4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
2ZVYA 3S06A 3S03A 3LDTA 3S0WA 4ZHYB 2MQEA 4R40B 2L26A 4G4ZA 3WPWA 3S0HA 2KGWA 4G4XA 3TD5A 2LCAA 2LBTA 3OONA 2AIZP 3TD3A 2K1SA 3S0YA 2ZVZA 3CYQA 5EB0A 1OAPA 4G4YA 2N48A 2ZOVA 4G88A 2ZF8A 4G4VA 4ZHVA 5EB1B 4B62A 4B5CA 4PWTA 4ZHWA 3KHNA 3IMPA 3CYPB 2HQSC 2W8BC 3S02A 5EAZA 3WPXA 3TD4A 4ERHA 1R1MA 4RHAA 4G4WA
chains in the Genus database with same CATH superfamily
1IV3A 3S06A 4BY9D 2EWCA 4BT7A 4G4XA 3WGLA 3JARB 3VCZA 5LYJA 3RYFA 2ZVZA 1JY8A 2Z1EA 1UFYA 5CB4A 3RYCA 1VQLF 4KWEA 3V3TA 4TV8B 5GONB 2ZF8A 4G4VA 3E1YA 4ZHVA 2BTUA 5JVDB 3DDNA 3FBAA 1IV1A 3VOBA 1JN1A 4M8IA 4YJ2A 3ERNA 3WJRA 3KIZA 3N2GB 3CC7F 1H47A 1PXWA 1XHOA 2UYKA 3GTZA 5JCOA 1E7KA 1QD9A 3FD5A 4IHJB 4NUTA 3VOAA 5EZYA 1T0AA 1H7MA 3RA5A 4X1KA 1FSZA 3JVHA 5HY4A 5EYPA 5J2TB 3IEQA 4X20B 2GZLA 4G4YA 4EB6A 5LOVB 4O2AA 5J2UA 2KG4A 4RQOA 5BMVA 1SA0A 1R1MA 2GLZA 1PF5A 4I55A 4O4HA 3D54A 4R40B 4BVRA 4O4JB 4TUYB 4E6EA 2QEXF 3I3FA 3HTNA 3P10A 5IJ9A 1VH8A 3CCEF 3MCQA 3E20B 1M90H 3LYBA 4IIJB 1YJNF 1W2BF 5ITZB 2UYPA 5FLXM 1VQ5F 1YIJF 1W59A 3VMFB 4B45A 3MCAB 4O4IA 5MN5A 4ERHA 2F9ZC 5GIOC 3J80M 1W55A 3MDOA 1NQ3A 3UT5A 1YJWF 2VAMA 4FFBA 2IQQA 3WPWA 5IJ9B 4O2AB 5J2UB 3I55F 5G4UC 3OONA 3HJWC 1YI2F 4BT4A 3S0YA 2FC3A 1K9MH 2PMPA 3JARA 3JASB 4X1IA 2RHLA 5EZYB 1FNJA 2ZOVA 5FNVA 3CB2A 1K8AH 4B62A 4XCQA 5HWEA 5GONA 5LXTB 3IMPA 1VQOF 1GX1A 2I6DA 3WGKA 4X1YB 1SDSA 5EWRA 4YJ2B 3FFMA 1Z5WA 3RYIA 2Z1UA 1VQPF 4FFBB 3HKCB 3P0ZA 4IIJA 1YITF 4X3MA 2H6LA 3SIUA 1CLIA 2L26A 3WGMA 3HAXD 1IV4A 5BMVB 5AVMA 4BVSA 1COMA 3IKEA 4O4JA 2AMTA 4TUYA 4X3LA 3HKDB 3NK6A 1TUBB 2CWJA 3KHNA 3ZP4A 2R751 3I56F 5KMGB 1GZ0A 5EAZA 3CC4F 5JH7A 2YYEA 3TD4A 4U39A 2Z1FA 4EI8A 1N8RH 1Q82H 1U3PA 4BT2A 2I6RA 3VYSC 1T0KB 2UYNA 1YHQF 2HS3A 3KE1A 2KGWA 3S0HA 3LWQC 2K1SA 4I50A 4TV8A 3Q8HA 3JAKB 2Q1XA 4C82A 1GO0A 1VQMF 3AGKA 3VYUC 3HKCA 4C81A 5IJ0A 1VQNF 2RHHA 2RB9A 5HY1A 1K73H 3MBMA 1X7PA 1QU9A 3BYQA 3OBYA 4LNUA 4WBNA 5LXTA 1KNJA 5CB4B 3RYCB 1CK2A 1TVKA 4NWOB 5JCOC 2KTUA 3HKDA 4O2BA 3IR9A 3GYQA 4I50B 1JFFB 2AIZP 1QVFF 3NMUC 3CPWF 4EB6B 5LOVA 1VQ6F 5EB0A 1W581 2VGMA 1JD1A 3K12A 5HP8A 2KTVA 4I4TB 3C9UA 3CXCF 3F0DA 3JAWB 4ZOLA 1U40A 1XV2A 5LP6C 4X1KB 3VI6A 1ODEA 3C9RA 3ZP7A 3OBWA 2QI2A 3J7AR 1ZWZA 4DXDA 3RYHA 1SZQA 3B6NA 3M4SA 1J7HA 2MQEA 4G4ZA 3HKBA 4DRXB 3PLAC 3PAFA 5CA0B 4C8GA 3CCLF 3M1XA 3ELCA 3ZOPA 3RYFB 1QAHA 3CG6A 2BTQB 5FJ4C 1KC8H 3WGJA 4G88A 5GIPC 1GO1A 3DC2A 4ZHQB 3KJKA 2CHSA 5EYPB 5J2TA 3WPXA 4F6RB 1UI9A 1W41A 4O2BB 3N2KB 3FD6A 3UT5B 2AIFA 2CVLA 1Q86H 1KNKA 1YGYA 2HP3A 2OTMA 4X1IB 1XBIA 4BT3A 1U43A 1OAPA 3JALB 2Q1YA 1TVKB 3JCMM 3K2XA 2BTOA 3ON1A 4ZHWA 1NJIH 4F6RA 1W5AA 1W5FA 5B8FA 3NVKE 5C8YA 3N2KA 3WXMB 4O4LA 3JATB 1QVGF 5GANK 5IJ0B 1X7OA 1RQ2A 5IYZB 4G4WA 2OTJF 2DYYA 1IV2A 4C8IA 4HNAB 5MN4A 3CCRF 3CMAF 5JQGA 1FFXA 1DT9A 2LCAA 2HRUA 1OFUA 3JALA 5EO3A 5CA1A 1JFFA 3LWOC 3RYHB 1Z5VA 2HRYA 2W8BC 2ZODA 5HP7A 3N2GA 1W57A 1W40A 3CD6F 3F0GA 2ZVYA 3SIVA 2UYNB 3QHDA 3LDTA 3QUWA 3WJQA 3IEWA 3C8LA 4ZHYB 2QA4F 3TD5A 4BW0B 1NMUB 2FGYA 3JAKA 5JVDA 3M84A 5LP6A 3U0OA 5HXUA 2CZWA 1FNKA 5MN6A 3L7QA 5EB1B 2P6YA 1VQ7F 2VAWA 4ZHQA 3I7TA 4C8EA 2ZAUA 1FFXB 1XRGA 1W3EX 3D00A 3NK7A 4X1YA 3LWRC 5EIBC 1X25A 2UZHA 2HP0A 3CCSF 2HVYD 2WALA 2IG8A 1M1KH 5LA6B 2CW4A 3F0FA 3K0TA 3FPIA 3CYQA 3E22B 3HKEB 3CCUF 2B33A 1SA0B 4BT6A 3CCJF 3CPQA 5JQGB 3CMEF 3JAWA 4WBNB 1KQSF 5HY0A 3G6EF 1VQ4F 3JAMM 3LMEA 2HQSC 4O4IB 3VYTC 2Z01A 4X20A 5G4VC 3V4DA 4O4LB 1W5BA 3RA6A 1Q81H 3N4YA 2R6R1 5EIBD 3S03A 2HX0A 1ONIA 3T80A 1CN7A 2YXZA 2Z1TA 1DBFA 5CA0A 3CCQF 2OZBA 2LBTA 1JJ2F 4ZOLB 4U3JB 4O4HB 1IPAA 3OW2F 4YJ3B 4B5CA 5GINC 3V7QA 1RLGA 3C9TA 3V7EA 2UYJA 3RE3A 4LCKA 2VXYA 1VK3A 5LP6B 3J81M 3R0PA 2QTPA 4DRXA 5ITZA 5KX5A 2JNBA 3E22A 3JASA 3N4ZA 4LNUB 5DCVA 5FNVB 5LYJB 1W5EA 2CSLA 1RLUA 2CHTA 2HS4A 5GAPK 3D01A 3CC2F 1H48A 1Q8RA 2RHOA 3ESJA 4EI7A 5IT9M 3P4EA 3VIUA 2LBXA 4B46A 1TUBA 2BO1A 5KMGA 4EI9A 2H8EA 4TZZA 3LWPC 3F6MA 4I4TA 5IYZA 3F0EA 3HKEA 3EORA 1S72F 1U3LA 4ZK7A 4RHAA 1RQ7A 4HNAA 3MQWA 4U3JA 3KJJA 3S0WA 3IKFA 2HP0B 3WJPA 1YQNA 4YJ3A 4C4WC 3TD3A 3HKBB 5C8YB 3O85A 4BT5A 5LA6A 2HS0A 3CCMF 5A2QM 2H8CA 1VQKF 4BVTA 1KD1H 3VTIC 5KX5B 4TV9A 3CCVF 4PWTA 2G9IA 1VQ8F 3CYPB 2PHNA 4NQ3A 2OHWA 1VQ9F 3VO8A 1Q7YH 1W42A 4ZI7A 5HXZA 1X52A 2V9YA 3WGNA 3G71F 3ZO8A 5CA1B 2LBWA 1VQVA 3RYIB 5HY2A 2NMUA 2RHJA 3JATA 3NVIB 3C9SA 3K14A 2IAFA 2OTLF 1RA4A 3G4SF 2DT4A 4IHJA 4TV9B 2N48A 2VGNA 1VHAA 3HWUA 4I55B 4ZI7B 3QTYA 3S02A 4BVQA 1YJ9F 3GHZA 2VAPA 3LFOA 2GVIA 3LWVC 2ALEA 5JH7B
chains in the Genus database with same CATH topology
2ZVYA 3S06A 3S03A 3LDTA 3S0WA 4ZHYB 2MQEA 4R40B 2L26A 4G4ZA 3WPWA 3S0HA 2KGWA 4G4XA 3TD5A 2LCAA 2LBTA 3OONA 2AIZP 3TD3A 2K1SA 3S0YA 2ZVZA 3CYQA 5EB0A 1OAPA 4G4YA 2N48A 2ZOVA 4G88A 2ZF8A 4G4VA 4ZHVA 5EB1B 4B62A 4B5CA 4PWTA 4ZHWA 3KHNA 3IMPA 3CYPB 2HQSC 2W8BC 3S02A 5EAZA 3WPXA 3TD4A 4ERHA 1R1MA 4RHAA 4G4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  3S06 A;  3S03 A;  3LDT A;  3S0W A;  4ZHY B;  2MQE A;  4R40 B;  2L26 A;  4G4Z A;  3WPW A;  3S0H A;  2KGW A;  4G4X A;  3TD5 A;  2LCA A;  2LBT A;  3OON A;  2AIZ P;  3TD3 A;  2K1S A;  3S0Y A;  2ZVZ A;  3CYQ A;  5EB0 A;  1OAP A;  4G4Y A;  2N48 A;  2ZOV A;  4G88 A;  2ZF8 A;  4G4V A;  4ZHV A;  5EB1 B;  4B62 A;  4B5C A;  4PWT A;  4ZHW A;  3KHN A;  3IMP A;  3CYP B;  2HQS C;  2W8B C;  3S02 A;  5EAZ A;  3WPX A;  3TD4 A;  4ERH A;  1R1M A;  4RHA A;  4G4W A; 
#chains in the Genus database with same CATH topology
 1IV3 A;  3S06 A;  4BY9 D;  2EWC A;  4BT7 A;  4G4X A;  3WGL A;  3JAR B;  3VCZ A;  5LYJ A;  3RYF A;  2ZVZ A;  1JY8 A;  2Z1E A;  1UFY A;  5CB4 A;  3RYC A;  1VQL F;  4KWE A;  3V3T A;  4TV8 B;  5GON B;  2ZF8 A;  4G4V A;  3E1Y A;  4ZHV A;  2BTU A;  5JVD B;  3DDN A;  3FBA A;  1IV1 A;  3VOB A;  1JN1 A;  4M8I A;  4YJ2 A;  3ERN A;  3WJR A;  3KIZ A;  3N2G B;  3CC7 F;  1H47 A;  1PXW A;  1XHO A;  2UYK A;  3GTZ A;  5JCO A;  1E7K A;  1QD9 A;  3FD5 A;  4IHJ B;  4NUT A;  3VOA A;  5EZY A;  1T0A A;  1H7M A;  3RA5 A;  4X1K A;  1FSZ A;  3JVH A;  5HY4 A;  5EYP A;  5J2T B;  3IEQ A;  4X20 B;  2GZL A;  4G4Y A;  4EB6 A;  5LOV B;  4O2A A;  5J2U A;  2KG4 A;  4RQO A;  5BMV A;  1SA0 A;  1R1M A;  2GLZ A;  1PF5 A;  4I55 A;  4O4H A;  3D54 A;  4R40 B;  4BVR A;  4O4J B;  4TUY B;  4E6E A;  2QEX F;  3I3F A;  3HTN A;  3P10 A;  5IJ9 A;  1VH8 A;  3CCE F;  3MCQ A;  3E20 B;  1M90 H;  3LYB A;  4IIJ B;  1YJN F;  1W2B F;  5ITZ B;  2UYP A;  5FLX M;  1VQ5 F;  1YIJ F;  1W59 A;  3VMF B;  4B45 A;  3MCA B;  4O4I A;  5MN5 A;  4ERH A;  2F9Z C;  5GIO C;  3J80 M;  1W55 A;  3MDO A;  1NQ3 A;  3UT5 A;  1YJW F;  2VAM A;  4FFB A;  2IQQ A;  3WPW A;  5IJ9 B;  4O2A B;  5J2U B;  3I55 F;  5G4U C;  3OON A;  3HJW C;  1YI2 F;  4BT4 A;  3S0Y A;  2FC3 A;  1K9M H;  2PMP A;  3JAR A;  3JAS B;  4X1I A;  2RHL A;  5EZY B;  1FNJ A;  2ZOV A;  5FNV A;  3CB2 A;  1K8A H;  4B62 A;  4XCQ A;  5HWE A;  5GON A;  5LXT B;  3IMP A;  1VQO F;  1GX1 A;  2I6D A;  3WGK A;  4X1Y B;  1SDS A;  5EWR A;  4YJ2 B;  3FFM A;  1Z5W A;  3RYI A;  2Z1U A;  1VQP F;  4FFB B;  3HKC B;  3P0Z A;  4IIJ A;  1YIT F;  4X3M A;  2H6L A;  3SIU A;  1CLI A;  2L26 A;  3WGM A;  3HAX D;  1IV4 A;  5BMV B;  5AVM A;  4BVS A;  1COM A;  3IKE A;  4O4J A;  2AMT A;  4TUY A;  4X3L A;  3HKD B;  3NK6 A;  1TUB B;  2CWJ A;  3KHN A;  3ZP4 A;  2R75 1;  3I56 F;  5KMG B;  1GZ0 A;  5EAZ A;  3CC4 F;  5JH7 A;  2YYE A;  3TD4 A;  4U39 A;  2Z1F A;  4EI8 A;  1N8R H;  1Q82 H;  1U3P A;  4BT2 A;  2I6R A;  3VYS C;  1T0K B;  2UYN A;  1YHQ F;  2HS3 A;  3KE1 A;  2KGW A;  3S0H A;  3LWQ C;  2K1S A;  4I50 A;  4TV8 A;  3Q8H A;  3JAK B;  2Q1X A;  4C82 A;  1GO0 A;  1VQM F;  3AGK A;  3VYU C;  3HKC A;  4C81 A;  5IJ0 A;  1VQN F;  2RHH A;  2RB9 A;  5HY1 A;  1K73 H;  3MBM A;  1X7P A;  1QU9 A;  3BYQ A;  3OBY A;  4LNU A;  4WBN A;  5LXT A;  1KNJ A;  5CB4 B;  3RYC B;  1CK2 A;  1TVK A;  4NWO B;  5JCO C;  2KTU A;  3HKD A;  4O2B A;  3IR9 A;  3GYQ A;  4I50 B;  1JFF B;  2AIZ P;  1QVF F;  3NMU C;  3CPW F;  4EB6 B;  5LOV A;  1VQ6 F;  5EB0 A;  1W58 1;  2VGM A;  1JD1 A;  3K12 A;  5HP8 A;  2KTV A;  4I4T B;  3C9U A;  3CXC F;  3F0D A;  3JAW B;  4ZOL A;  1U40 A;  1XV2 A;  5LP6 C;  4X1K B;  3VI6 A;  1ODE A;  3C9R A;  3ZP7 A;  3OBW A;  2QI2 A;  3J7A R;  1ZWZ A;  4DXD A;  3RYH A;  1SZQ A;  3B6N A;  3M4S A;  1J7H A;  2MQE A;  4G4Z A;  3HKB A;  4DRX B;  3PLA C;  3PAF A;  5CA0 B;  4C8G A;  3CCL F;  3M1X A;  3ELC A;  3ZOP A;  3RYF B;  1QAH A;  3CG6 A;  2BTQ B;  5FJ4 C;  1KC8 H;  3WGJ A;  4G88 A;  5GIP C;  1GO1 A;  3DC2 A;  4ZHQ B;  3KJK A;  2CHS A;  5EYP B;  5J2T A;  3WPX A;  4F6R B;  1UI9 A;  1W41 A;  4O2B B;  3N2K B;  3FD6 A;  3UT5 B;  2AIF A;  2CVL A;  1Q86 H;  1KNK A;  1YGY A;  2HP3 A;  2OTM A;  4X1I B;  1XBI A;  4BT3 A;  1U43 A;  1OAP A;  3JAL B;  2Q1Y A;  1TVK B;  3JCM M;  3K2X A;  2BTO A;  3ON1 A;  4ZHW A;  1NJI H;  4F6R A;  1W5A A;  1W5F A;  5B8F A;  3NVK E;  5C8Y A;  3N2K A;  3WXM B;  4O4L A;  3JAT B;  1QVG F;  5GAN K;  5IJ0 B;  1X7O A;  1RQ2 A;  5IYZ B;  4G4W A;  2OTJ F;  2DYY A;  1IV2 A;  4C8I A;  4HNA B;  5MN4 A;  3CCR F;  3CMA F;  5JQG A;  1FFX A;  1DT9 A;  2LCA A;  2HRU A;  1OFU A;  3JAL A;  5EO3 A;  5CA1 A;  1JFF A;  3LWO C;  3RYH B;  1Z5V A;  2HRY A;  2W8B C;  2ZOD A;  5HP7 A;  3N2G A;  1W57 A;  1W40 A;  3CD6 F;  3F0G A;  2ZVY A;  3SIV A;  2UYN B;  3QHD A;  3LDT A;  3QUW A;  3WJQ A;  3IEW A;  3C8L A;  4ZHY B;  2QA4 F;  3TD5 A;  4BW0 B;  1NMU B;  2FGY A;  3JAK A;  5JVD A;  3M84 A;  5LP6 A;  3U0O A;  5HXU A;  2CZW A;  1FNK A;  5MN6 A;  3L7Q A;  5EB1 B;  2P6Y A;  1VQ7 F;  2VAW A;  4ZHQ A;  3I7T A;  4C8E A;  2ZAU A;  1FFX B;  1XRG A;  1W3E X;  3D00 A;  3NK7 A;  4X1Y A;  3LWR C;  5EIB C;  1X25 A;  2UZH A;  2HP0 A;  3CCS F;  2HVY D;  2WAL A;  2IG8 A;  1M1K H;  5LA6 B;  2CW4 A;  3F0F A;  3K0T A;  3FPI A;  3CYQ A;  3E22 B;  3HKE B;  3CCU F;  2B33 A;  1SA0 B;  4BT6 A;  3CCJ F;  3CPQ A;  5JQG B;  3CME F;  3JAW A;  4WBN B;  1KQS F;  5HY0 A;  3G6E F;  1VQ4 F;  3JAM M;  3LME A;  2HQS C;  4O4I B;  3VYT C;  2Z01 A;  4X20 A;  5G4V C;  3V4D A;  4O4L B;  1W5B A;  3RA6 A;  1Q81 H;  3N4Y A;  2R6R 1;  5EIB D;  3S03 A;  2HX0 A;  1ONI A;  3T80 A;  1CN7 A;  2YXZ A;  2Z1T A;  1DBF A;  5CA0 A;  3CCQ F;  2OZB A;  2LBT A;  1JJ2 F;  4ZOL B;  4U3J B;  4O4H B;  1IPA A;  3OW2 F;  4YJ3 B;  4B5C A;  5GIN C;  3V7Q A;  1RLG A;  3C9T A;  3V7E A;  2UYJ A;  3RE3 A;  4LCK A;  2VXY A;  1VK3 A;  5LP6 B;  3J81 M;  3R0P A;  2QTP A;  4DRX A;  5ITZ A;  5KX5 A;  2JNB A;  3E22 A;  3JAS A;  3N4Z A;  4LNU B;  5DCV A;  5FNV B;  5LYJ B;  1W5E A;  2CSL A;  1RLU A;  2CHT A;  2HS4 A;  5GAP K;  3D01 A;  3CC2 F;  1H48 A;  1Q8R A;  2RHO A;  3ESJ A;  4EI7 A;  5IT9 M;  3P4E A;  3VIU A;  2LBX A;  4B46 A;  1TUB A;  2BO1 A;  5KMG A;  4EI9 A;  2H8E A;  4TZZ A;  3LWP C;  3F6M A;  4I4T A;  5IYZ A;  3F0E A;  3HKE A;  3EOR A;  1S72 F;  1U3L A;  4ZK7 A;  4RHA A;  1RQ7 A;  4HNA A;  3MQW A;  4U3J A;  3KJJ A;  3S0W A;  3IKF A;  2HP0 B;  3WJP A;  1YQN A;  4YJ3 A;  4C4W C;  3TD3 A;  3HKB B;  5C8Y B;  3O85 A;  4BT5 A;  5LA6 A;  2HS0 A;  3CCM F;  5A2Q M;  2H8C A;  1VQK F;  4BVT A;  1KD1 H;  3VTI C;  5KX5 B;  4TV9 A;  3CCV F;  4PWT A;  2G9I A;  1VQ8 F;  3CYP B;  2PHN A;  4NQ3 A;  2OHW A;  1VQ9 F;  3VO8 A;  1Q7Y H;  1W42 A;  4ZI7 A;  5HXZ A;  1X52 A;  2V9Y A;  3WGN A;  3G71 F;  3ZO8 A;  5CA1 B;  2LBW A;  1VQV A;  3RYI B;  5HY2 A;  2NMU A;  2RHJ A;  3JAT A;  3NVI B;  3C9S A;  3K14 A;  2IAF A;  2OTL F;  1RA4 A;  3G4S F;  2DT4 A;  4IHJ A;  4TV9 B;  2N48 A;  2VGN A;  1VHA A;  3HWU A;  4I55 B;  4ZI7 B;  3QTY A;  3S02 A;  4BVQ A;  1YJ9 F;  3GHZ A;  2VAP A;  3LFO A;  2GVI A;  3LWV C;  2ALE A;  5JH7 B; 
#chains in the Genus database with same CATH homology
 2ZVY A;  3S06 A;  3S03 A;  3LDT A;  3S0W A;  4ZHY B;  2MQE A;  4R40 B;  2L26 A;  4G4Z A;  3WPW A;  3S0H A;  2KGW A;  4G4X A;  3TD5 A;  2LCA A;  2LBT A;  3OON A;  2AIZ P;  3TD3 A;  2K1S A;  3S0Y A;  2ZVZ A;  3CYQ A;  5EB0 A;  1OAP A;  4G4Y A;  2N48 A;  2ZOV A;  4G88 A;  2ZF8 A;  4G4V A;  4ZHV A;  5EB1 B;  4B62 A;  4B5C A;  4PWT A;  4ZHW A;  3KHN A;  3IMP A;  3CYP B;  2HQS C;  2W8B C;  3S02 A;  5EAZ A;  3WPX A;  3TD4 A;  4ERH A;  1R1M A;  4RHA A;  4G4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...