJR A;  3CCS F;  3R0P A;  4BVR A;  2Z1F A;  4EB6 B;  1NJI H;  2OHW A;  4BVT A;  3FD5 A;  3LWV C;  4U3J B;  4ZI7 B;  2GZL A;  2ZVZ A;  1VQN F;  3K12 A;  4ZOL A;  3U0O A;  3C9S A;  2N48 A;  4I55 A;  2F9Z C;  4E6E A;  3LWQ C;  3HKE A;  3GTZ A;  3HKC A;  1W58 1;  4TV8 A;  3JAW B;  5LOV A;  3JAT B;  5A2Q M;  1E7K A;  5J2U B;  5G4U C;  1Q82 H;  4G4X A;  1OAP A;  1ONI A;  4NUT A;  3J81 M;  1YGY A;  3VOB A;  4C82 A;  4FFB B;  3TD4 A;  3FD6 A;  5EIB D;  5BMV A;  4BVQ A;  3WGJ A;  1PF5 A;  5LP6 B;  2DT4 A;  5GAN K;  2AIZ P;  5LA6 A;  3AGK A;  3RYF B;  1VQK F;  3D00 A;  3CC4 F;  4ZOL B;  1RA4 A;  2KTV A;  3E20 B;  5MN4 A;  2W8B C;  3N2G B;  1Z5V A;  3S0Y A;  3HKE B;  4C4W C;  3E22 B;  4LNU A;  2OTJ F;  2DYY A;  3FFM A;  3QTY A;  3S0W A;  4O2A A;  3CYP B;  2V9Y A;  5CA0 B;  3JAS A;  4X1K B;  3I3F A;  1W5B A;  3CC2 F;  4B62 A;  3Q8H A;  4DRX B;  5FJ4 C;  3VIU A;  5EZY A;  2Z1T A;  3CG6 A;  3JCM M;  1QU9 A;  2IAF A;  3RA5 A;  3S02 A;  4IHJ A;  2HX0 A;  5IJ0 A;  4ZHY B;  5EIB C;  3IEQ A;  4ZK7 A;  1YJW F;  2I6D A;  2HP0 B;  3HKB B;  2QTP A;  3M84 A;  4RHA A;  3CCV F;  4KWE A;  3CCU F;  2YXZ A;  2NMU A;  1X7P A;  4O4J A;  5HY2 A;  1QVG F;  2GLZ A;  5IYZ A;  4C8G A;  3C9T A;  1Z5W A;  1YIT F;  2RHO A;  1H48 A;  2LBW A;  5EAZ A;  4YJ3 A;  3HKD B;  3RYH A;  2FGY A;  4HNA A;  3F0F A;  5GIP C;  3RYI B;  2VAW A;  1TVK B;  1XRG A;  2CZW A;  4X1Y A;  1PXW A;  1VK3 A;  2HRU A;  3JAK B;  5EYP A;  3V4D A;  3EOR A;  3RYC A;  3JVH A;  4I50 B;  5CB4 B;  4B5C A;  3HAX D;  5HXU A;  1SA0 A;  2R6R 1;  2AIF A;  4PWT A;  3V7E A;  4O4H B;  2KG4 A; 
#chains in the Genus database with same CATH homology
 3TD5 A;  5EB0 A;  4ZHY B;  3S0Y A;  2ZF8 A;  1R1M A;  3LDT A;  3WPW A;  4ZHV A;  2K1S A;  4G4V A;  3S0W A;  2LCA A;  3OON A;  2HQS C;  3CYP B;  3S0H A;  4RHA A;  4G4X A;  3S06 A;  1OAP A;  4ZHW A;  5EB1 B;  4B62 A;  4G4W A;  2L26 A;  4G4Z A;  3CYQ A;  2ZOV A;  3TD4 A;  3TD3 A;  2KGW A;  2ZVZ A;  3S03 A;  4R40 B;  3KHN A;  4G88 A;  3IMP A;  4B5C A;  2AIZ P;  4ERH A;  2ZVY A;  2N48 A;  4G4Y A;  5EAZ A;  3S02 A;  4PWT A;  2MQE A;  3WPX A;  2W8B C;  2LBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...