4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
3IMPA 2ZVYA 2L26A 3S0WA 2KGWA 3LDTA 1R1MA 4B5CA 4ERHA 5EB1B 3CYQA 3WPXA 3S06A 4ZHVA 2W8BC 2AIZP 4RHAA 4PWTA 2N48A 4ZHYB 3S0YA 4G4WA 4G4XA 4G88A 3S0HA 3KHNA 4G4YA 5EB0A 3TD5A 2LCAA 3TD4A 3OONA 2ZVZA 3S02A 4B62A 2MQEA 2HQSC 4G4ZA 4ZHWA 4G4VA 3WPWA 4R40B 2LBTA 1OAPA 2K1SA 2ZF8A 5EAZA 3TD3A 3S03A 3CYPB 2ZOVA
chains in the Genus database with same CATH superfamily
1ZWZA 2DT4A 4YJ3A 1W57A 4O2BA 5GANK 1YJWF 1Z5VA 2GVIA 3VMFB 2Z1UA 2Q1XA 5EYPB 1JFFB 3I56F 1VQ4F 1CN7A 3OBWA 3PLAC 5CB4A 1VHAA 2B33A 4IIJB 5KMGB 3JAWA 1X7OA 3O85A 3UT5A 1K9MH 1OAPA 5J2TA 1W59A 5JH7A 1Q81H 1QD9A 3V7QA 5GIOC 3I55F 1VQKF 1NJIH 3IMPA 3HAXD 3F0EA 3D00A 5A2QM 2ZVYA 5CA1A 1VQ6F 1IV3A 3C9TA 3K12A 5EIBD 1GZ0A 3CCQF 4DRXB 4O4HB 3N4YA 3LWOC 1JN1A 5JQGA 2UYPA 3MCQA 3ZO8A 1H7MA 3JVHA 3J7AR 5LP6C 4EB6A 2MQEA 3N2GA 5FNVB 3RYFB 2UYNB 3KJKA 3QUWA 3FPIA 3HKBA 2VAWA 4YJ3B 4RQOA 1YJNF 2H8CA 1TUBB 4O2BB 1VQ5F 2PHNA 1W581 4F6RB 3CCEF 3GYQA 1XRGA 3LFOA 3CC2F 3P0ZA 4BT2A 4B46A 3VTIC 5GAPK 4PWTA 2RB9A 1U40A 5LYJB 1OFUA 5LXTA 2WALA 1K8AH 3JASA 2GZLA 5GONB 4B62A 3JARA 4G4ZA 4O4LB 4C8EA 4BT3A 5EZYB 5C8YB 3K14A 1ONIA 1KNJA 2IG8A 3FFMA 5CA1B 3CMAF 5GINC 4BVQA 4DXDA 5CA0B 2LBWA 3VO8A 5J2UA 4U3JA 1X25A 4EI8A 4HNAA 1YHQF 3BYQA 1XV2A 5GIPC 3G4SF 1JD1A 1S72F 4E6EA 5IYZA 4RHAA 1K73H 4WBNB 5HWEA 5DCVA 1TVKB 3RYIA 5EYPA 2AIFA 2VAMA 1W41A 4BT6A 1JFFA 4C81A 1IV1A 1VQVA 3RYHA 2LBXA 4IIJA 3S03A 3CCSF 5KMGA 5HXZA 3P10A 3DDNA 5KX5A 1R1MA 3U0OA 5G4UC 2V9YA 3JAMM 2HX0A 2BTUA 4X1YA 1YI2F 4O4HA 5JCOC 2UYJA 3KHNA 2GLZA 1QVFF 1VQOF 4TUYB 1QU9A 3NVIB 4X3MA 3OW2F 1Z5WA 3HTNA 3WGKA 2K1SA 4U3JB 1J7HA 3RYFA 2UYNA 4C4WC 3IKFA 5IYZB 2KTUA 1X52A 3HKCA 3WPXA 1TUBA 2Q1YA 5HP7A 1QVGF 2G9IA 3G71F 4F6RA 1W2BF 2VGNA 3RYIB 4X1KB 4O4IA 3FBAA 3RYHB 3ESJA 4ZHWA 5LYJA 3WGNA 4R40B 2VAPA 5GONA 5KX5B 5IJ9A 3RA6A 3TD3A 1CLIA 1UFYA 5HP8A 4O4LA 4C8IA 3E22B 2Z1FA 4NQ3A 2L26A 5EZYA 4X1YB 5C8YA 2KGWA 3KE1A 2I6DA 3N2KA 4I50B 5CA0A 2QI2A 1IPAA 3ERNA 3E20B 3F0GA 4U39A 1W42A 2FC3A 3RE3A 4FFBA 3VOAA 1VQLF 1YJ9F 2IQQA 1PF5A 3QTYA 3WJPA 4WBNA 3WPWA 3ON1A 3RYCB 2UZHA 5MN6A 3QHDA 4BT7A 2ZF8A 3Q8HA 1TVKA 3HKCB 2HS3A 3C8LA 3S0WA 1T0KB 2IAFA 4NUTA 2BO1A 3CYQA 1RLUA 4ZK7A 3S06A 4O4IB 3CCLF 3IR9A 3C9SA 4ZHYB 3V3TA 4G4WA 4G4XA 3TD5A 4IHJB 1SZQA 2LCAA 3VYUC 3IEWA 5IJ9B 4BW0B 2YYEA 4G4VA 4B45A 4X1IB 3WGJA 3T80A 3VCZA 2CVLA 2HS0A 3KIZA 3CD6F 1JY8A 2HP3A 3N2KB 4TUYA 3G6EF 2YXZA 4BT4A 2UYKA 3MBMA 1CK2A 3EORA 5LA6B 2QEXF 1YQNA 2CHSA 4FFBB 3LWVC 4TV8B 2AIZP 3DC2A 1N8RH 1VK3A 3ZP7A 4LNUB 2H8EA 5FLXM 1UI9A 3HKEA 4G4YA 5EB0A 5HY0A 1YITF 1U3LA 1RQ2A 2ZVZA 1Q7YH 4X1KA 4O4JB 4BVSA 5AVMA 1KQSF 2OHWA 5BMVB 1VQNF 2QA4F 1RLGA 4C8GA 2P6YA 4BT5A 3LDTA 3K2XA 1GX1A 3F0FA 4ERHA 4I55A 1W5FA 3E22A 3JALB 2W8BC 3KJJA 1M1KH 3ZOPA 1QAHA 2RHOA 1E7KA 3LWPC 3MCAB 1Q8RA 4X3LA 4I50A 4EI9A 4EI7A 2ZAUA 3NMUC 5IJ0B 1YIJF 2OTMA 3NVKE 1VQPF 3NK7A 1W3EX 1KNKA 3L7QA 1JJ2F 3RYCA 1GO1A 4KWEA 1KD1H 2R751 4NWOB 3N4ZA 1W5EA 3D54A 4M8IA 3HKEB 5LP6A 2JNBA 3CCMF 2DYYA 3SIUA 3S0YA 4BVTA 3J80M 3CPWF 3CCJF 3OBYA 2RHHA 2KTVA 1NQ3A 2Z1EA 3JCMM 1GO0A 1DT9A 2LBTA 3CCUF 1W55A 4IHJA 2HVYD 4ZOLB 1YGYA 3CYPB 5EWRA 2CSLA 4I55B 1Q82H 4X1IA 3VYSC 5MN4A 5HY1A 1RQ7A 3M1XA 4YJ2B 3WGLA 2EWCA 2QTPA 1VQ8F 1VH8A 2VGMA 2N48A 2ZODA 5LA6A 2F9ZC 3LMEA 4TV8A 3JATA 3S02A 3HKDB 1U43A 4ZHQB 4LNUA 3I7TA 4TV9B 3JAKA 3WJRA 2HP0A 3VOBA 2VXYA 5EAZA 2AMTA 1H48A 3NK6A 5EO3A 4ZI7B 4O4JA 2H6LA 2RHJA 4X20B 5JVDB 2OTJF 3K0TA 5LP6B 1VQ9F 5EB1B 5BMVA 3D01A 2BTOA 2I6RA 3AGKA 1XBIA 3VI6A 3HJWC 3SIVA 5EIBC 3WXMB 1SA0B 4O2AB 3F0DA 3P4EA 2Z1TA 2CWJA 3JALA 1U3PA 4BVRA 5HXUA 4I4TB 3WGMA 1RA4A 4XCQA 1W5AA 3E1YA 2R6R1 3GHZA 1FSZA 5FJ4C 5IJ0A 3PAFA 2BTQB 4B5CA 2FGYA 3FD5A 5ITZA 1PXWA 5JCOA 4C82A 5CB4B 2CHTA 2HS4A 1Q86H 1W40A 3JATB 3CPQA 3JAWB 3UT5B 1VQMF 3CC4F 4G88A 1FFXA 2OTLF 3C9RA 3I3FA 5J2TB 3JAKB 3OONA 2HP0B 5JH7B 1DBFA 4BY9D 3LYBA 3F6MA 5HY2A 5MN5A 1IV2A 2HRUA 5LOVA 2ALEA 2CW4A 3FD6A 2HRYA 2ZOVA 5JQGB 1W5BA 4ZOLA 3LWRC 4LCKA 3IEQA 3CCVF 3B6NA 2KG4A 3M84A 4ZHVA 3M4SA 4EB6B 3N2GB 3VYTC 4YJ2A 1X7PA 3S0HA 3HKBB 1VQ7F 3CC7F 3GTZA 3CMEF 3LWQC 1IV4A 1XHOA 3R0PA 3MQWA 5IT9M 3CCRF 3HKDA 4ZHQA 5ITZB 4TZZA 4TV9A 3J81M 3ZP4A 3RA5A 3CXCF 1KC8H 5LXTB 4ZI7A 2RHLA 1M90H 3JASB 1FFXB 1NMUB 2Z01A 2PMPA 4X20A 2OZBA 4DRXA 5JVDA 3CG6A 3ELCA 3IKEA 3JARB 1H47A 5G4VC 5HY4A 5LOVB 3VIUA 3WJQA 1ODEA 3C9UA 3TD4A 1SA0A 4O2AA 3V4DA 2HQSC 3HWUA 2CZWA 5J2UB 5B8FA 1FNJA 4HNAB 3CB2A 1FNKA 1T0AA 4I4TA 1SDSA 1COMA 3MDOA 5FNVA 3V7EA 2NMUA
chains in the Genus database with same CATH topology
3IMPA 2ZVYA 2L26A 3S0WA 2KGWA 3LDTA 1R1MA 4B5CA 4ERHA 5EB1B 3CYQA 3WPXA 3S06A 4ZHVA 2W8BC 2AIZP 4RHAA 4PWTA 2N48A 4ZHYB 3S0YA 4G4WA 4G4XA 4G88A 3S0HA 3KHNA 4G4YA 5EB0A 3TD5A 2LCAA 3TD4A 3OONA 2ZVZA 3S02A 4B62A 2MQEA 2HQSC 4G4ZA 4ZHWA 4G4VA 3WPWA 4R40B 2LBTA 1OAPA 2K1SA 2ZF8A 5EAZA 3TD3A 3S03A 3CYPB 2ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMP A;  2ZVY A;  2L26 A;  3S0W A;  2KGW A;  3LDT A;  1R1M A;  4B5C A;  4ERH A;  5EB1 B;  3CYQ A;  3WPX A;  3S06 A;  4ZHV A;  2W8B C;  2AIZ P;  4RHA A;  4PWT A;  2N48 A;  4ZHY B;  3S0Y A;  4G4W A;  4G4X A;  4G88 A;  3S0H A;  3KHN A;  4G4Y A;  5EB0 A;  3TD5 A;  2LCA A;  3TD4 A;  3OON A;  2ZVZ A;  3S02 A;  4B62 A;  2MQE A;  2HQS C;  4G4Z A;  4ZHW A;  4G4V A;  3WPW A;  4R40 B;  2LBT A;  1OAP A;  2K1S A;  2ZF8 A;  5EAZ A;  3TD3 A;  3S03 A;  3CYP B;  2ZOV A; 
#chains in the Genus database with same CATH topology
 1ZWZ A;  2DT4 A;  4YJ3 A;  1W57 A;  4O2B A;  5GAN K;  1YJW F;  1Z5V A;  2GVI A;  3VMF B;  2Z1U A;  2Q1X A;  5EYP B;  1JFF B;  3I56 F;  1VQ4 F;  1CN7 A;  3OBW A;  3PLA C;  5CB4 A;  1VHA A;  2B33 A;  4IIJ B;  5KMG B;  3JAW A;  1X7O A;  3O85 A;  3UT5 A;  1K9M H;  1OAP A;  5J2T A;  1W59 A;  5JH7 A;  1Q81 H;  1QD9 A;  3V7Q A;  5GIO C;  3I55 F;  1VQK F;  1NJI H;  3IMP A;  3HAX D;  3F0E A;  3D00 A;  5A2Q M;  2ZVY A;  5CA1 A;  1VQ6 F;  1IV3 A;  3C9T A;  3K12 A;  5EIB D;  1GZ0 A;  3CCQ F;  4DRX B;  4O4H B;  3N4Y A;  3LWO C;  1JN1 A;  5JQG A;  2UYP A;  3MCQ A;  3ZO8 A;  1H7M A;  3JVH A;  3J7A R;  5LP6 C;  4EB6 A;  2MQE A;  3N2G A;  5FNV B;  3RYF B;  2UYN B;  3KJK A;  3QUW A;  3FPI A;  3HKB A;  2VAW A;  4YJ3 B;  4RQO A;  1YJN F;  2H8C A;  1TUB B;  4O2B B;  1VQ5 F;  2PHN A;  1W58 1;  4F6R B;  3CCE F;  3GYQ A;  1XRG A;  3LFO A;  3CC2 F;  3P0Z A;  4BT2 A;  4B46 A;  3VTI C;  5GAP K;  4PWT A;  2RB9 A;  1U40 A;  5LYJ B;  1OFU A;  5LXT A;  2WAL A;  1K8A H;  3JAS A;  2GZL A;  5GON B;  4B62 A;  3JAR A;  4G4Z A;  4O4L B;  4C8E A;  4BT3 A;  5EZY B;  5C8Y B;  3K14 A;  1ONI A;  1KNJ A;  2IG8 A;  3FFM A;  5CA1 B;  3CMA F;  5GIN C;  4BVQ A;  4DXD A;  5CA0 B;  2LBW A;  3VO8 A;  5J2U A;  4U3J A;  1X25 A;  4EI8 A;  4HNA A;  1YHQ F;  3BYQ A;  1XV2 A;  5GIP C;  3G4S F;  1JD1 A;  1S72 F;  4E6E A;  5IYZ A;  4RHA A;  1K73 H;  4WBN B;  5HWE A;  5DCV A;  1TVK B;  3RYI A;  5EYP A;  2AIF A;  2VAM A;  1W41 A;  4BT6 A;  1JFF A;  4C81 A;  1IV1 A;  1VQV A;  3RYH A;  2LBX A;  4IIJ A;  3S03 A;  3CCS F;  5KMG A;  5HXZ A;  3P10 A;  3DDN A;  5KX5 A;  1R1M A;  3U0O A;  5G4U C;  2V9Y A;  3JAM M;  2HX0 A;  2BTU A;  4X1Y A;  1YI2 F;  4O4H A;  5JCO C;  2UYJ A;  3KHN A;  2GLZ A;  1QVF F;  1VQO F;  4TUY B;  1QU9 A;  3NVI B;  4X3M A;  3OW2 F;  1Z5W A;  3HTN A;  3WGK A;  2K1S A;  4U3J B;  1J7H A;  3RYF A;  2UYN A;  4C4W C;  3IKF A;  5IYZ B;  2KTU A;  1X52 A;  3HKC A;  3WPX A;  1TUB A;  2Q1Y A;  5HP7 A;  1QVG F;  2G9I A;  3G71 F;  4F6R A;  1W2B F;  2VGN A;  3RYI B;  4X1K B;  4O4I A;  3FBA A;  3RYH B;  3ESJ A;  4ZHW A;  5LYJ A;  3WGN A;  4R40 B;  2VAP A;  5GON A;  5KX5 B;  5IJ9 A;  3RA6 A;  3TD3 A;  1CLI A;  1UFY A;  5HP8 A;  4O4L A;  4C8I A;  3E22 B;  2Z1F A;  4NQ3 A;  2L26 A;  5EZY A;  4X1Y B;  5C8Y A;  2KGW A;  3KE1 A;  2I6D A;  3N2K A;  4I50 B;  5CA0 A;  2QI2 A;  1IPA A;  3ERN A;  3E20 B;  3F0G A;  4U39 A;  1W42 A;  2FC3 A;  3RE3 A;  4FFB A;  3VOA A;  1VQL F;  1YJ9 F;  2IQQ A;  1PF5 A;  3QTY A;  3WJP A;  4WBN A;  3WPW A;  3ON1 A;  3RYC B;  2UZH A;  5MN6 A;  3QHD A;  4BT7 A;  2ZF8 A;  3Q8H A;  1TVK A;  3HKC B;  2HS3 A;  3C8L A;  3S0W A;  1T0K B;  2IAF A;  4NUT A;  2BO1 A;  3CYQ A;  1RLU A;  4ZK7 A;  3S06 A;  4O4I B;  3CCL F;  3IR9 A;  3C9S A;  4ZHY B;  3V3T A;  4G4W A;  4G4X A;  3TD5 A;  4IHJ B;  1SZQ A;  2LCA A;  3VYU C;  3IEW A;  5IJ9 B;  4BW0 B;  2YYE A;  4G4V A;  4B45 A;  4X1I B;  3WGJ A;  3T80 A;  3VCZ A;  2CVL A;  2HS0 A;  3KIZ A;  3CD6 F;  1JY8 A;  2HP3 A;  3N2K B;  4TUY A;  3G6E F;  2YXZ A;  4BT4 A;  2UYK A;  3MBM A;  1CK2 A;  3EOR A;  5LA6 B;  2QEX F;  1YQN A;  2CHS A;  4FFB B;  3LWV C;  4TV8 B;  2AIZ P;  3DC2 A;  1N8R H;  1VK3 A;  3ZP7 A;  4LNU B;  2H8E A;  5FLX M;  1UI9 A;  3HKE A;  4G4Y A;  5EB0 A;  5HY0 A;  1YIT F;  1U3L A;  1RQ2 A;  2ZVZ A;  1Q7Y H;  4X1K A;  4O4J B;  4BVS A;  5AVM A;  1KQS F;  2OHW A;  5BMV B;  1VQN F;  2QA4 F;  1RLG A;  4C8G A;  2P6Y A;  4BT5 A;  3LDT A;  3K2X A;  1GX1 A;  3F0F A;  4ERH A;  4I55 A;  1W5F A;  3E22 A;  3JAL B;  2W8B C;  3KJJ A;  1M1K H;  3ZOP A;  1QAH A;  2RHO A;  1E7K A;  3LWP C;  3MCA B;  1Q8R A;  4X3L A;  4I50 A;  4EI9 A;  4EI7 A;  2ZAU A;  3NMU C;  5IJ0 B;  1YIJ F;  2OTM A;  3NVK E;  1VQP F;  3NK7 A;  1W3E X;  1KNK A;  3L7Q A;  1JJ2 F;  3RYC A;  1GO1 A;  4KWE A;  1KD1 H;  2R75 1;  4NWO B;  3N4Z A;  1W5E A;  3D54 A;  4M8I A;  3HKE B;  5LP6 A;  2JNB A;  3CCM F;  2DYY A;  3SIU A;  3S0Y A;  4BVT A;  3J80 M;  3CPW F;  3CCJ F;  3OBY A;  2RHH A;  2KTV A;  1NQ3 A;  2Z1E A;  3JCM M;  1GO0 A;  1DT9 A;  2LBT A;  3CCU F;  1W55 A;  4IHJ A;  2HVY D;  4ZOL B;  1YGY A;  3CYP B;  5EWR A;  2CSL A;  4I55 B;  1Q82 H;  4X1I A;  3VYS C;  5MN4 A;  5HY1 A;  1RQ7 A;  3M1X A;  4YJ2 B;  3WGL A;  2EWC A;  2QTP A;  1VQ8 F;  1VH8 A;  2VGM A;  2N48 A;  2ZOD A;  5LA6 A;  2F9Z C;  3LME A;  4TV8 A;  3JAT A;  3S02 A;  3HKD B;  1U43 A;  4ZHQ B;  4LNU A;  3I7T A;  4TV9 B;  3JAK A;  3WJR A;  2HP0 A;  3VOB A;  2VXY A;  5EAZ A;  2AMT A;  1H48 A;  3NK6 A;  5EO3 A;  4ZI7 B;  4O4J A;  2H6L A;  2RHJ A;  4X20 B;  5JVD B;  2OTJ F;  3K0T A;  5LP6 B;  1VQ9 F;  5EB1 B;  5BMV A;  3D01 A;  2BTO A;  2I6R A;  3AGK A;  1XBI A;  3VI6 A;  3HJW C;  3SIV A;  5EIB C;  3WXM B;  1SA0 B;  4O2A B;  3F0D A;  3P4E A;  2Z1T A;  2CWJ A;  3JAL A;  1U3P A;  4BVR A;  5HXU A;  4I4T B;  3WGM A;  1RA4 A;  4XCQ A;  1W5A A;  3E1Y A;  2R6R 1;  3GHZ A;  1FSZ A;  5FJ4 C;  5IJ0 A;  3PAF A;  2BTQ B;  4B5C A;  2FGY A;  3FD5 A;  5ITZ A;  1PXW A;  5JCO A;  4C82 A;  5CB4 B;  2CHT A;  2HS4 A;  1Q86 H;  1W40 A;  3JAT B;  3CPQ A;  3JAW B;  3UT5 B;  1VQM F;  3CC4 F;  4G88 A;  1FFX A;  2OTL F;  3C9R A;  3I3F A;  5J2T B;  3JAK B;  3OON A;  2HP0 B;  5JH7 B;  1DBF A;  4BY9 D;  3LYB A;  3F6M A;  5HY2 A;  5MN5 A;  1IV2 A;  2HRU A;  5LOV A;  2ALE A;  2CW4 A;  3FD6 A;  2HRY A;  2ZOV A;  5JQG B;  1W5B A;  4ZOL A;  3LWR C;  4LCK A;  3IEQ A;  3CCV F;  3B6N A;  2KG4 A;  3M84 A;  4ZHV A;  3M4S A;  4EB6 B;  3N2G B;  3VYT C;  4YJ2 A;  1X7P A;  3S0H A;  3HKB B;  1VQ7 F;  3CC7 F;  3GTZ A;  3CME F;  3LWQ C;  1IV4 A;  1XHO A;  3R0P A;  3MQW A;  5IT9 M;  3CCR F;  3HKD A;  4ZHQ A;  5ITZ B;  4TZZ A;  4TV9 A;  3J81 M;  3ZP4 A;  3RA5 A;  3CXC F;  1KC8 H;  5LXT B;  4ZI7 A;  2RHL A;  1M90 H;  3JAS B;  1FFX B;  1NMU B;  2Z01 A;  2PMP A;  4X20 A;  2OZB A;  4DRX A;  5JVD A;  3CG6 A;  3ELC A;  3IKE A;  3JAR B;  1H47 A;  5G4V C;  5HY4 A;  5LOV B;  3VIU A;  3WJQ A;  1ODE A;  3C9U A;  3TD4 A;  1SA0 A;  4O2A A;  3V4D A;  2HQS C;  3HWU A;  2CZW A;  5J2U B;  5B8F A;  1FNJ A;  4HNA B;  3CB2 A;  1FNK A;  1T0A A;  4I4T A;  1SDS A;  1COM A;  3MDO A;  5FNV A;  3V7E A;  2NMU A; 
#chains in the Genus database with same CATH homology
 3IMP A;  2ZVY A;  2L26 A;  3S0W A;  2KGW A;  3LDT A;  1R1M A;  4B5C A;  4ERH A;  5EB1 B;  3CYQ A;  3WPX A;  3S06 A;  4ZHV A;  2W8B C;  2AIZ P;  4RHA A;  4PWT A;  2N48 A;  4ZHY B;  3S0Y A;  4G4W A;  4G4X A;  4G88 A;  3S0H A;  3KHN A;  4G4Y A;  5EB0 A;  3TD5 A;  2LCA A;  3TD4 A;  3OON A;  2ZVZ A;  3S02 A;  4B62 A;  2MQE A;  2HQS C;  4G4Z A;  4ZHW A;  4G4V A;  3WPW A;  4R40 B;  2LBT A;  1OAP A;  2K1S A;  2ZF8 A;  5EAZ A;  3TD3 A;  3S03 A;  3CYP B;  2ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...