4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
3OONA 4G4WA 2LCAA 3KHNA 3LDTA 3CYQA 4G88A 3TD3A 4RHAA 3S06A 2ZOVA 3WPWA 3S03A 2ZF8A 2ZVZA 4G4XA 3S0YA 2N48A 2MQEA 2W8BC 4B5CA 4ZHYB 3CYPB 3S0HA 2AIZP 4G4YA 2KGWA 5EB0A 2LBTA 4B62A 4R40B 4ZHWA 3S02A 2ZVYA 5EAZA 3S0WA 3IMPA 4G4ZA 2K1SA 1OAPA 5EB1B 2L26A 3WPXA 1R1MA 2HQSC 3TD4A 4ERHA 4G4VA 4PWTA 4ZHVA 3TD5A
chains in the Genus database with same CATH superfamily
4HNAB 3KIZA 1VQVA 2HS3A 3KHNA 3FD5A 4IIJB 3RE3A 5IJ0A 3TD3A 2UYKA 2EWCA 3RYHA 3G6EF 3CCQF 3CC4F 3F0GA 4X20B 1TUBB 3V4DA 4BW0B 1VQ5F 2LBTA 4ZHWA 5HY0A 5B8FA 3K12A 2RHOA 1NJIH 5HY4A 4X1YA 3OW2F 3JAKB 2KTUA 1FNJA 4ZOLA 4C81A 4BVRA 1U43A 2OZBA 1UI9A 1W5BA 3JAMM 3CC2F 3CCMF 1YJWF 2HVYD 3KE1A 3I7TA 5EIBD 3OONA 5JVDA 3CMEF 1VK3A 3CG6A 1VQPF 4X1KA 5C8YA 1RLUA 3JALB 3PAFA 5CA0B 1Q86H 3S0YA 1CK2A 3M1XA 3NVKE 4KWEA 3UT5B 5LOVA 1K9MH 3S0WA 2ALEA 5EZYA 1YJNF 5EB1B 5HY1A 2LBWA 4XCQA 1W57A 5KX5A 1E7KA 3LYBA 3TD4A 5JCOC 4I4TB 1IV4A 1RA4A 3F0EA 2LCAA 5KMGA 3F0FA 2HX0A 3ON1A 5LYJB 4O4IA 2JNBA 4TV8B 2LBXA 3VIUA 3RYCA 1N8RH 5A2QM 1PXWA 4EI7A 2Z1TA 1VQ6F 3MCQA 1OFUA 3CPQA 1YI2F 5CB4B 3JATB 1X25A 3VMFB 3ZP7A 3I55F 1CLIA 4WBNA 3GYQA 2UZHA 3MQWA 3WJPA 1QAHA 3JAKA 1QU9A 2RHHA 5EWRA 3E22A 4BT6A 3JARA 5J2UB 5ITZA 4G4XA 3V3TA 1W3EX 5FLXM 2QEXF 3HKDA 4B5CA 2CZWA 4TUYB 4NUTA 1COMA 3CYPB 4X20A 1VQ7F 2CHSA 5HXZA 3IEQA 1J7HA 1CN7A 4I50B 3G4SF 3J81M 5EYPA 1GZ0A 1ODEA 3D00A 3P10A 3WGNA 4PWTA 2PMPA 1YJ9F 3M4SA 4C8IA 3P0ZA 3CYQA 3RYFB 1H7MA 2Q1YA 5FJ4C 4O4JB 5CA1A 1JFFB 3VI6A 5MN6A 3PLAC 5IT9M 2MQEA 3CCUF 1YGYA 4B45A 3RYFA 3HKDB 2Z1FA 3J80M 2VXYA 1VQ8F 3RA5A 2HP0B 1XV2A 2UYJA 3RYIB 5LP6C 3WGLA 3C9SA 4BVTA 3UT5A 3E20B 1W2BF 4NQ3A 4ZK7A 1Q81H 1VQNF 2H8CA 3BYQA 3LFOA 3KJKA 4BT7A 2W8BC 3E1YA 4TV9B 3ZOPA 2HS4A 4FFBA 4YJ3A 3LWQC 2P6YA 1M90H 3ELCA 4TV8A 5LYJA 2UYPA 1KNJA 2CVLA 1UFYA 1Q82H 3V7EA 2L26A 2UYNA 3NK6A 1Z5WA 5JH7A 4O2BA 5LA6B 1KQSF 2Z1EA 1KNKA 3V7QA 5MN4A 3CCVF 3FPIA 3TD5A 5LP6A 3CD6F 1H48A 1FNKA 3LDTA 3WJRA 4TZZA 3K14A 5FNVA 3JCMM 2BTOA 2ZVZA 3O85A 3L7QA 4YJ2B 3P4EA 3GTZA 4BT5A 2GLZA 2KTVA 4O4LA 3R0PA 2HP0A 3JAWB 1K8AH 2HS0A 1R1MA 3C9TA 3K2XA 3DC2A 2HP3A 2IQQA 5GAPK 3CCJF 4I50A 4NWOB 2OTLF 4O4LB 5IYZB 4C8GA 3N4YA 3QTYA 3N2GA 5EYPB 1FFXA 1ONIA 1SZQA 4ZOLB 5JQGB 1K73H 3GHZA 1DT9A 5GONB 1W55A 2QI2A 3RYCB 4RQOA 4BT4A 1KC8H 2VAWA 1GO0A 4BT3A 2ZODA 3D54A 4TUYA 4O4HB 1Q8RA 5EB0A 4DXDA 4EI9A 1VHAA 1TUBA 5BMVB 5LXTA 3S02A 3LWVC 4O4JA 1PF5A 5GANK 3QUWA 3HJWC 2DT4A 3HKEB 3N4ZA 2CHTA 2FGYA 4M8IA 3F0DA 4B46A 2HQSC 3CMAF 4G4VA 2IG8A 4E6EA 3B6NA 4BVQA 4ZHVA 2QA4F 4BT2A 2PHNA 2VGMA 5G4VC 3G71F 5IJ9A 2H8EA 1VQOF 4O4IB 4BVSA 4O4HA 3DDNA 3CC7F 3HKCA 5HY2A 3N2KA 1IV3A 2AIZP 2FC3A 1KD1H 2BTQB 5IJ9B 4EI8A 3OBYA 1FFXB 3LWRC 2Z1UA 4X3LA 5KX5B 3RYIA 3I3FA 3JVHA 4I4TA 4ERHA 1T0AA 2AMTA 2OTJF 5LA6A 3JAWA 2CSLA 4LCKA 1RLGA 2WALA 1W40A 3WJQA 2ZAUA 3VCZA 3CPWF 1Q7YH 4X1IA 3WPWA 3IKEA 2BO1A 4FFBB 5JVDB 2KGWA 3Q8HA 3LWOC 3VYUC 2RB9A 3E22B 5JQGA 3M84A 3CB2A 3IMPA 2B33A 3HKBA 5KMGB 3HAXD 1ZWZA 4WBNB 1W5AA 1U3PA 3K0TA 5G4UC 4G88A 2CW4A 3JATA 1XHOA 3KJJA 2IAFA 1XBIA 3C9UA 4IHJA 5GINC 4ZHQB 2ZF8A 2F9ZC 2N48A 1S72F 3CCLF 1FSZA 5IJ0B 4G4YA 5GONA 5GIOC 1U40A 2QTPA 3N2GB 1QVFF 1W5FA 2I6DA 2OTMA 3T80A 3IEWA 1QD9A 2G9IA 2R751 3NVIB 1QVGF 1JN1A 3HKBB 2OHWA 2UYNB 2CWJA 5CB4A 3CXCF 2BTUA 1YIJF 1TVKB 1W41A 2NMUA 1IV1A 4X1YB 2ZOVA 3S03A 2RHLA 3VYTC 4ZHQA 3JASA 4LNUB 4IHJB 4BY9D 1JFFA 1VQLF 1TVKA 4X1IB 2ZVYA 3SIVA 3RYHB 1JD1A 5ITZB 3VO8A 3ESJA 3FD6A 3LMEA 1JY8A 4DRXB 5EO3A 1H47A 1VQ9F 2DYYA 3J7AR 3C9RA 2VAMA 1SA0A 3QHDA 3VOBA 2YXZA 5HP7A 2HRUA 4YJ3B 5BMVA 5LXTB 1X7PA 4TV9A 4U39A 4X1KB 1W59A 3I56F 1SDSA 1RQ2A 3JASB 4LNUA 3HTNA 3C8LA 2Q1XA 4U3JB 3ZP4A 5J2UA 3SIUA 5DCVA 1W42A 1XRGA 2K1SA 3CCEF 1GO1A 3ERNA 3U0OA 3HWUA 1W581 1RQ7A 1X7OA 3D01A 1IPAA 1NMUB 1X52A 3NK7A 3HKEA 4G4WA 5HP8A 2GZLA 4X3MA 3WGMA 3FFMA 1VQMF 5EZYB 3HKCB 4RHAA 3MBMA 2I6RA 4ZI7A 5CA1B 5EIBC 5EAZA 3MDOA 5C8YB 2HRYA 5IYZA 1OAPA 4F6RA 1W5EA 1NQ3A 3VTIC 1IV2A 1VQ4F 3IKFA 1Z5VA 3ZO8A 3WXMB 3N2KB 5JCOA 5J2TB 5AVMA 1U3LA 4I55A 5LOVB 4O2AB 3OBWA 1DBFA 1YQNA 2KG4A 1T0KB 1GX1A 5GIPC 3JARB 3JALA 5CA0A 4B62A 1VH8A 1SA0B 2AIFA 2YYEA 3AGKA 4C8EA 3IR9A 1YHQF 4G4ZA 3VYSC 5HWEA 3EORA 3NMUC 2VGNA 3WPXA 4C4WC 1VQKF 4HNAA 3FBAA 5JH7B 4EB6B 3CCRF 2H6LA 3MCAB 3LWPC 3CCSF 4DRXA 2GVIA 3F6MA 3WGJA 3S06A 4YJ2A 1JJ2F 4U3JA 4O2AA 2RHJA 3WGKA 4I55B 4ZHYB 5MN5A 1YITF 3RA6A 4ZI7B 5FNVB 1M1KH 5J2TA 2VAPA 3S0HA 2V9YA 4R40B 3VOAA 5HXUA 4C82A 5LP6B 2R6R1 4IIJA 4F6RB 4O2BB 2Z01A 4EB6A
chains in the Genus database with same CATH topology
3OONA 4G4WA 2LCAA 3KHNA 3LDTA 3CYQA 4G88A 3TD3A 4RHAA 3S06A 2ZOVA 3WPWA 3S03A 2ZF8A 2ZVZA 4G4XA 3S0YA 2N48A 2MQEA 2W8BC 4B5CA 4ZHYB 3CYPB 3S0HA 2AIZP 4G4YA 2KGWA 5EB0A 2LBTA 4B62A 4R40B 4ZHWA 3S02A 2ZVYA 5EAZA 3S0WA 3IMPA 4G4ZA 2K1SA 1OAPA 5EB1B 2L26A 3WPXA 1R1MA 2HQSC 3TD4A 4ERHA 4G4VA 4PWTA 4ZHVA 3TD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OON A;  4G4W A;  2LCA A;  3KHN A;  3LDT A;  3CYQ A;  4G88 A;  3TD3 A;  4RHA A;  3S06 A;  2ZOV A;  3WPW A;  3S03 A;  2ZF8 A;  2ZVZ A;  4G4X A;  3S0Y A;  2N48 A;  2MQE A;  2W8B C;  4B5C A;  4ZHY B;  3CYP B;  3S0H A;  2AIZ P;  4G4Y A;  2KGW A;  5EB0 A;  2LBT A;  4B62 A;  4R40 B;  4ZHW A;  3S02 A;  2ZVY A;  5EAZ A;  3S0W A;  3IMP A;  4G4Z A;  2K1S A;  1OAP A;  5EB1 B;  2L26 A;  3WPX A;  1R1M A;  2HQS C;  3TD4 A;  4ERH A;  4G4V A;  4PWT A;  4ZHV A;  3TD5 A; 
#chains in the Genus database with same CATH topology
 4HNA B;  3KIZ A;  1VQV A;  2HS3 A;  3KHN A;  3FD5 A;  4IIJ B;  3RE3 A;  5IJ0 A;  3TD3 A;  2UYK A;  2EWC A;  3RYH A;  3G6E F;  3CCQ F;  3CC4 F;  3F0G A;  4X20 B;  1TUB B;  3V4D A;  4BW0 B;  1VQ5 F;  2LBT A;  4ZHW A;  5HY0 A;  5B8F A;  3K12 A;  2RHO A;  1NJI H;  5HY4 A;  4X1Y A;  3OW2 F;  3JAK B;  2KTU A;  1FNJ A;  4ZOL A;  4C81 A;  4BVR A;  1U43 A;  2OZB A;  1UI9 A;  1W5B A;  3JAM M;  3CC2 F;  3CCM F;  1YJW F;  2HVY D;  3KE1 A;  3I7T A;  5EIB D;  3OON A;  5JVD A;  3CME F;  1VK3 A;  3CG6 A;  1VQP F;  4X1K A;  5C8Y A;  1RLU A;  3JAL B;  3PAF A;  5CA0 B;  1Q86 H;  3S0Y A;  1CK2 A;  3M1X A;  3NVK E;  4KWE A;  3UT5 B;  5LOV A;  1K9M H;  3S0W A;  2ALE A;  5EZY A;  1YJN F;  5EB1 B;  5HY1 A;  2LBW A;  4XCQ A;  1W57 A;  5KX5 A;  1E7K A;  3LYB A;  3TD4 A;  5JCO C;  4I4T B;  1IV4 A;  1RA4 A;  3F0E A;  2LCA A;  5KMG A;  3F0F A;  2HX0 A;  3ON1 A;  5LYJ B;  4O4I A;  2JNB A;  4TV8 B;  2LBX A;  3VIU A;  3RYC A;  1N8R H;  5A2Q M;  1PXW A;  4EI7 A;  2Z1T A;  1VQ6 F;  3MCQ A;  1OFU A;  3CPQ A;  1YI2 F;  5CB4 B;  3JAT B;  1X25 A;  3VMF B;  3ZP7 A;  3I55 F;  1CLI A;  4WBN A;  3GYQ A;  2UZH A;  3MQW A;  3WJP A;  1QAH A;  3JAK A;  1QU9 A;  2RHH A;  5EWR A;  3E22 A;  4BT6 A;  3JAR A;  5J2U B;  5ITZ A;  4G4X A;  3V3T A;  1W3E X;  5FLX M;  2QEX F;  3HKD A;  4B5C A;  2CZW A;  4TUY B;  4NUT A;  1COM A;  3CYP B;  4X20 A;  1VQ7 F;  2CHS A;  5HXZ A;  3IEQ A;  1J7H A;  1CN7 A;  4I50 B;  3G4S F;  3J81 M;  5EYP A;  1GZ0 A;  1ODE A;  3D00 A;  3P10 A;  3WGN A;  4PWT A;  2PMP A;  1YJ9 F;  3M4S A;  4C8I A;  3P0Z A;  3CYQ A;  3RYF B;  1H7M A;  2Q1Y A;  5FJ4 C;  4O4J B;  5CA1 A;  1JFF B;  3VI6 A;  5MN6 A;  3PLA C;  5IT9 M;  2MQE A;  3CCU F;  1YGY A;  4B45 A;  3RYF A;  3HKD B;  2Z1F A;  3J80 M;  2VXY A;  1VQ8 F;  3RA5 A;  2HP0 B;  1XV2 A;  2UYJ A;  3RYI B;  5LP6 C;  3WGL A;  3C9S A;  4BVT A;  3UT5 A;  3E20 B;  1W2B F;  4NQ3 A;  4ZK7 A;  1Q81 H;  1VQN F;  2H8C A;  3BYQ A;  3LFO A;  3KJK A;  4BT7 A;  2W8B C;  3E1Y A;  4TV9 B;  3ZOP A;  2HS4 A;  4FFB A;  4YJ3 A;  3LWQ C;  2P6Y A;  1M90 H;  3ELC A;  4TV8 A;  5LYJ A;  2UYP A;  1KNJ A;  2CVL A;  1UFY A;  1Q82 H;  3V7E A;  2L26 A;  2UYN A;  3NK6 A;  1Z5W A;  5JH7 A;  4O2B A;  5LA6 B;  1KQS F;  2Z1E A;  1KNK A;  3V7Q A;  5MN4 A;  3CCV F;  3FPI A;  3TD5 A;  5LP6 A;  3CD6 F;  1H48 A;  1FNK A;  3LDT A;  3WJR A;  4TZZ A;  3K14 A;  5FNV A;  3JCM M;  2BTO A;  2ZVZ A;  3O85 A;  3L7Q A;  4YJ2 B;  3P4E A;  3GTZ A;  4BT5 A;  2GLZ A;  2KTV A;  4O4L A;  3R0P A;  2HP0 A;  3JAW B;  1K8A H;  2HS0 A;  1R1M A;  3C9T A;  3K2X A;  3DC2 A;  2HP3 A;  2IQQ A;  5GAP K;  3CCJ F;  4I50 A;  4NWO B;  2OTL F;  4O4L B;  5IYZ B;  4C8G A;  3N4Y A;  3QTY A;  3N2G A;  5EYP B;  1FFX A;  1ONI A;  1SZQ A;  4ZOL B;  5JQG B;  1K73 H;  3GHZ A;  1DT9 A;  5GON B;  1W55 A;  2QI2 A;  3RYC B;  4RQO A;  4BT4 A;  1KC8 H;  2VAW A;  1GO0 A;  4BT3 A;  2ZOD A;  3D54 A;  4TUY A;  4O4H B;  1Q8R A;  5EB0 A;  4DXD A;  4EI9 A;  1VHA A;  1TUB A;  5BMV B;  5LXT A;  3S02 A;  3LWV C;  4O4J A;  1PF5 A;  5GAN K;  3QUW A;  3HJW C;  2DT4 A;  3HKE B;  3N4Z A;  2CHT A;  2FGY A;  4M8I A;  3F0D A;  4B46 A;  2HQS C;  3CMA F;  4G4V A;  2IG8 A;  4E6E A;  3B6N A;  4BVQ A;  4ZHV A;  2QA4 F;  4BT2 A;  2PHN A;  2VGM A;  5G4V C;  3G71 F;  5IJ9 A;  2H8E A;  1VQO F;  4O4I B;  4BVS A;  4O4H A;  3DDN A;  3CC7 F;  3HKC A;  5HY2 A;  3N2K A;  1IV3 A;  2AIZ P;  2FC3 A;  1KD1 H;  2BTQ B;  5IJ9 B;  4EI8 A;  3OBY A;  1FFX B;  3LWR C;  2Z1U A;  4X3L A;  5KX5 B;  3RYI A;  3I3F A;  3JVH A;  4I4T A;  4ERH A;  1T0A A;  2AMT A;  2OTJ F;  5LA6 A;  3JAW A;  2CSL A;  4LCK A;  1RLG A;  2WAL A;  1W40 A;  3WJQ A;  2ZAU A;  3VCZ A;  3CPW F;  1Q7Y H;  4X1I A;  3WPW A;  3IKE A;  2BO1 A;  4FFB B;  5JVD B;  2KGW A;  3Q8H A;  3LWO C;  3VYU C;  2RB9 A;  3E22 B;  5JQG A;  3M84 A;  3CB2 A;  3IMP A;  2B33 A;  3HKB A;  5KMG B;  3HAX D;  1ZWZ A;  4WBN B;  1W5A A;  1U3P A;  3K0T A;  5G4U C;  4G88 A;  2CW4 A;  3JAT A;  1XHO A;  3KJJ A;  2IAF A;  1XBI A;  3C9U A;  4IHJ A;  5GIN C;  4ZHQ B;  2ZF8 A;  2F9Z C;  2N48 A;  1S72 F;  3CCL F;  1FSZ A;  5IJ0 B;  4G4Y A;  5GON A;  5GIO C;  1U40 A;  2QTP A;  3N2G B;  1QVF F;  1W5F A;  2I6D A;  2OTM A;  3T80 A;  3IEW A;  1QD9 A;  2G9I A;  2R75 1;  3NVI B;  1QVG F;  1JN1 A;  3HKB B;  2OHW A;  2UYN B;  2CWJ A;  5CB4 A;  3CXC F;  2BTU A;  1YIJ F;  1TVK B;  1W41 A;  2NMU A;  1IV1 A;  4X1Y B;  2ZOV A;  3S03 A;  2RHL A;  3VYT C;  4ZHQ A;  3JAS A;  4LNU B;  4IHJ B;  4BY9 D;  1JFF A;  1VQL F;  1TVK A;  4X1I B;  2ZVY A;  3SIV A;  3RYH B;  1JD1 A;  5ITZ B;  3VO8 A;  3ESJ A;  3FD6 A;  3LME A;  1JY8 A;  4DRX B;  5EO3 A;  1H47 A;  1VQ9 F;  2DYY A;  3J7A R;  3C9R A;  2VAM A;  1SA0 A;  3QHD A;  3VOB A;  2YXZ A;  5HP7 A;  2HRU A;  4YJ3 B;  5BMV A;  5LXT B;  1X7P A;  4TV9 A;  4U39 A;  4X1K B;  1W59 A;  3I56 F;  1SDS A;  1RQ2 A;  3JAS B;  4LNU A;  3HTN A;  3C8L A;  2Q1X A;  4U3J B;  3ZP4 A;  5J2U A;  3SIU A;  5DCV A;  1W42 A;  1XRG A;  2K1S A;  3CCE F;  1GO1 A;  3ERN A;  3U0O A;  3HWU A;  1W58 1;  1RQ7 A;  1X7O A;  3D01 A;  1IPA A;  1NMU B;  1X52 A;  3NK7 A;  3HKE A;  4G4W A;  5HP8 A;  2GZL A;  4X3M A;  3WGM A;  3FFM A;  1VQM F;  5EZY B;  3HKC B;  4RHA A;  3MBM A;  2I6R A;  4ZI7 A;  5CA1 B;  5EIB C;  5EAZ A;  3MDO A;  5C8Y B;  2HRY A;  5IYZ A;  1OAP A;  4F6R A;  1W5E A;  1NQ3 A;  3VTI C;  1IV2 A;  1VQ4 F;  3IKF A;  1Z5V A;  3ZO8 A;  3WXM B;  3N2K B;  5JCO A;  5J2T B;  5AVM A;  1U3L A;  4I55 A;  5LOV B;  4O2A B;  3OBW A;  1DBF A;  1YQN A;  2KG4 A;  1T0K B;  1GX1 A;  5GIP C;  3JAR B;  3JAL A;  5CA0 A;  4B62 A;  1VH8 A;  1SA0 B;  2AIF A;  2YYE A;  3AGK A;  4C8E A;  3IR9 A;  1YHQ F;  4G4Z A;  3VYS C;  5HWE A;  3EOR A;  3NMU C;  2VGN A;  3WPX A;  4C4W C;  1VQK F;  4HNA A;  3FBA A;  5JH7 B;  4EB6 B;  3CCR F;  2H6L A;  3MCA B;  3LWP C;  3CCS F;  4DRX A;  2GVI A;  3F6M A;  3WGJ A;  3S06 A;  4YJ2 A;  1JJ2 F;  4U3J A;  4O2A A;  2RHJ A;  3WGK A;  4I55 B;  4ZHY B;  5MN5 A;  1YIT F;  3RA6 A;  4ZI7 B;  5FNV B;  1M1K H;  5J2T A;  2VAP A;  3S0H A;  2V9Y A;  4R40 B;  3VOA A;  5HXU A;  4C82 A;  5LP6 B;  2R6R 1;  4IIJ A;  4F6R B;  4O2B B;  2Z01 A;  4EB6 A; 
#chains in the Genus database with same CATH homology
 3OON A;  4G4W A;  2LCA A;  3KHN A;  3LDT A;  3CYQ A;  4G88 A;  3TD3 A;  4RHA A;  3S06 A;  2ZOV A;  3WPW A;  3S03 A;  2ZF8 A;  2ZVZ A;  4G4X A;  3S0Y A;  2N48 A;  2MQE A;  2W8B C;  4B5C A;  4ZHY B;  3CYP B;  3S0H A;  2AIZ P;  4G4Y A;  2KGW A;  5EB0 A;  2LBT A;  4B62 A;  4R40 B;  4ZHW A;  3S02 A;  2ZVY A;  5EAZ A;  3S0W A;  3IMP A;  4G4Z A;  2K1S A;  1OAP A;  5EB1 B;  2L26 A;  3WPX A;  1R1M A;  2HQS C;  3TD4 A;  4ERH A;  4G4V A;  4PWT A;  4ZHV A;  3TD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...