4G4VA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
b'MALAKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
molecule tags Peptide binding protein
source organism Acinetobacter baumannii
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4vA00
4G4ZA 4B5CA 3S0HA 3WPWA 4G4WA 3OONA 3WPXA 3CYPB 3CYQA 3KHNA 2AIZP 4ZHWA 3S03A 2ZF8A 3LDTA 2HQSC 3S0WA 2ZVZA 3TD4A 5EAZA 4G4VA 2K1SA 4G4XA 2W8BC 4PWTA 2ZOVA 3S06A 4G88A 4R40B 2LBTA 5EB0A 2N48A 2KGWA 3TD3A 4G4YA 4RHAA 3S02A 4B62A 1OAPA 3S0YA 2LCAA 3TD5A 4ZHYB 2MQEA 2L26A 4ERHA 4ZHVA 1R1MA 5EB1B 3IMPA 2ZVYA
chains in the Genus database with same CATH superfamily
3HKEA 3NVKE 1Z5WA 2QI2A 3N2KB 3CC7F 3S0WA 4BVQA 5HWEA 3WJPA 1NQ3A 5HY0A 4C8EA 4DRXB 3LWPC 4I50A 3I55F 3LWVC 2N48A 3GYQA 3C8LA 5EYPA 5LP6B 1W3EX 3M1XA 1VQ4F 1W41A 2V9YA 2IQQA 2L26A 1K73H 1W55A 5J2UB 1XV2A 4ZHQB 4C8GA 3JCMM 1UFYA 2Z1TA 3V4DA 1RLGA 4B45A 3C9UA 4X1YA 4TZZA 2RHOA 2ALEA 5FNVA 3SIVA 3DC2A 5MN6A 5J2TB 4ZI7A 2W8BC 4X3LA 5CA1B 3FD5A 4EI8A 4U3JA 2KG4A 5J2UA 4ZK7A 4F6RB 1IV2A 1YJ9F 1YIJF 5GONB 2H8EA 3VMFB 1T0KB 4C4WC 3CMEF 4BY9D 2UYPA 3G4SF 4KWEA 1KNKA 3QUWA 3S03A 1X52A 3RYCB 3JASA 5IT9M 3ELCA 3P10A 1RQ7A 2RHJA 1YHQF 1KD1H 3VI6A 2ZAUA 1QVGF 1GZ0A 5HY4A 1PXWA 1ONIA 4G88A 2YXZA 5DCVA 4IIJB 1YJNF 3F0DA 2JNBA 2WALA 3D01A 4O4HB 4F6RA 3HKCB 3RA6A 5GONA 1W59A 5LA6B 2VGNA 2RB9A 3LMEA 2CVLA 4EB6B 3E22B 5CA0A 3MCQA 3CD6F 4LNUB 4G4WA 3CYPB 2OTLF 3JAWB 2Z1UA 4YJ3B 1CLIA 3ESJA 3VO8A 1DBFA 2K1SA 4I55A 1TUBB 3I7TA 3VYSC 3K14A 5EIBC 4X1KB 2I6DA 1VQ6F 3MDOA 1FNKA 2HX0A 3J80M 1Z5VA 3HAXD 2BO1A 3BYQA 2IAFA 1W40A 5LXTB 5CA0B 2H8CA 3M4SA 4LNUA 1W581 3CCJF 2UYKA 3WPWA 3JAWA 3CYQA 1SZQA 4TUYB 5G4UC 2EWCA 4YJ3A 5GIOC 2HQSC 3HKDA 1NJIH 1VQKF 1NMUB 4I55B 3RA5A 3ZO8A 2CW4A 1K9MH 3N2GA 3JALB 3MCAB 3I56F 2VAWA 1RLUA 1VQ8F 5EO3A 1J7HA 1JY8A 2CHSA 1SA0B 1IV1A 4BT5A 1QU9A 4BT6A 1XBIA 3NK7A 2HP0B 5EB1B 3IMPA 1M90H 3FPIA 5JVDB 3KHNA 1GO0A 4ZOLA 3NMUC 2Z1EA 3FBAA 2G9IA 1DT9A 3IR9A 3JARB 4BW0B 5LYJA 3N2GB 1GX1A 1KNJA 4C8IA 5GANK 1S72F 2Q1YA 5ITZA 5JQGA 3CPQA 4RHAA 3S02A 5HY2A 3K0TA 4NWOB 4BVTA 4C81A 4X20A 5EZYB 2HP0A 5CB4B 4BT3A 2P6YA 5A2QM 1OFUA 3CB2A 3HKBA 2NMUA 2UYNA 2RHHA 3WXMB 2BTQB 3OONA 1YQNA 3J7AR 2PHNA 3JARA 4O2AB 4O2BB 1VK3A 3V7QA 1RQ2A 3K12A 5GIPC 2DT4A 3WGNA 2ZOVA 4M8IA 4X3MA 2GVIA 2LBTA 5EB0A 4NUTA 4O4JA 1OAPA 1SDSA 2LCAA 5CB4A 2HP3A 3DDNA 3P0ZA 4IHJB 4O4IB 4ZHYB 5MN5A 3ZP4A 3HKBB 1JFFA 2R6R1 4DXDA 3MQWA 3RYFA 5IJ0A 3S0HA 3WGJA 3RYIB 3RYHB 3PLAC 1W5FA 3OBYA 4HNAA 3G6EF 2ZVZA 3FFMA 5EWRA 3QTYA 1JN1A 3JAKB 1QVFF 4BVSA 1U43A 3F0GA 5HXZA 5GINC 4O4JB 3J81M 4I50B 2KGWA 1VQMF 2VAPA 5HP7A 5KMGB 1M1KH 1VH8A 1VQ7F 4IHJA 1XRGA 3RYIA 2AMTA 3F6MA 4HNAB 4C82A 5AVMA 1U3PA 3KIZA 2HVYD 2AIFA 3G71F 5HXUA 3N4ZA 5FNVB 3CG6A 5BMVB 2QTPA 5J2TA 3VTIC 5KMGA 1H7MA 3CCMF 2VAMA 1RA4A 3S0YA 3CXCF 3V3TA 3HKEB 3RE3A 4BT7A 5LP6C 2Q1XA 5FJ4C 3N2KA 3T80A 5JCOC 2BTOA 3RYCA 3JASB 2QA4F 1N8RH 1YI2F 5JCOA 3D54A 3C9TA 3VOAA 3WJQA 3CCVF 1CN7A 2F9ZC 5EYPB 5LP6A 1COMA 4IIJA 1E7KA 3CMAF 1K8AH 3IKEA 4WBNB 3CCUF 1YGYA 3CCLF 2IG8A 5EIBD 2CSLA 1JD1A 2VGMA 4ZHQA 3WGMA 3FD6A 2CZWA 3JATB 4X1YB 4ZHWA 3D00A 3E20B 1Q82H 1FSZA 1FFXA 5GAPK 3Q8HA 2Z01A 4BT2A 4ZI7B 2FGYA 1YITF 5CA1A 2ZODA 3V7EA 2KTUA 2UZHA 4FFBB 3C9RA 1IV3A 2Z1FA 1W5AA 3LYBA 1U3LA 3PAFA 4TV8B 4U3JB 1Q7YH 3ON1A 1GO1A 4WBNA 2HRUA 4NQ3A 1Q81H 3CCQF 3TD3A 5LXTA 2LBWA 2OHWA 2HRYA 3JATA 2KTVA 3WGKA 3OBWA 3K2XA 2AIZP 2ZF8A 1FFXB 2H6LA 1VQ9F 5FLXM 3JVHA 4TUYA 2UYJA 3JAMM 3TD4A 2I6RA 4LCKA 3ZOPA 3ERNA 1IPAA 2B33A 2OTMA 3CCSF 4FFBA 3CC4F 4B46A 3CPWF 3P4EA 4TV8A 1VHAA 3I3FA 3JALA 4R40B 3NVIB 5KX5B 1TVKA 4G4YA 1VQVA 4O4HA 2YYEA 3HKCA 1ZWZA 5MN4A 5LA6A 3WGLA 3KJJA 4EB6A 2FC3A 3E22A 4ERHA 4ZHVA 2ZVYA 2GLZA 2R751 3IEQA 5HP8A 3WJRA 4XCQA 5IYZA 4ZOLB 1H47A 3HTNA 2HS0A 1TUBA 2RHLA 2CWJA 2OZBA 3NK6A 3HJWC 4X1KA 5LOVA 5KX5A 1TVKB 1X7PA 2DYYA 2PMPA 5ITZB 1VQNF 2HS4A 5C8YA 1W2BF 1U40A 4X20B 1R1MA 3VYTC 2QEXF 3CCRF 4X1IB 4RQOA 3SIUA 3KE1A 4BT4A 1W5EA 5HY1A 2UYNB 5IYZB 1KC8H 5IJ9B 3HKDB 3VIUA 2CHTA 4YJ2B 4BVRA 3KJKA 4O2BA 5EAZA 3CCEF 4G4VA 3IKFA 3CC2F 5LOVB 5B8FA 1Q86H 1PF5A 3GHZA 1T0AA 1VQOF 3B6NA 3U0OA 1JJ2F 1SA0A 2VXYA 3VCZA 5C8YB 3TD5A 3IEWA 4TV9B 3UT5B 4X1IA 1Q8RA 5JVDA 3OW2F 1VQPF 1W42A 4G4ZA 4B5CA 5IJ9A 4U39A 3WPXA 2BTUA 3L7QA 3RYFB 5IJ0B 3E1YA 1X7OA 4YJ2A 3O85A 1ODEA 3LDTA 3RYHA 5LYJB 3C9SA 5JH7B 1XHOA 2LBXA 4G4XA 4E6EA 4PWTA 5JQGB 3JAKA 3S06A 1KQSF 3HWUA 3VOBA 1YJWF 1VQLF 2OTJF 5EZYA 3MBMA 1W5BA 4TV9A 3UT5A 3LWOC 2MQEA 1X25A 3EORA 4O4LA 4B62A 4I4TB 3LWRC 1CK2A 3R0PA 4O2AA 3ZP7A 5JH7A 1H48A 2HS3A 3LWQC 3N4YA 4EI7A 4DRXA 1W57A 3AGKA 2GZLA 3LFOA 5BMVA 1QAHA 3F0EA 1FNJA 3M84A 3QHDA 4O4IA 1QD9A 3GTZA 4EI9A 1JFFB 4O4LB 1IV4A 4I4TA 5G4VC 3VYUC 3F0FA 1VQ5F 1UI9A
chains in the Genus database with same CATH topology
4G4ZA 4B5CA 3S0HA 3WPWA 4G4WA 3OONA 3WPXA 3CYPB 3CYQA 3KHNA 2AIZP 4ZHWA 3S03A 2ZF8A 3LDTA 2HQSC 3S0WA 2ZVZA 3TD4A 5EAZA 4G4VA 2K1SA 4G4XA 2W8BC 4PWTA 2ZOVA 3S06A 4G88A 4R40B 2LBTA 5EB0A 2N48A 2KGWA 3TD3A 4G4YA 4RHAA 3S02A 4B62A 1OAPA 3S0YA 2LCAA 3TD5A 4ZHYB 2MQEA 2L26A 4ERHA 4ZHVA 1R1MA 5EB1B 3IMPA 2ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4Z A;  4B5C A;  3S0H A;  3WPW A;  4G4W A;  3OON A;  3WPX A;  3CYP B;  3CYQ A;  3KHN A;  2AIZ P;  4ZHW A;  3S03 A;  2ZF8 A;  3LDT A;  2HQS C;  3S0W A;  2ZVZ A;  3TD4 A;  5EAZ A;  4G4V A;  2K1S A;  4G4X A;  2W8B C;  4PWT A;  2ZOV A;  3S06 A;  4G88 A;  4R40 B;  2LBT A;  5EB0 A;  2N48 A;  2KGW A;  3TD3 A;  4G4Y A;  4RHA A;  3S02 A;  4B62 A;  1OAP A;  3S0Y A;  2LCA A;  3TD5 A;  4ZHY B;  2MQE A;  2L26 A;  4ERH A;  4ZHV A;  1R1M A;  5EB1 B;  3IMP A;  2ZVY A; 
#chains in the Genus database with same CATH topology
 3HKE A;  3NVK E;  1Z5W A;  2QI2 A;  3N2K B;  3CC7 F;  3S0W A;  4BVQ A;  5HWE A;  3WJP A;  1NQ3 A;  5HY0 A;  4C8E A;  4DRX B;  3LWP C;  4I50 A;  3I55 F;  3LWV C;  2N48 A;  3GYQ A;  3C8L A;  5EYP A;  5LP6 B;  1W3E X;  3M1X A;  1VQ4 F;  1W41 A;  2V9Y A;  2IQQ A;  2L26 A;  1K73 H;  1W55 A;  5J2U B;  1XV2 A;  4ZHQ B;  4C8G A;  3JCM M;  1UFY A;  2Z1T A;  3V4D A;  1RLG A;  4B45 A;  3C9U A;  4X1Y A;  4TZZ A;  2RHO A;  2ALE A;  5FNV A;  3SIV A;  3DC2 A;  5MN6 A;  5J2T B;  4ZI7 A;  2W8B C;  4X3L A;  5CA1 B;  3FD5 A;  4EI8 A;  4U3J A;  2KG4 A;  5J2U A;  4ZK7 A;  4F6R B;  1IV2 A;  1YJ9 F;  1YIJ F;  5GON B;  2H8E A;  3VMF B;  1T0K B;  4C4W C;  3CME F;  4BY9 D;  2UYP A;  3G4S F;  4KWE A;  1KNK A;  3QUW A;  3S03 A;  1X52 A;  3RYC B;  3JAS A;  5IT9 M;  3ELC A;  3P10 A;  1RQ7 A;  2RHJ A;  1YHQ F;  1KD1 H;  3VI6 A;  2ZAU A;  1QVG F;  1GZ0 A;  5HY4 A;  1PXW A;  1ONI A;  4G88 A;  2YXZ A;  5DCV A;  4IIJ B;  1YJN F;  3F0D A;  2JNB A;  2WAL A;  3D01 A;  4O4H B;  4F6R A;  3HKC B;  3RA6 A;  5GON A;  1W59 A;  5LA6 B;  2VGN A;  2RB9 A;  3LME A;  2CVL A;  4EB6 B;  3E22 B;  5CA0 A;  3MCQ A;  3CD6 F;  4LNU B;  4G4W A;  3CYP B;  2OTL F;  3JAW B;  2Z1U A;  4YJ3 B;  1CLI A;  3ESJ A;  3VO8 A;  1DBF A;  2K1S A;  4I55 A;  1TUB B;  3I7T A;  3VYS C;  3K14 A;  5EIB C;  4X1K B;  2I6D A;  1VQ6 F;  3MDO A;  1FNK A;  2HX0 A;  3J80 M;  1Z5V A;  3HAX D;  2BO1 A;  3BYQ A;  2IAF A;  1W40 A;  5LXT B;  5CA0 B;  2H8C A;  3M4S A;  4LNU A;  1W58 1;  3CCJ F;  2UYK A;  3WPW A;  3JAW A;  3CYQ A;  1SZQ A;  4TUY B;  5G4U C;  2EWC A;  4YJ3 A;  5GIO C;  2HQS C;  3HKD A;  1NJI H;  1VQK F;  1NMU B;  4I55 B;  3RA5 A;  3ZO8 A;  2CW4 A;  1K9M H;  3N2G A;  3JAL B;  3MCA B;  3I56 F;  2VAW A;  1RLU A;  1VQ8 F;  5EO3 A;  1J7H A;  1JY8 A;  2CHS A;  1SA0 B;  1IV1 A;  4BT5 A;  1QU9 A;  4BT6 A;  1XBI A;  3NK7 A;  2HP0 B;  5EB1 B;  3IMP A;  1M90 H;  3FPI A;  5JVD B;  3KHN A;  1GO0 A;  4ZOL A;  3NMU C;  2Z1E A;  3FBA A;  2G9I A;  1DT9 A;  3IR9 A;  3JAR B;  4BW0 B;  5LYJ A;  3N2G B;  1GX1 A;  1KNJ A;  4C8I A;  5GAN K;  1S72 F;  2Q1Y A;  5ITZ A;  5JQG A;  3CPQ A;  4RHA A;  3S02 A;  5HY2 A;  3K0T A;  4NWO B;  4BVT A;  4C81 A;  4X20 A;  5EZY B;  2HP0 A;  5CB4 B;  4BT3 A;  2P6Y A;  5A2Q M;  1OFU A;  3CB2 A;  3HKB A;  2NMU A;  2UYN A;  2RHH A;  3WXM B;  2BTQ B;  3OON A;  1YQN A;  3J7A R;  2PHN A;  3JAR A;  4O2A B;  4O2B B;  1VK3 A;  3V7Q A;  1RQ2 A;  3K12 A;  5GIP C;  2DT4 A;  3WGN A;  2ZOV A;  4M8I A;  4X3M A;  2GVI A;  2LBT A;  5EB0 A;  4NUT A;  4O4J A;  1OAP A;  1SDS A;  2LCA A;  5CB4 A;  2HP3 A;  3DDN A;  3P0Z A;  4IHJ B;  4O4I B;  4ZHY B;  5MN5 A;  3ZP4 A;  3HKB B;  1JFF A;  2R6R 1;  4DXD A;  3MQW A;  3RYF A;  5IJ0 A;  3S0H A;  3WGJ A;  3RYI B;  3RYH B;  3PLA C;  1W5F A;  3OBY A;  4HNA A;  3G6E F;  2ZVZ A;  3FFM A;  5EWR A;  3QTY A;  1JN1 A;  3JAK B;  1QVF F;  4BVS A;  1U43 A;  3F0G A;  5HXZ A;  5GIN C;  4O4J B;  3J81 M;  4I50 B;  2KGW A;  1VQM F;  2VAP A;  5HP7 A;  5KMG B;  1M1K H;  1VH8 A;  1VQ7 F;  4IHJ A;  1XRG A;  3RYI A;  2AMT A;  3F6M A;  4HNA B;  4C82 A;  5AVM A;  1U3P A;  3KIZ A;  2HVY D;  2AIF A;  3G71 F;  5HXU A;  3N4Z A;  5FNV B;  3CG6 A;  5BMV B;  2QTP A;  5J2T A;  3VTI C;  5KMG A;  1H7M A;  3CCM F;  2VAM A;  1RA4 A;  3S0Y A;  3CXC F;  3V3T A;  3HKE B;  3RE3 A;  4BT7 A;  5LP6 C;  2Q1X A;  5FJ4 C;  3N2K A;  3T80 A;  5JCO C;  2BTO A;  3RYC A;  3JAS B;  2QA4 F;  1N8R H;  1YI2 F;  5JCO A;  3D54 A;  3C9T A;  3VOA A;  3WJQ A;  3CCV F;  1CN7 A;  2F9Z C;  5EYP B;  5LP6 A;  1COM A;  4IIJ A;  1E7K A;  3CMA F;  1K8A H;  3IKE A;  4WBN B;  3CCU F;  1YGY A;  3CCL F;  2IG8 A;  5EIB D;  2CSL A;  1JD1 A;  2VGM A;  4ZHQ A;  3WGM A;  3FD6 A;  2CZW A;  3JAT B;  4X1Y B;  4ZHW A;  3D00 A;  3E20 B;  1Q82 H;  1FSZ A;  1FFX A;  5GAP K;  3Q8H A;  2Z01 A;  4BT2 A;  4ZI7 B;  2FGY A;  1YIT F;  5CA1 A;  2ZOD A;  3V7E A;  2KTU A;  2UZH A;  4FFB B;  3C9R A;  1IV3 A;  2Z1F A;  1W5A A;  3LYB A;  1U3L A;  3PAF A;  4TV8 B;  4U3J B;  1Q7Y H;  3ON1 A;  1GO1 A;  4WBN A;  2HRU A;  4NQ3 A;  1Q81 H;  3CCQ F;  3TD3 A;  5LXT A;  2LBW A;  2OHW A;  2HRY A;  3JAT A;  2KTV A;  3WGK A;  3OBW A;  3K2X A;  2AIZ P;  2ZF8 A;  1FFX B;  2H6L A;  1VQ9 F;  5FLX M;  3JVH A;  4TUY A;  2UYJ A;  3JAM M;  3TD4 A;  2I6R A;  4LCK A;  3ZOP A;  3ERN A;  1IPA A;  2B33 A;  2OTM A;  3CCS F;  4FFB A;  3CC4 F;  4B46 A;  3CPW F;  3P4E A;  4TV8 A;  1VHA A;  3I3F A;  3JAL A;  4R40 B;  3NVI B;  5KX5 B;  1TVK A;  4G4Y A;  1VQV A;  4O4H A;  2YYE A;  3HKC A;  1ZWZ A;  5MN4 A;  5LA6 A;  3WGL A;  3KJJ A;  4EB6 A;  2FC3 A;  3E22 A;  4ERH A;  4ZHV A;  2ZVY A;  2GLZ A;  2R75 1;  3IEQ A;  5HP8 A;  3WJR A;  4XCQ A;  5IYZ A;  4ZOL B;  1H47 A;  3HTN A;  2HS0 A;  1TUB A;  2RHL A;  2CWJ A;  2OZB A;  3NK6 A;  3HJW C;  4X1K A;  5LOV A;  5KX5 A;  1TVK B;  1X7P A;  2DYY A;  2PMP A;  5ITZ B;  1VQN F;  2HS4 A;  5C8Y A;  1W2B F;  1U40 A;  4X20 B;  1R1M A;  3VYT C;  2QEX F;  3CCR F;  4X1I B;  4RQO A;  3SIU A;  3KE1 A;  4BT4 A;  1W5E A;  5HY1 A;  2UYN B;  5IYZ B;  1KC8 H;  5IJ9 B;  3HKD B;  3VIU A;  2CHT A;  4YJ2 B;  4BVR A;  3KJK A;  4O2B A;  5EAZ A;  3CCE F;  4G4V A;  3IKF A;  3CC2 F;  5LOV B;  5B8F A;  1Q86 H;  1PF5 A;  3GHZ A;  1T0A A;  1VQO F;  3B6N A;  3U0O A;  1JJ2 F;  1SA0 A;  2VXY A;  3VCZ A;  5C8Y B;  3TD5 A;  3IEW A;  4TV9 B;  3UT5 B;  4X1I A;  1Q8R A;  5JVD A;  3OW2 F;  1VQP F;  1W42 A;  4G4Z A;  4B5C A;  5IJ9 A;  4U39 A;  3WPX A;  2BTU A;  3L7Q A;  3RYF B;  5IJ0 B;  3E1Y A;  1X7O A;  4YJ2 A;  3O85 A;  1ODE A;  3LDT A;  3RYH A;  5LYJ B;  3C9S A;  5JH7 B;  1XHO A;  2LBX A;  4G4X A;  4E6E A;  4PWT A;  5JQG B;  3JAK A;  3S06 A;  1KQS F;  3HWU A;  3VOB A;  1YJW F;  1VQL F;  2OTJ F;  5EZY A;  3MBM A;  1W5B A;  4TV9 A;  3UT5 A;  3LWO C;  2MQE A;  1X25 A;  3EOR A;  4O4L A;  4B62 A;  4I4T B;  3LWR C;  1CK2 A;  3R0P A;  4O2A A;  3ZP7 A;  5JH7 A;  1H48 A;  2HS3 A;  3LWQ C;  3N4Y A;  4EI7 A;  4DRX A;  1W57 A;  3AGK A;  2GZL A;  3LFO A;  5BMV A;  1QAH A;  3F0E A;  1FNJ A;  3M84 A;  3QHD A;  4O4I A;  1QD9 A;  3GTZ A;  4EI9 A;  1JFF B;  4O4L B;  1IV4 A;  4I4T A;  5G4V C;  3VYU C;  3F0F A;  1VQ5 F;  1UI9 A; 
#chains in the Genus database with same CATH homology
 4G4Z A;  4B5C A;  3S0H A;  3WPW A;  4G4W A;  3OON A;  3WPX A;  3CYP B;  3CYQ A;  3KHN A;  2AIZ P;  4ZHW A;  3S03 A;  2ZF8 A;  3LDT A;  2HQS C;  3S0W A;  2ZVZ A;  3TD4 A;  5EAZ A;  4G4V A;  2K1S A;  4G4X A;  2W8B C;  4PWT A;  2ZOV A;  3S06 A;  4G88 A;  4R40 B;  2LBT A;  5EB0 A;  2N48 A;  2KGW A;  3TD3 A;  4G4Y A;  4RHA A;  3S02 A;  4B62 A;  1OAP A;  3S0Y A;  2LCA A;  3TD5 A;  4ZHY B;  2MQE A;  2L26 A;  4ERH A;  4ZHV A;  1R1M A;  5EB1 B;  3IMP A;  2ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...