4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
2MQEA 4B62A 3OONA 4RHAA 4G4XA 3S0HA 1OAPA 2K1SA 2AIZP 2LBTA 2W8BC 3WPWA 2ZOVA 3S0YA 3S06A 2HQSC 2ZVZA 5EAZA 4R40B 3CYQA 4G4WA 4ERHA 3CYPB 4G4ZA 3LDTA 5EB0A 3WPXA 3S02A 2ZVYA 4ZHWA 3S03A 2ZF8A 3TD4A 4G88A 3TD3A 4ZHYB 2LCAA 3IMPA 3KHNA 4G4VA 2L26A 4G4YA 4ZHVA 3TD5A 4B5CA 2KGWA 2N48A 4PWTA 5EB1B 3S0WA 1R1MA
chains in the Genus database with same CATH superfamily
1FFXB 2CHTA 3JVHA 3CCEF 4U3JB 3V3TA 3QHDA 3OW2F 3JASA 3IKFA 4BVTA 1W41A 2NMUA 4G4WA 3ESJA 3J80M 1TUBA 3JAKB 3C9UA 4XCQA 5HY2A 4X3MA 3I3FA 4O2AB 2GVIA 2ZF8A 5C8YA 2RHLA 4IIJA 3ZP7A 1QD9A 5LA6A 3KIZA 3JALB 1IV3A 3VI6A 3HTNA 3VO8A 1YJNF 3OBYA 3N4ZA 4LNUB 3WJPA 2Z1EA 3NMUC 3HKBA 3S06A 3K14A 4TV8A 3I7TA 1W5BA 1H7MA 3CYPB 1Z5VA 4ZOLA 3WGNA 3I55F 4TV9B 2OTJF 3QTYA 3CCJF 3K2XA 4X3LA 3VOAA 5BMVA 4FFBB 2UYJA 4ZHQB 3TD4A 1KQSF 4NUTA 2Z1TA 3M1XA 5MN4A 3LWQC 2OZBA 4O4JA 5HXUA 3C9TA 5LYJA 1E7KA 4EB6A 1W5EA 1W55A 5GIPC 3NVKE 1W40A 2K1SA 4BY9D 3CG6A 3IEQA 5EZYA 3I56F 3VOBA 5CA0B 3LYBA 4I4TA 3FBAA 4IHJA 5JCOC 4BVSA 1RQ7A 1RA4A 2VAPA 1VQ6F 3F0EA 5IJ9B 5JVDB 3K12A 5LP6C 4YJ2A 3FD5A 4WBNB 4EI9A 4X1IB 3JARA 2BO1A 1N8RH 4BT3A 2LCAA 3CCMF 3HKDB 4U3JA 3DC2A 1JN1A 3RA6A 1VQOF 2GLZA 3S0HA 1FNJA 3G6EF 4O4IA 3WPWA 2IG8A 3CCLF 1U3PA 3JATA 3CCRF 2RB9A 1VHAA 2H8CA 2VGMA 3S02A 4I50A 3CCVF 1YIJF 2HP0B 4E6EA 5FLXM 2JNBA 2PHNA 2UYNA 3DDNA 3RE3A 3WGLA 1W5FA 4G4VA 2Z1UA 2QTPA 2R751 1R1MA 3HJWC 5LOVA 1YGYA 2OTLF 2H8EA 3BYQA 3D54A 1X7PA 1W3EX 3E22A 1H48A 4O4HA 3IR9A 3D01A 1S72F 5KX5B 3Q8HA 5KMGA 3T80A 1W2BF 1YJWF 1T0KB 2YYEA 3ZOPA 3RYHB 1RQ2A 3CPQA 5A2QM 5J2TA 2Z01A 5DCVA 3HAXD 3KHNA 3P4EA 5EWRA 2KGWA 5EIBD 3GYQA 5EYPA 1CLIA 3K0TA 4C8IA 5IJ9A 2ZVZA 5AVMA 1Z5WA 4B46A 2RHJA 1IV2A 2HS3A 1SDSA 1QVFF 3LDTA 3RYFB 1VQ4F 2EWCA 1YI2F 3R0PA 1M1KH 3IKEA 1Q86H 5FJ4C 3WGJA 3C8LA 3M84A 2CSLA 3U0OA 1VQPF 3N2KB 4BVQA 4C82A 2OTMA 4ZHVA 3V4DA 5EB1B 4B5CA 3RYIA 2P6YA 4LCKA 4M8IA 4X1KA 4BVRA 1XRGA 1VK3A 2GZLA 2HVYD 5CA1B 2VGNA 5LP6B 2QA4F 3FPIA 1KC8H 3FFMA 3G71F 4HNAA 1YJ9F 1DT9A 5J2UB 4X1YA 2ZVYA 4O2BB 5CB4B 4ZK7A 1GO0A 5IYZB 4X20B 3KE1A 3HKEB 2Z1FA 2DT4A 5HP8A 3CB2A 3MCQA 5JQGA 5IJ0B 1GO1A 1W59A 1YHQF 3CMAF 1K73H 2MQEA 3L7QA 1PF5A 2ZODA 4TUYB 3J81M 3JAWB 3ZP4A 1VQLF 4ZI7B 1UFYA 2W8BC 5FNVA 3WJRA 5JH7B 1XBIA 4R40B 1J7HA 1RLGA 1GX1A 4I55A 5HY1A 2VAMA 5EB0A 3CC2F 3HKCA 4RQOA 3WXMB 3RYCA 2HRYA 3MDOA 4YJ3A 3RA5A 3UT5A 3AGKA 3M4SA 1SA0B 1FFXA 5MN5A 2CHSA 1U3LA 1JJ2F 4F6RB 5LXTB 1UI9A 4BT2A 4DRXB 3OONA 3CCUF 1OAPA 1QAHA 3ELCA 2VAWA 3JAKA 1Q82H 3JASB 4O2AA 4O4LB 1IV4A 2CW4A 3GHZA 1TUBB 3JALA 2FC3A 3HWUA 1JFFB 2AMTA 2BTQB 3ERNA 3MCAB 3N2GB 4IIJB 3TD5A 5LA6B 4LNUA 1KNKA 1ZWZA 5CA1A 4RHAA 5GIOC 2LBTA 2HQSC 2HS4A 5EAZA 5J2UA 1VQ9F 1VH8A 2HS0A 4TV9A 3HKBB 4TV8B 5HXZA 3B6NA 3WPXA 4FFBA 4ZHQA 1ODEA 4ZOLB 3LWRC 1GZ0A 2UZHA 3CMEF 5GANK 4EI7A 4G88A 4B45A 3IMPA 5BMVB 1W5AA 1COMA 1YQNA 5GONB 1Q7YH 1M90H 5G4UC 1K9MH 5CA0A 3F0GA 4G4XA 4O4JB 3NK7A 2ZOVA 5LYJB 3VCZA 4EB6B 5B8FA 4C81A 5JVDA 4I4TB 4IHJB 1OFUA 4WBNA 1KD1H 4C8GA 5EO3A 4X1IA 4BW0B 3NK6A 3CCQF 2CZWA 1XV2A 2LBXA 3HKDA 4YJ2B 3CPWF 3D00A 3JARB 5HY4A 1X25A 4PWTA 2YXZA 2LBWA 3CXCF 2ZAUA 4BT7A 1VQVA 3MQWA 4O4LA 4O4IB 3CYQA 3SIVA 2HP0A 3CC7F 4BT5A 5HP7A 1W581 3JATB 2VXYA 3VMFB 1QVGF 3V7EA 1JFFA 2V9YA 1Q8RA 4NQ3A 3JCMM 4I50B 3N2GA 2RHOA 3GTZA 2OHWA 4ZHYB 1DBFA 3S0WA 3F0FA 2I6RA 2UYNB 3WGMA 2KG4A 1ONIA 3PLAC 1CN7A 1VQNF 2I6DA 1JD1A 5LOVB 1W57A 1IPAA 5KX5A 1FNKA 2UYPA 1VQKF 3E22B 3G4SF 1X52A 4O4HB 1NMUB 2QEXF 2G9IA 3F6MA 3RYHA 4ZHWA 5ITZB 3IEWA 5EIBC 3S03A 1K8AH 1YITF 5KMGB 5GONA 3SIUA 1VQ8F 3J7AR 3P10A 2BTOA 2RHHA 5J2TB 1RLUA 2BTUA 3C9RA 3LWOC 4B62A 1T0AA 3CD6F 4KWEA 1TVKB 3NVIB 3OBWA 1JY8A 1PXWA 1VQ5F 2R6R1 3S0YA 4DXDA 4BT6A 2CVLA 2F9ZC 5EYPB 3RYFA 3KJKA 4TZZA 2PMPA 1W42A 4ERHA 2H6LA 2KTUA 1Q81H 1VQMF 3LMEA 5MN6A 1FSZA 3N2KA 3QUWA 5JCOA 2DYYA 3FD6A 2L26A 2Q1YA 4G4YA 2N48A 5C8YB 3N4YA 3E20B 4BT4A 2UYKA 1H47A 5HWEA 5LP6A 3ON1A 2AIZP 3RYIB 2WALA 3F0DA 3VIUA 1U43A 4X1KB 4EI8A 2HP3A 2B33A 4O2BA 5CB4A 3ZO8A 5G4VC 1SZQA 5IYZA 4X20A 1NJIH 2QI2A 3HKEA 3LWPC 1KNJA 4HNAB 2IQQA 3O85A 3C9SA 5IJ0A 4X1YB 3VYSC 3VYTC 2HRUA 2CWJA 3TD3A 3E1YA 3P0ZA 3VYUC 4TUYA 1U40A 3JAWA 4ZI7A 4C8EA 2AIFA 1VQ7F 5JQGB 5JH7A 1X7OA 3WJQA 5GINC 3EORA 1CK2A 2ALEA 3VTIC 5FNVB 3JAMM 4U39A 5ITZA 5EZYB 2HX0A 4G4ZA 2FGYA 4NWOB 4I55B 1QU9A 5IT9M 1XHOA 5HY0A 1SA0A 3HKCB 3LFOA 2IAFA 4C4WC 3KJJA 3CCSF 3RYCB 3LWVC 3V7QA 4YJ3B 3CC4F 4F6RA 5LXTA 2KTVA 3WGKA 1TVKA 1NQ3A 4DRXA 5GAPK 3MBMA 3PAFA 2Q1XA 3UT5B 1IV1A
chains in the Genus database with same CATH topology
2MQEA 4B62A 3OONA 4RHAA 4G4XA 3S0HA 1OAPA 2K1SA 2AIZP 2LBTA 2W8BC 3WPWA 2ZOVA 3S0YA 3S06A 2HQSC 2ZVZA 5EAZA 4R40B 3CYQA 4G4WA 4ERHA 3CYPB 4G4ZA 3LDTA 5EB0A 3WPXA 3S02A 2ZVYA 4ZHWA 3S03A 2ZF8A 3TD4A 4G88A 3TD3A 4ZHYB 2LCAA 3IMPA 3KHNA 4G4VA 2L26A 4G4YA 4ZHVA 3TD5A 4B5CA 2KGWA 2N48A 4PWTA 5EB1B 3S0WA 1R1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MQE A;  4B62 A;  3OON A;  4RHA A;  4G4X A;  3S0H A;  1OAP A;  2K1S A;  2AIZ P;  2LBT A;  2W8B C;  3WPW A;  2ZOV A;  3S0Y A;  3S06 A;  2HQS C;  2ZVZ A;  5EAZ A;  4R40 B;  3CYQ A;  4G4W A;  4ERH A;  3CYP B;  4G4Z A;  3LDT A;  5EB0 A;  3WPX A;  3S02 A;  2ZVY A;  4ZHW A;  3S03 A;  2ZF8 A;  3TD4 A;  4G88 A;  3TD3 A;  4ZHY B;  2LCA A;  3IMP A;  3KHN A;  4G4V A;  2L26 A;  4G4Y A;  4ZHV A;  3TD5 A;  4B5C A;  2KGW A;  2N48 A;  4PWT A;  5EB1 B;  3S0W A;  1R1M A; 
#chains in the Genus database with same CATH topology
 1FFX B;  2CHT A;  3JVH A;  3CCE F;  4U3J B;  3V3T A;  3QHD A;  3OW2 F;  3JAS A;  3IKF A;  4BVT A;  1W41 A;  2NMU A;  4G4W A;  3ESJ A;  3J80 M;  1TUB A;  3JAK B;  3C9U A;  4XCQ A;  5HY2 A;  4X3M A;  3I3F A;  4O2A B;  2GVI A;  2ZF8 A;  5C8Y A;  2RHL A;  4IIJ A;  3ZP7 A;  1QD9 A;  5LA6 A;  3KIZ A;  3JAL B;  1IV3 A;  3VI6 A;  3HTN A;  3VO8 A;  1YJN F;  3OBY A;  3N4Z A;  4LNU B;  3WJP A;  2Z1E A;  3NMU C;  3HKB A;  3S06 A;  3K14 A;  4TV8 A;  3I7T A;  1W5B A;  1H7M A;  3CYP B;  1Z5V A;  4ZOL A;  3WGN A;  3I55 F;  4TV9 B;  2OTJ F;  3QTY A;  3CCJ F;  3K2X A;  4X3L A;  3VOA A;  5BMV A;  4FFB B;  2UYJ A;  4ZHQ B;  3TD4 A;  1KQS F;  4NUT A;  2Z1T A;  3M1X A;  5MN4 A;  3LWQ C;  2OZB A;  4O4J A;  5HXU A;  3C9T A;  5LYJ A;  1E7K A;  4EB6 A;  1W5E A;  1W55 A;  5GIP C;  3NVK E;  1W40 A;  2K1S A;  4BY9 D;  3CG6 A;  3IEQ A;  5EZY A;  3I56 F;  3VOB A;  5CA0 B;  3LYB A;  4I4T A;  3FBA A;  4IHJ A;  5JCO C;  4BVS A;  1RQ7 A;  1RA4 A;  2VAP A;  1VQ6 F;  3F0E A;  5IJ9 B;  5JVD B;  3K12 A;  5LP6 C;  4YJ2 A;  3FD5 A;  4WBN B;  4EI9 A;  4X1I B;  3JAR A;  2BO1 A;  1N8R H;  4BT3 A;  2LCA A;  3CCM F;  3HKD B;  4U3J A;  3DC2 A;  1JN1 A;  3RA6 A;  1VQO F;  2GLZ A;  3S0H A;  1FNJ A;  3G6E F;  4O4I A;  3WPW A;  2IG8 A;  3CCL F;  1U3P A;  3JAT A;  3CCR F;  2RB9 A;  1VHA A;  2H8C A;  2VGM A;  3S02 A;  4I50 A;  3CCV F;  1YIJ F;  2HP0 B;  4E6E A;  5FLX M;  2JNB A;  2PHN A;  2UYN A;  3DDN A;  3RE3 A;  3WGL A;  1W5F A;  4G4V A;  2Z1U A;  2QTP A;  2R75 1;  1R1M A;  3HJW C;  5LOV A;  1YGY A;  2OTL F;  2H8E A;  3BYQ A;  3D54 A;  1X7P A;  1W3E X;  3E22 A;  1H48 A;  4O4H A;  3IR9 A;  3D01 A;  1S72 F;  5KX5 B;  3Q8H A;  5KMG A;  3T80 A;  1W2B F;  1YJW F;  1T0K B;  2YYE A;  3ZOP A;  3RYH B;  1RQ2 A;  3CPQ A;  5A2Q M;  5J2T A;  2Z01 A;  5DCV A;  3HAX D;  3KHN A;  3P4E A;  5EWR A;  2KGW A;  5EIB D;  3GYQ A;  5EYP A;  1CLI A;  3K0T A;  4C8I A;  5IJ9 A;  2ZVZ A;  5AVM A;  1Z5W A;  4B46 A;  2RHJ A;  1IV2 A;  2HS3 A;  1SDS A;  1QVF F;  3LDT A;  3RYF B;  1VQ4 F;  2EWC A;  1YI2 F;  3R0P A;  1M1K H;  3IKE A;  1Q86 H;  5FJ4 C;  3WGJ A;  3C8L A;  3M84 A;  2CSL A;  3U0O A;  1VQP F;  3N2K B;  4BVQ A;  4C82 A;  2OTM A;  4ZHV A;  3V4D A;  5EB1 B;  4B5C A;  3RYI A;  2P6Y A;  4LCK A;  4M8I A;  4X1K A;  4BVR A;  1XRG A;  1VK3 A;  2GZL A;  2HVY D;  5CA1 B;  2VGN A;  5LP6 B;  2QA4 F;  3FPI A;  1KC8 H;  3FFM A;  3G71 F;  4HNA A;  1YJ9 F;  1DT9 A;  5J2U B;  4X1Y A;  2ZVY A;  4O2B B;  5CB4 B;  4ZK7 A;  1GO0 A;  5IYZ B;  4X20 B;  3KE1 A;  3HKE B;  2Z1F A;  2DT4 A;  5HP8 A;  3CB2 A;  3MCQ A;  5JQG A;  5IJ0 B;  1GO1 A;  1W59 A;  1YHQ F;  3CMA F;  1K73 H;  2MQE A;  3L7Q A;  1PF5 A;  2ZOD A;  4TUY B;  3J81 M;  3JAW B;  3ZP4 A;  1VQL F;  4ZI7 B;  1UFY A;  2W8B C;  5FNV A;  3WJR A;  5JH7 B;  1XBI A;  4R40 B;  1J7H A;  1RLG A;  1GX1 A;  4I55 A;  5HY1 A;  2VAM A;  5EB0 A;  3CC2 F;  3HKC A;  4RQO A;  3WXM B;  3RYC A;  2HRY A;  3MDO A;  4YJ3 A;  3RA5 A;  3UT5 A;  3AGK A;  3M4S A;  1SA0 B;  1FFX A;  5MN5 A;  2CHS A;  1U3L A;  1JJ2 F;  4F6R B;  5LXT B;  1UI9 A;  4BT2 A;  4DRX B;  3OON A;  3CCU F;  1OAP A;  1QAH A;  3ELC A;  2VAW A;  3JAK A;  1Q82 H;  3JAS B;  4O2A A;  4O4L B;  1IV4 A;  2CW4 A;  3GHZ A;  1TUB B;  3JAL A;  2FC3 A;  3HWU A;  1JFF B;  2AMT A;  2BTQ B;  3ERN A;  3MCA B;  3N2G B;  4IIJ B;  3TD5 A;  5LA6 B;  4LNU A;  1KNK A;  1ZWZ A;  5CA1 A;  4RHA A;  5GIO C;  2LBT A;  2HQS C;  2HS4 A;  5EAZ A;  5J2U A;  1VQ9 F;  1VH8 A;  2HS0 A;  4TV9 A;  3HKB B;  4TV8 B;  5HXZ A;  3B6N A;  3WPX A;  4FFB A;  4ZHQ A;  1ODE A;  4ZOL B;  3LWR C;  1GZ0 A;  2UZH A;  3CME F;  5GAN K;  4EI7 A;  4G88 A;  4B45 A;  3IMP A;  5BMV B;  1W5A A;  1COM A;  1YQN A;  5GON B;  1Q7Y H;  1M90 H;  5G4U C;  1K9M H;  5CA0 A;  3F0G A;  4G4X A;  4O4J B;  3NK7 A;  2ZOV A;  5LYJ B;  3VCZ A;  4EB6 B;  5B8F A;  4C81 A;  5JVD A;  4I4T B;  4IHJ B;  1OFU A;  4WBN A;  1KD1 H;  4C8G A;  5EO3 A;  4X1I A;  4BW0 B;  3NK6 A;  3CCQ F;  2CZW A;  1XV2 A;  2LBX A;  3HKD A;  4YJ2 B;  3CPW F;  3D00 A;  3JAR B;  5HY4 A;  1X25 A;  4PWT A;  2YXZ A;  2LBW A;  3CXC F;  2ZAU A;  4BT7 A;  1VQV A;  3MQW A;  4O4L A;  4O4I B;  3CYQ A;  3SIV A;  2HP0 A;  3CC7 F;  4BT5 A;  5HP7 A;  1W58 1;  3JAT B;  2VXY A;  3VMF B;  1QVG F;  3V7E A;  1JFF A;  2V9Y A;  1Q8R A;  4NQ3 A;  3JCM M;  4I50 B;  3N2G A;  2RHO A;  3GTZ A;  2OHW A;  4ZHY B;  1DBF A;  3S0W A;  3F0F A;  2I6R A;  2UYN B;  3WGM A;  2KG4 A;  1ONI A;  3PLA C;  1CN7 A;  1VQN F;  2I6D A;  1JD1 A;  5LOV B;  1W57 A;  1IPA A;  5KX5 A;  1FNK A;  2UYP A;  1VQK F;  3E22 B;  3G4S F;  1X52 A;  4O4H B;  1NMU B;  2QEX F;  2G9I A;  3F6M A;  3RYH A;  4ZHW A;  5ITZ B;  3IEW A;  5EIB C;  3S03 A;  1K8A H;  1YIT F;  5KMG B;  5GON A;  3SIU A;  1VQ8 F;  3J7A R;  3P10 A;  2BTO A;  2RHH A;  5J2T B;  1RLU A;  2BTU A;  3C9R A;  3LWO C;  4B62 A;  1T0A A;  3CD6 F;  4KWE A;  1TVK B;  3NVI B;  3OBW A;  1JY8 A;  1PXW A;  1VQ5 F;  2R6R 1;  3S0Y A;  4DXD A;  4BT6 A;  2CVL A;  2F9Z C;  5EYP B;  3RYF A;  3KJK A;  4TZZ A;  2PMP A;  1W42 A;  4ERH A;  2H6L A;  2KTU A;  1Q81 H;  1VQM F;  3LME A;  5MN6 A;  1FSZ A;  3N2K A;  3QUW A;  5JCO A;  2DYY A;  3FD6 A;  2L26 A;  2Q1Y A;  4G4Y A;  2N48 A;  5C8Y B;  3N4Y A;  3E20 B;  4BT4 A;  2UYK A;  1H47 A;  5HWE A;  5LP6 A;  3ON1 A;  2AIZ P;  3RYI B;  2WAL A;  3F0D A;  3VIU A;  1U43 A;  4X1K B;  4EI8 A;  2HP3 A;  2B33 A;  4O2B A;  5CB4 A;  3ZO8 A;  5G4V C;  1SZQ A;  5IYZ A;  4X20 A;  1NJI H;  2QI2 A;  3HKE A;  3LWP C;  1KNJ A;  4HNA B;  2IQQ A;  3O85 A;  3C9S A;  5IJ0 A;  4X1Y B;  3VYS C;  3VYT C;  2HRU A;  2CWJ A;  3TD3 A;  3E1Y A;  3P0Z A;  3VYU C;  4TUY A;  1U40 A;  3JAW A;  4ZI7 A;  4C8E A;  2AIF A;  1VQ7 F;  5JQG B;  5JH7 A;  1X7O A;  3WJQ A;  5GIN C;  3EOR A;  1CK2 A;  2ALE A;  3VTI C;  5FNV B;  3JAM M;  4U39 A;  5ITZ A;  5EZY B;  2HX0 A;  4G4Z A;  2FGY A;  4NWO B;  4I55 B;  1QU9 A;  5IT9 M;  1XHO A;  5HY0 A;  1SA0 A;  3HKC B;  3LFO A;  2IAF A;  4C4W C;  3KJJ A;  3CCS F;  3RYC B;  3LWV C;  3V7Q A;  4YJ3 B;  3CC4 F;  4F6R A;  5LXT A;  2KTV A;  3WGK A;  1TVK A;  1NQ3 A;  4DRX A;  5GAP K;  3MBM A;  3PAF A;  2Q1X A;  3UT5 B;  1IV1 A; 
#chains in the Genus database with same CATH homology
 2MQE A;  4B62 A;  3OON A;  4RHA A;  4G4X A;  3S0H A;  1OAP A;  2K1S A;  2AIZ P;  2LBT A;  2W8B C;  3WPW A;  2ZOV A;  3S0Y A;  3S06 A;  2HQS C;  2ZVZ A;  5EAZ A;  4R40 B;  3CYQ A;  4G4W A;  4ERH A;  3CYP B;  4G4Z A;  3LDT A;  5EB0 A;  3WPX A;  3S02 A;  2ZVY A;  4ZHW A;  3S03 A;  2ZF8 A;  3TD4 A;  4G88 A;  3TD3 A;  4ZHY B;  2LCA A;  3IMP A;  3KHN A;  4G4V A;  2L26 A;  4G4Y A;  4ZHV A;  3TD5 A;  4B5C A;  2KGW A;  2N48 A;  4PWT A;  5EB1 B;  3S0W A;  1R1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...