3CC4F

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc4F00
3HJWC 3JAMM 1VQNF 4TZZA 1M1KH 1K9MH 5G4VC 1GO1A 2KG4A 2CZWA 1X52A 1NMUB 1RA4A 3AGKA 1GZ0A 3CCRF 3JCMM 5GINC 3OBWA 1KQSF 2HVYD 3G6EF 2WALA 3I56F 2FC3A 1IPAA 3V7QA 3CCJF 3J80M 1Q81H 1VQ9F 3J7AR 2I6DA 1VQ5F 3SIVA 2OHWA 3PAFA 5GAPK 1Q82H 3N4YA 5FLXM 3NK7A 5FJ4C 1YJ9F 3J81M 1W42A 2VGNA 3ON1A 3RA6A 2VGMA 1W2BF 2JNBA 2KTVA 3CCMF 1VQLF 1W40A 3NK6A 1DT9A 3E20B 3NVKE 1K8AH 1VQKF 3CCLF 4BW0B 3E1YA 2OZBA 1VQOF 3VI6A 3CC2F 5IT9M 1NJIH 1S72F 3OW2F 3WXMB 1VQPF 1VQ6F 2QA4F 4X3LA 3LWRC 2QEXF 1JJ2F 5GANK 1GO0A 1H7MA 3CCSF 1VQMF 2KTUA 3HAXD 1CN7A 3CMAF 1YI2F 3G71F 3LWOC 1YJNF 2ALEA 1QVFF 3CD6F 3O85A 2LBXA 3NMUC 5DCVA 1QVGF 3LWVC 4BY9D 3VMFB 1VQ7F 3LFOA 3IR9A 1Q7YH 3CCQF 3SIUA 3CC7F 5GIOC 1CK2A 1RLGA 1N8RH 4X3MA 5G4UC 1KC8H 1K73H 2QI2A 3MCAB 1X7PA 3CCVF 3LWQC 1VQ8F 3V7EA 1SDSA 3RA5A 1VQ4F 3CG6A 3I55F 5EO3A 3CXCF 1Q86H 4LCKA 1W3EX 2LBWA 1M90H 1ZWZA 2OTJF 1XBIA 4C4WC 3CPWF 3GYQA 1YIJF 1E7KA 1T0KB 2BO1A 5EWRA 3CC4F 3N4ZA 1PXWA 3FFMA 3G4SF 3PLAC 3CPQA 5GIPC 3CCEF 4NUTA 3OBYA 1YHQF 5A2QM 1KD1H 2OTLF 3NVIB 3CMEF 3CCUF 2AIFA 1W41A 3LWPC 1YITF 1X7OA 1YJWF
chains in the Genus database with same CATH superfamily
5CB4A 3S0YA 3HJWC 2VAMA 3WGLA 5G4VC 1GO1A 1TVKB 4TUYA 2HRYA 4BVQA 1KQSF 3CCRF 5HP8A 3OBWA 3HKDB 2GZLA 3K12A 3G6EF 2WALA 2FC3A 1IPAA 2UYNB 5JVDB 3BYQA 3M1XA 5IJ9B 4TV9B 4I55B 3MBMA 3T80A 5HXUA 2OHWA 4DXDA 3SIVA 3HKEA 5EB0A 5IJ0A 5GAPK 2LCAA 4M8IA 3N4YA 3UT5A 1IV4A 3RYFB 4C8GA 3J81M 2VGNA 2RHOA 2VGMA 3P10A 4ZHQA 1JN1A 4ZI7A 2Z1TA 1W40A 5CB4B 1UI9A 4G88A 3KIZA 2OZBA 4TUYB 3VI6A 1S72F 2Z1UA 2GLZA 4X3LA 2QEXF 5GANK 3V4DA 4C8EA 5LOVA 4BT6A 2KTUA 3VCZA 4G4XA 1CN7A 1W581 2AIZP 4F6RA 4ZK7A 3G71F 1ONIA 1RLUA 3HKEB 2VXYA 3QUWA 3O85A 3UT5B 1QU9A 2ZAUA 3C9SA 4EI7A 2ZVYA 5EYPA 4BT5A 3TD3A 3HWUA 3QHDA 3VMFB 4ZHQB 1VQ7F 3C9UA 3I7TA 3LFOA 4ZI7B 2OTMA 2HS4A 5CA0A 5B8FA 4BT7A 5GIOC 1N8RH 5G4UC 2UZHA 4IIJA 1K73H 2QI2A 2I6RA 3F0FA 2HS3A 1TUBA 3LYBA 1VQ8F 3LDTA 3V7EA 1DBFA 3RA5A 3I55F 5LOVB 1R1MA 2R6R1 3WJRA 4F6RB 1W3EX 2LBWA 1PF5A 1XBIA 2ZVZA 2Z1FA 3JARB 5LYJB 5EYPB 3K14A 3S0HA 4NQ3A 3JATA 1PXWA 3JAKA 3F6MA 4BVTA 1SA0A 4ERHA 5CA0B 3PLAC 2GVIA 1H47A 2HX0A 4NUTA 3OBYA 1TUBB 1YHQF 1KNKA 4B45A 1KD1H 2OTLF 3CCUF 4FFBA 1YITF 3FD6A 4RQOA 3S02A 5HY4A 2ZF8A 1U40A 5LXTA 1M1KH 1FNJA 5GONA 2Q1XA 3VYSC 1RA4A 1GZ0A 2MQEA 3I56F 4HNAA 3VOAA 1J7HA 3J80M 2Z01A 4TV9A 1IV1A 3VYUC 3J7AR 4R40B 2N48A 3JATB 1VQ5F 2YYEA 2W8BC 3JAKB 2HP3A 1Q8RA 5KX5A 2CWJA 2BTQB 3ZP7A 2YXZA 4XCQA 1W42A 4RHAA 3RYCA 4FFBB 3CYQA 3ERNA 1W2BF 3CCMF 1XRGA 1DT9A 1OAPA 3DC2A 3E20B 5LXTB 1VQKF 4BW0B 3DDNA 5GONB 2NMUA 2R751 1FFXB 3S06A 3S03A 2QA4F 4HNAB 4BVRA 2PMPA 2IAFA 3C9TA 4ZHVA 1GO0A 1H7MA 3OONA 3VTIC 1VQMF 4ZOLB 4KWEA 1T0AA 2ALEA 3M4SA 5KX5B 3P4EA 3IEWA 3C9RA 1NQ3A 3RYCB 3P0ZA 4C8IA 5HXZA 1Q7YH 3CCQF 3JALA 5FNVA 1Z5WA 1RLGA 1KC8H 2HQSC 1RQ7A 5BMVB 1X7PA 4O2BA 5EO3A 3CXCF 1OFUA 1H48A 5EIBD 5LA6A 4O4LA 1QAHA 4BT4A 3IEQA 3JARA 4I50A 5LYJA 2ZODA 3GYQA 4ZHWA 1E7KA 3D01A 5MN6A 1YGYA 2BO1A 1KNJA 5IYZA 5EWRA 5CA1A 5JCOA 3FFMA 4U3JA 3JALB 3HKBB 5FNVB 3G4SF 4LNUB 4O2AA 2UYJA 1X25A 2RB9A 3CPQA 3ZO8A 5GIPC 1VQVA 4DRXA 4TV8A 3FBAA 4O2BB 3CMEF 4I4TA 1W41A 1YJWF 1FSZA 5EAZA 5LA6B 2KG4A 2CZWA 3VO8A 4O4LB 1X52A 3F0GA 4ZHYB 4I50B 3AGKA 3JCMM 5GINC 4IHJB 5J2UA 4BT3A 3ESJA 3CCJF 5IYZB 3JVHA 1VQ9F 2I6DA 4G4YA 2HRUA 5CA1B 4U3JB 5C8YA 3PAFA 4G4VA 1Q82H 1ODEA 3MCQA 4O2AB 4G4WA 5FLXM 1W59A 2VAPA 1YJ9F 3JAWA 4DRXB 4TV8B 4WBNA 4I4TB 4X1KA 4B46A 4EI9A 1VQLF 2V9YA 1YQNA 2CHTA 3NK6A 4O4IA 3E22A 3NVKE 1FFXA 3IMPA 5LP6A 3CC2F 5IT9M 1NJIH 3MDOA 5MN5A 5J2UB 1VQPF 4C81A 3LWRC 1JJ2F 4ZOLA 2LBTA 2DT4A 3ZOPA 3FPIA 3HAXD 1W5BA 3HKCA 5EB1B 2RHHA 4E6EA 3CB2A 3Q8HA 5C8YB 3LWOC 1YJNF 3D54A 3CD6F 3NMUC 5DCVA 3VIUA 1QVGF 3KJKA 3WPWA 2IG8A 1JD1A 3JAWB 1CLIA 3F0DA 3WJQA 2B33A 4WBNB 1GX1A 3CYPB 3IR9A 4X1KB 1FNKA 2RHLA 4X1YA 3SIUA 4O4IB 3E22B 3CC7F 1QD9A 1CK2A 5BMVA 5LP6B 5HY0A 3K2XA 2Q1YA 3MCAB 5EZYA 3WJPA 3CCVF 3C8LA 3V3TA 3VYTC 1SDSA 4U39A 3KJJA 1W55A 1XV2A 3CG6A 3HKCB 1Q86H 2HP0B 4LCKA 1ZWZA 3CPWF 3F0EA 3U0OA 3JASA 5JCOC 3CC4F 3HTNA 1W57A 3HKBA 2RHJA 4LNUA 3S0WA 4X1YB 5JH7A 3TD5A 2KGWA 1W5AA 2H8EA 3RYHA 4C82A 2UYKA 3RYIA 3QTYA 5EZYB 4O4HA 3WGNA 2AMTA 3KE1A 3EORA 1K9MH 1XHOA 3JAMM 1VQNF 3I3FA 5EIBC 4BT2A 4TZZA 3FD5A 3K0TA 4IHJA 4O4JA 1NMUB 4X20A 2HVYD 1U3PA 2FGYA 3IKFA 3GHZA 5HWEA 3JASB 3GTZA 2QTPA 3V7QA 2F9ZC 1Q81H 4EB6A 3WGKA 3TD4A 2VAWA 2H6LA 3WGJA 5ITZA 2DYYA 3ELCA 5JH7B 4YJ2A 3VOBA 1SZQA 5KMGA 3RYHB 3NK7A 5IJ0B 2PHNA 4G4ZA 3RYIB 5FJ4C 3KHNA 4O4HB 3ON1A 3RA6A 2JNBA 2KTVA 3WPXA 2HS0A 4BVSA 5LP6C 1K8AH 1IV2A 3IKEA 3RE3A 3CCLF 1RQ2A 3E1YA 4EI8A 1VQOF 4O4JB 4X20B 3OW2F 3MQWA 3WXMB 2BTUA 1VQ6F 5J2TA 2BTOA 3ZP4A 1VH8A 4EB6B 1VHAA 2P6YA 3R0PA 2ZOVA 3CCSF 2CVLA 5HP7A 5JQGA 3CMAF 5ITZB 1YI2F 1JFFA 2IQQA 3M84A 4YJ2B 2EWCA 4X1IA 1QVFF 2Z1EA 2LBXA 5KMGB 4YJ3A 3LWVC 3D00A 4BY9D 2L26A 4PWTA 5AVMA 2K1SA 3N2GA 4X3MA 5MN4A 4IIJB 3N2KA 3LWQC 5J2TB 4NWOB 1VQ4F 3B6NA 2HP0A 1COMA 5JQGB 2OTJF 3LMEA 1M90H 1TVKA 1JFFB 2G9IA 4C4WC 4X1IB 3WGMA 4B5CA 1YIJF 3HKDA 4YJ3B 1U3LA 1T0KB 2UYNA 5JVDA 5HY1A 1IV3A 3N4ZA 5IJ9A 2CW4A 1Z5VA 4I55A 5HY2A 3L7QA 2UYPA 4B62A 1SA0B 1VK3A 3N2GB 1U43A 1W5EA 3RYFA 3CCEF 2H8CA 1UFYA 5A2QM 1JY8A 1W5FA 3N2KB 3NVIB 2CHSA 2AIFA 3LWPC 1X7OA 2CSLA
chains in the Genus database with same CATH topology
3HJWC 3JAMM 1VQNF 4TZZA 1M1KH 1K9MH 5G4VC 1GO1A 2KG4A 2CZWA 1X52A 4BVQA 1NMUB 1RA4A 3AGKA 1GZ0A 3CCRF 3JCMM 2FGYA 3OBWA 5GINC 1KQSF 2HVYD 3G6EF 5HWEA 2WALA 3I56F 2FC3A 1IPAA 2F9ZC 3V7QA 3J80M 3CCJF 1Q81H 1VQ9F 3J7AR 2I6DA 1VQ5F 3SIVA 5HXUA 2OHWA 3PAFA 5GAPK 1Q82H 3N4YA 5FLXM 3NK7A 5FJ4C 1YJ9F 3J81M 4XCQA 1W42A 2VGNA 3ON1A 3RA6A 2VGMA 1W2BF 2JNBA 2KTVA 3CCMF 4EI9A 1VQLF 1W40A 4BVSA 3NK6A 1DT9A 3E20B 3NVKE 1K8AH 1VQKF 3CCLF 4BW0B 3E1YA 2OZBA 4EI8A 3VI6A 1VQOF 3CC2F 5IT9M 1NJIH 1S72F 3OW2F 3WXMB 1VQPF 2GLZA 1VQ6F 2QA4F 4X3LA 3LWRC 2QEXF 1JJ2F 4BVRA 5GANK 1GO0A 1H7MA 3CCSF 1VQMF 2KTUA 3HAXD 1CN7A 3CMAF 1YI2F 3G71F 3LWOC 1YJNF 2ALEA 1QVFF 3CD6F 3O85A 2LBXA 4EI7A 3NMUC 5DCVA 1QVGF 3LWVC 3D00A 4BY9D 3VMFB 1VQ7F 3LFOA 3IR9A 5HXZA 1Q7YH 3CCQF 3SIUA 3CC7F 5GIOC 1CK2A 1RLGA 1N8RH 4X3MA 5G4UC 1KC8H 5HY0A 1K73H 2QI2A 3MCAB 1X7PA 3CCVF 3LWQC 1VQ8F 3V3TA 3V7EA 1SDSA 3RA5A 1VQ4F 3CG6A 3I55F 5EO3A 3CXCF 1Q86H 4LCKA 1W3EX 2LBWA 1M90H 1ZWZA 2OTJF 1XBIA 4C4WC 3CPWF 3GYQA 1YIJF 1E7KA 1T0KB 2BO1A 4NQ3A 5HY1A 5EWRA 3CC4F 3N4ZA 1PXWA 5HY2A 3FFMA 4BVTA 3G4SF 3PLAC 3CPQA 5GIPC 3CCEF 4NUTA 3OBYA 1YHQF 5A2QM 1KD1H 2OTLF 3NVIB 3CMEF 3CCUF 2AIFA 1W41A 3LWPC 1YITF 1X7OA 5HY4A 1YJWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJW C;  3JAM M;  1VQN F;  4TZZ A;  1M1K H;  1K9M H;  5G4V C;  1GO1 A;  2KG4 A;  2CZW A;  1X52 A;  1NMU B;  1RA4 A;  3AGK A;  1GZ0 A;  3CCR F;  3JCM M;  5GIN C;  3OBW A;  1KQS F;  2HVY D;  3G6E F;  2WAL A;  3I56 F;  2FC3 A;  1IPA A;  3V7Q A;  3CCJ F;  3J80 M;  1Q81 H;  1VQ9 F;  3J7A R;  2I6D A;  1VQ5 F;  3SIV A;  2OHW A;  3PAF A;  5GAP K;  1Q82 H;  3N4Y A;  5FLX M;  3NK7 A;  5FJ4 C;  1YJ9 F;  3J81 M;  1W42 A;  2VGN A;  3ON1 A;  3RA6 A;  2VGM A;  1W2B F;  2JNB A;  2KTV A;  3CCM F;  1VQL F;  1W40 A;  3NK6 A;  1DT9 A;  3E20 B;  3NVK E;  1K8A H;  1VQK F;  3CCL F;  4BW0 B;  3E1Y A;  2OZB A;  1VQO F;  3VI6 A;  3CC2 F;  5IT9 M;  1NJI H;  1S72 F;  3OW2 F;  3WXM B;  1VQP F;  1VQ6 F;  2QA4 F;  4X3L A;  3LWR C;  2QEX F;  1JJ2 F;  5GAN K;  1GO0 A;  1H7M A;  3CCS F;  1VQM F;  2KTU A;  3HAX D;  1CN7 A;  3CMA F;  1YI2 F;  3G71 F;  3LWO C;  1YJN F;  2ALE A;  1QVF F;  3CD6 F;  3O85 A;  2LBX A;  3NMU C;  5DCV A;  1QVG F;  3LWV C;  4BY9 D;  3VMF B;  1VQ7 F;  3LFO A;  3IR9 A;  1Q7Y H;  3CCQ F;  3SIU A;  3CC7 F;  5GIO C;  1CK2 A;  1RLG A;  1N8R H;  4X3M A;  5G4U C;  1KC8 H;  1K73 H;  2QI2 A;  3MCA B;  1X7P A;  3CCV F;  3LWQ C;  1VQ8 F;  3V7E A;  1SDS A;  3RA5 A;  1VQ4 F;  3CG6 A;  3I55 F;  5EO3 A;  3CXC F;  1Q86 H;  4LCK A;  1W3E X;  2LBW A;  1M90 H;  1ZWZ A;  2OTJ F;  1XBI A;  4C4W C;  3CPW F;  3GYQ A;  1YIJ F;  1E7K A;  1T0K B;  2BO1 A;  5EWR A;  3CC4 F;  3N4Z A;  1PXW A;  3FFM A;  3G4S F;  3PLA C;  3CPQ A;  5GIP C;  3CCE F;  4NUT A;  3OBY A;  1YHQ F;  5A2Q M;  1KD1 H;  2OTL F;  3NVI B;  3CME F;  3CCU F;  2AIF A;  1W41 A;  3LWP C;  1YIT F;  1X7O A;  1YJW F; 
#chains in the Genus database with same CATH topology
 5CB4 A;  3S0Y A;  3HJW C;  2VAM A;  3WGL A;  5G4V C;  1GO1 A;  1TVK B;  4TUY A;  2HRY A;  4BVQ A;  1KQS F;  3CCR F;  5HP8 A;  3OBW A;  3HKD B;  2GZL A;  3K12 A;  3G6E F;  2WAL A;  2FC3 A;  1IPA A;  2UYN B;  5JVD B;  3BYQ A;  3M1X A;  5IJ9 B;  4TV9 B;  4I55 B;  3MBM A;  3T80 A;  5HXU A;  2OHW A;  4DXD A;  3SIV A;  3HKE A;  5EB0 A;  5IJ0 A;  5GAP K;  2LCA A;  4M8I A;  3N4Y A;  3UT5 A;  1IV4 A;  3RYF B;  4C8G A;  3J81 M;  2VGN A;  2RHO A;  2VGM A;  3P10 A;  4ZHQ A;  1JN1 A;  4ZI7 A;  2Z1T A;  1W40 A;  5CB4 B;  1UI9 A;  4G88 A;  3KIZ A;  2OZB A;  4TUY B;  3VI6 A;  1S72 F;  2Z1U A;  2GLZ A;  4X3L A;  2QEX F;  5GAN K;  3V4D A;  4C8E A;  5LOV A;  4BT6 A;  2KTU A;  3VCZ A;  4G4X A;  1CN7 A;  1W58 1;  2AIZ P;  4F6R A;  4ZK7 A;  3G71 F;  1ONI A;  1RLU A;  3HKE B;  2VXY A;  3QUW A;  3O85 A;  3UT5 B;  1QU9 A;  2ZAU A;  3C9S A;  4EI7 A;  2ZVY A;  5EYP A;  4BT5 A;  3TD3 A;  3HWU A;  3QHD A;  3VMF B;  4ZHQ B;  1VQ7 F;  3C9U A;  3I7T A;  3LFO A;  4ZI7 B;  2OTM A;  2HS4 A;  5CA0 A;  5B8F A;  4BT7 A;  5GIO C;  1N8R H;  5G4U C;  2UZH A;  4IIJ A;  1K73 H;  2QI2 A;  2I6R A;  3F0F A;  2HS3 A;  1TUB A;  3LYB A;  1VQ8 F;  3LDT A;  3V7E A;  1DBF A;  3RA5 A;  3I55 F;  5LOV B;  1R1M A;  2R6R 1;  3WJR A;  4F6R B;  1W3E X;  2LBW A;  1PF5 A;  1XBI A;  2ZVZ A;  2Z1F A;  3JAR B;  5LYJ B;  5EYP B;  3K14 A;  3S0H A;  4NQ3 A;  3JAT A;  1PXW A;  3JAK A;  3F6M A;  4BVT A;  1SA0 A;  4ERH A;  5CA0 B;  3PLA C;  2GVI A;  1H47 A;  2HX0 A;  4NUT A;  3OBY A;  1TUB B;  1YHQ F;  1KNK A;  4B45 A;  1KD1 H;  2OTL F;  3CCU F;  4FFB A;  1YIT F;  3FD6 A;  4RQO A;  3S02 A;  5HY4 A;  2ZF8 A;  1U40 A;  5LXT A;  1M1K H;  1FNJ A;  5GON A;  2Q1X A;  3VYS C;  1RA4 A;  1GZ0 A;  2MQE A;  3I56 F;  4HNA A;  3VOA A;  1J7H A;  3J80 M;  2Z01 A;  4TV9 A;  1IV1 A;  3VYU C;  3J7A R;  4R40 B;  2N48 A;  3JAT B;  1VQ5 F;  2YYE A;  2W8B C;  3JAK B;  2HP3 A;  1Q8R A;  5KX5 A;  2CWJ A;  2BTQ B;  3ZP7 A;  2YXZ A;  4XCQ A;  1W42 A;  4RHA A;  3RYC A;  4FFB B;  3CYQ A;  3ERN A;  1W2B F;  3CCM F;  1XRG A;  1DT9 A;  1OAP A;  3DC2 A;  3E20 B;  5LXT B;  1VQK F;  4BW0 B;  3DDN A;  5GON B;  2NMU A;  2R75 1;  1FFX B;  3S06 A;  3S03 A;  2QA4 F;  4HNA B;  4BVR A;  2PMP A;  2IAF A;  3C9T A;  4ZHV A;  1GO0 A;  1H7M A;  3OON A;  3VTI C;  1VQM F;  4ZOL B;  4KWE A;  1T0A A;  2ALE A;  3M4S A;  5KX5 B;  3P4E A;  3IEW A;  3C9R A;  1NQ3 A;  3RYC B;  3P0Z A;  4C8I A;  5HXZ A;  1Q7Y H;  3CCQ F;  3JAL A;  5FNV A;  1Z5W A;  1RLG A;  1KC8 H;  2HQS C;  1RQ7 A;  5BMV B;  1X7P A;  4O2B A;  5EO3 A;  3CXC F;  1OFU A;  1H48 A;  5EIB D;  5LA6 A;  4O4L A;  1QAH A;  4BT4 A;  3IEQ A;  3JAR A;  4I50 A;  5LYJ A;  2ZOD A;  3GYQ A;  4ZHW A;  1E7K A;  3D01 A;  5MN6 A;  1YGY A;  2BO1 A;  1KNJ A;  5IYZ A;  5EWR A;  5CA1 A;  5JCO A;  3FFM A;  4U3J A;  3JAL B;  3HKB B;  5FNV B;  3G4S F;  4LNU B;  4O2A A;  2UYJ A;  1X25 A;  2RB9 A;  3CPQ A;  3ZO8 A;  5GIP C;  1VQV A;  4DRX A;  4TV8 A;  3FBA A;  4O2B B;  3CME F;  4I4T A;  1W41 A;  1YJW F;  1FSZ A;  5EAZ A;  5LA6 B;  2KG4 A;  2CZW A;  3VO8 A;  4O4L B;  1X52 A;  3F0G A;  4ZHY B;  4I50 B;  3AGK A;  3JCM M;  5GIN C;  4IHJ B;  5J2U A;  4BT3 A;  3ESJ A;  3CCJ F;  5IYZ B;  3JVH A;  1VQ9 F;  2I6D A;  4G4Y A;  2HRU A;  5CA1 B;  4U3J B;  5C8Y A;  3PAF A;  4G4V A;  1Q82 H;  1ODE A;  3MCQ A;  4O2A B;  4G4W A;  5FLX M;  1W59 A;  2VAP A;  1YJ9 F;  3JAW A;  4DRX B;  4TV8 B;  4WBN A;  4I4T B;  4X1K A;  4B46 A;  4EI9 A;  1VQL F;  2V9Y A;  1YQN A;  2CHT A;  3NK6 A;  4O4I A;  3E22 A;  3NVK E;  1FFX A;  3IMP A;  5LP6 A;  3CC2 F;  5IT9 M;  1NJI H;  3MDO A;  5MN5 A;  5J2U B;  1VQP F;  4C81 A;  3LWR C;  1JJ2 F;  4ZOL A;  2LBT A;  2DT4 A;  3ZOP A;  3FPI A;  3HAX D;  1W5B A;  3HKC A;  5EB1 B;  2RHH A;  4E6E A;  3CB2 A;  3Q8H A;  5C8Y B;  3LWO C;  1YJN F;  3D54 A;  3CD6 F;  3NMU C;  5DCV A;  3VIU A;  1QVG F;  3KJK A;  3WPW A;  2IG8 A;  1JD1 A;  3JAW B;  1CLI A;  3F0D A;  3WJQ A;  2B33 A;  4WBN B;  1GX1 A;  3CYP B;  3IR9 A;  4X1K B;  1FNK A;  2RHL A;  4X1Y A;  3SIU A;  4O4I B;  3E22 B;  3CC7 F;  1QD9 A;  1CK2 A;  5BMV A;  5LP6 B;  5HY0 A;  3K2X A;  2Q1Y A;  3MCA B;  5EZY A;  3WJP A;  3CCV F;  3C8L A;  3V3T A;  3VYT C;  1SDS A;  4U39 A;  3KJJ A;  1W55 A;  1XV2 A;  3CG6 A;  3HKC B;  1Q86 H;  2HP0 B;  4LCK A;  1ZWZ A;  3CPW F;  3F0E A;  3U0O A;  3JAS A;  5JCO C;  3CC4 F;  3HTN A;  1W57 A;  3HKB A;  2RHJ A;  4LNU A;  3S0W A;  4X1Y B;  5JH7 A;  3TD5 A;  2KGW A;  1W5A A;  2H8E A;  3RYH A;  4C82 A;  2UYK A;  3RYI A;  3QTY A;  5EZY B;  4O4H A;  3WGN A;  2AMT A;  3KE1 A;  3EOR A;  1K9M H;  1XHO A;  3JAM M;  1VQN F;  3I3F A;  5EIB C;  4BT2 A;  4TZZ A;  3FD5 A;  3K0T A;  4IHJ A;  4O4J A;  1NMU B;  4X20 A;  2HVY D;  1U3P A;  2FGY A;  3IKF A;  3GHZ A;  5HWE A;  3JAS B;  3GTZ A;  2QTP A;  3V7Q A;  2F9Z C;  1Q81 H;  4EB6 A;  3WGK A;  3TD4 A;  2VAW A;  2H6L A;  3WGJ A;  5ITZ A;  2DYY A;  3ELC A;  5JH7 B;  4YJ2 A;  3VOB A;  1SZQ A;  5KMG A;  3RYH B;  3NK7 A;  5IJ0 B;  2PHN A;  4G4Z A;  3RYI B;  5FJ4 C;  3KHN A;  4O4H B;  3ON1 A;  3RA6 A;  2JNB A;  2KTV A;  3WPX A;  2HS0 A;  4BVS A;  5LP6 C;  1K8A H;  1IV2 A;  3IKE A;  3RE3 A;  3CCL F;  1RQ2 A;  3E1Y A;  4EI8 A;  1VQO F;  4O4J B;  4X20 B;  3OW2 F;  3MQW A;  3WXM B;  2BTU A;  1VQ6 F;  5J2T A;  2BTO A;  3ZP4 A;  1VH8 A;  4EB6 B;  1VHA A;  2P6Y A;  3R0P A;  2ZOV A;  3CCS F;  2CVL A;  5HP7 A;  5JQG A;  3CMA F;  5ITZ B;  1YI2 F;  1JFF A;  2IQQ A;  3M84 A;  4YJ2 B;  2EWC A;  4X1I A;  1QVF F;  2Z1E A;  2LBX A;  5KMG B;  4YJ3 A;  3LWV C;  3D00 A;  4BY9 D;  2L26 A;  4PWT A;  5AVM A;  2K1S A;  3N2G A;  4X3M A;  5MN4 A;  4IIJ B;  3N2K A;  3LWQ C;  5J2T B;  4NWO B;  1VQ4 F;  3B6N A;  2HP0 A;  1COM A;  5JQG B;  2OTJ F;  3LME A;  1M90 H;  1TVK A;  1JFF B;  2G9I A;  4C4W C;  4X1I B;  3WGM A;  4B5C A;  1YIJ F;  3HKD A;  4YJ3 B;  1U3L A;  1T0K B;  2UYN A;  5JVD A;  5HY1 A;  1IV3 A;  3N4Z A;  5IJ9 A;  2CW4 A;  1Z5V A;  4I55 A;  5HY2 A;  3L7Q A;  2UYP A;  4B62 A;  1SA0 B;  1VK3 A;  3N2G B;  1U43 A;  1W5E A;  3RYF A;  3CCE F;  2H8C A;  1UFY A;  5A2Q M;  1JY8 A;  1W5F A;  3N2K B;  3NVI B;  2CHS A;  2AIF A;  3LWP C;  1X7O A;  2CSL A; 
#chains in the Genus database with same CATH homology
 3HJW C;  3JAM M;  1VQN F;  4TZZ A;  1M1K H;  1K9M H;  5G4V C;  1GO1 A;  2KG4 A;  2CZW A;  1X52 A;  4BVQ A;  1NMU B;  1RA4 A;  3AGK A;  1GZ0 A;  3CCR F;  3JCM M;  2FGY A;  3OBW A;  5GIN C;  1KQS F;  2HVY D;  3G6E F;  5HWE A;  2WAL A;  3I56 F;  2FC3 A;  1IPA A;  2F9Z C;  3V7Q A;  3J80 M;  3CCJ F;  1Q81 H;  1VQ9 F;  3J7A R;  2I6D A;  1VQ5 F;  3SIV A;  5HXU A;  2OHW A;  3PAF A;  5GAP K;  1Q82 H;  3N4Y A;  5FLX M;  3NK7 A;  5FJ4 C;  1YJ9 F;  3J81 M;  4XCQ A;  1W42 A;  2VGN A;  3ON1 A;  3RA6 A;  2VGM A;  1W2B F;  2JNB A;  2KTV A;  3CCM F;  4EI9 A;  1VQL F;  1W40 A;  4BVS A;  3NK6 A;  1DT9 A;  3E20 B;  3NVK E;  1K8A H;  1VQK F;  3CCL F;  4BW0 B;  3E1Y A;  2OZB A;  4EI8 A;  3VI6 A;  1VQO F;  3CC2 F;  5IT9 M;  1NJI H;  1S72 F;  3OW2 F;  3WXM B;  1VQP F;  2GLZ A;  1VQ6 F;  2QA4 F;  4X3L A;  3LWR C;  2QEX F;  1JJ2 F;  4BVR A;  5GAN K;  1GO0 A;  1H7M A;  3CCS F;  1VQM F;  2KTU A;  3HAX D;  1CN7 A;  3CMA F;  1YI2 F;  3G71 F;  3LWO C;  1YJN F;  2ALE A;  1QVF F;  3CD6 F;  3O85 A;  2LBX A;  4EI7 A;  3NMU C;  5DCV A;  1QVG F;  3LWV C;  3D00 A;  4BY9 D;  3VMF B;  1VQ7 F;  3LFO A;  3IR9 A;  5HXZ A;  1Q7Y H;  3CCQ F;  3SIU A;  3CC7 F;  5GIO C;  1CK2 A;  1RLG A;  1N8R H;  4X3M A;  5G4U C;  1KC8 H;  5HY0 A;  1K73 H;  2QI2 A;  3MCA B;  1X7P A;  3CCV F;  3LWQ C;  1VQ8 F;  3V3T A;  3V7E A;  1SDS A;  3RA5 A;  1VQ4 F;  3CG6 A;  3I55 F;  5EO3 A;  3CXC F;  1Q86 H;  4LCK A;  1W3E X;  2LBW A;  1M90 H;  1ZWZ A;  2OTJ F;  1XBI A;  4C4W C;  3CPW F;  3GYQ A;  1YIJ F;  1E7K A;  1T0K B;  2BO1 A;  4NQ3 A;  5HY1 A;  5EWR A;  3CC4 F;  3N4Z A;  1PXW A;  5HY2 A;  3FFM A;  4BVT A;  3G4S F;  3PLA C;  3CPQ A;  5GIP C;  3CCE F;  4NUT A;  3OBY A;  1YHQ F;  5A2Q M;  1KD1 H;  2OTL F;  3NVI B;  3CME F;  3CCU F;  2AIF A;  1W41 A;  3LWP C;  1YIT F;  1X7O A;  5HY4 A;  1YJW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...