3CC4F

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc4F00
3CPWF 2ALEA 3RA6A 2I6DA 1YHQF 1NMUB 3CG6A 1ZWZA 3V7QA 3I56F 2VGNA 3J7AR 2LBWA 1W2BF 4X3MA 2QEXF 5A2QM 1Q7YH 1VQ4F 5GAPK 1SDSA 3E1YA 3I55F 1Q81H 1VQKF 1RA4A 1KQSF 3LWOC 1RLGA 3PAFA 3CCMF 1YJ9F 2OTJF 3ON1A 2JNBA 1W42A 1VQ6F 4LCKA 3CCRF 2LBXA 3G6EF 1VQPF 1GZ0A 2OTLF 1NJIH 1VQ7F 3CC7F 1YIJF 1W40A 1PXWA 3CMAF 3SIUA 3N4ZA 3IR9A 3J80M 3AGKA 5G4UC 2QA4F 3CXCF 2CZWA 3CCLF 3E20B 1QVGF 1W41A 3OW2F 3CC4F 5EWRA 3J81M 1KD1H 5GANK 5G4VC 3LWVC 1JJ2F 4TZZA 4BY9D 1VQMF 1GO1A 2KG4A 3OBYA 3FFMA 3CCJF 3CCVF 1DT9A 1M1KH 3V7EA 3NVKE 3LWRC 1W3EX 3RA5A 5GIOC 1VQNF 5FJ4C 3CCUF 2KTVA 1VQOF 3LFOA 3OBWA 3HAXD 3HJWC 5GIPC 4BW0B 2OHWA 3VI6A 1YITF 3LWQC 5EO3A 1VQLF 1E7KA 1GO0A 5IT9M 1K8AH 1M90H 1CK2A 1VQ9F 3G71F 1YJWF 3G4SF 3NMUC 3JCMM 1K73H 1XBIA 3JAMM 1Q82H 4NUTA 3WXMB 4C4WC 3CMEF 3PLAC 2FC3A 3NK7A 1CN7A 3CD6F 3LWPC 1VQ8F 3SIVA 1YI2F 3VMFB 3NVIB 3NK6A 1QVFF 1IPAA 2OZBA 3O85A 3CC2F 1T0KB 5DCVA 5GINC 1H7MA 3CCQF 3CPQA 3CCSF 2WALA 3MCAB 5FLXM 3N4YA 1YJNF 1S72F 1KC8H 2AIFA 3GYQA 2KTUA 3CCEF 1X52A 2VGMA 1X7OA 1VQ5F 1K9MH 1X7PA 2QI2A 1Q86H 1N8RH 2BO1A 4X3LA 2HVYD
chains in the Genus database with same CATH superfamily
3WGNA 2HS4A 3V3TA 2Q1XA 2ALEA 1KNJA 2UYJA 2FGYA 1NMUB 4RHAA 4O4IB 4YJ2B 4ZHQA 3S06A 1JFFB 2VGNA 3RYCA 2HRUA 3HKEB 4B62A 1TVKB 3WPXA 4EB6A 5CA1A 4BT5A 2QEXF 1SDSA 3Q8HA 1COMA 3JVHA 1IV3A 3HKDB 2H8EA 3RYIB 3JALA 4DRXB 1VQ6F 2ZODA 2Z1EA 3GTZA 5LXTB 3VOBA 3CCRF 3V4DA 1GZ0A 2HP3A 2YXZA 4B46A 3S02A 1NJIH 1VQ7F 3M84A 1IV1A 3EORA 5HY4A 4TV8B 3CMAF 3SIUA 3TD3A 3IR9A 5G4UC 2VAWA 4FFBA 1RQ2A 3ERNA 1QVGF 3UT5B 5HY0A 1RLUA 3K14A 1TUBA 3JAWB 4BY9D 2G9IA 1GO1A 3RYHA 3CCJF 1W55A 3FD6A 1YQNA 1M1KH 3CYPB 3V7EA 2HRYA 1W3EX 5EB0A 1W5AA 3WGJA 5GIOC 5ITZA 4BT7A 5FJ4C 1RQ7A 1VQOF 3LFOA 3S0WA 3JARA 4BW0B 2CHSA 3M1XA 3LWQC 3FD5A 5JVDB 1W581 3E22A 1GO0A 4IIJB 5HXUA 3HKBA 3JCMM 4BVTA 4F6RB 1FFXA 5LA6B 3WGKA 2FC3A 3D01A 3NK7A 2GZLA 5GONB 3CD6F 4I4TB 4X20B 5C8YA 3SIVA 3DC2A 4ERHA 1VH8A 3NK6A 4ZHQB 4BT6A 4ZK7A 3VO8A 3P0ZA 2Z1TA 1VHAA 4EB6B 5CA1B 3CCQF 2RHHA 5J2UA 1FSZA 1S72F 5J2TB 1KC8H 4TV9A 1X52A 4U3JA 4B45A 4I50A 2UYKA 1W5EA 4YJ3B 5CB4A 4LNUA 2R6R1 1PF5A 2RHLA 2Z1FA 3OONA 1U3LA 1SA0A 5CA0A 1Z5WA 3RA6A 3IKEA 2LBTA 3JASA 1QU9A 1ZWZA 4FFBB 3JAKB 3J7AR 2H6LA 2LBWA 1W2BF 3F6MA 1Q7YH 2CSLA 4HNAB 3E1YA 5B8FA 5HY1A 1Q81H 2PMPA 1TUBB 3IEQA 5IJ9A 1RA4A 3MDOA 3RYHB 5FNVA 3WJRA 5LYJB 5LOVA 2NMUA 1YJ9F 4ZHWA 3D00A 2DT4A 2JNBA 5LP6C 1R1MA 1KNKA 4U39A 1XV2A 5ITZB 5IYZA 5JH7A 1QD9A 1IV2A 2W8BC 4RQOA 5EYPA 5BMVA 3I7TA 2GLZA 4O4HA 3VTIC 2V9YA 5JCOC 3KE1A 5MN5A 1PXWA 5KX5B 2VAMA 3N4ZA 3E22B 2QA4F 3CXCF 3HKBB 3K12A 4ZI7A 3RE3A 3IKFA 1X25A 3F0FA 1FFXB 3BYQA 1KD1H 2LCAA 5MN6A 5HP8A 5KMGB 3FFMA 3ZP4A 5C8YB 2ZAUA 5IJ0A 3LWRC 3ZO8A 1VQNF 5HP7A 4G88A 3HAXD 3K0TA 4O4LB 3P10A 3VI6A 2OHWA 4O4JA 4BT3A 4EI7A 1YITF 1Q8RA 3LDTA 4TV9B 5EO3A 1T0AA 5EZYB 1E7KA 3C9TA 5IT9M 4U3JB 2CW4A 4G4XA 4I50B 4O2AB 4PWTA 1YJWF 3G4SF 3NMUC 3JAMM 3C8LA 3C9SA 3WXMB 4C4WC 1SA0B 3S03A 3JATA 3LWPC 1GX1A 4ZHVA 2DYYA 3VIUA 4X1YB 3JASB 2IQQA 3ELCA 3NVIB 1IPAA 2OZBA 1UI9A 3CC2F 3N2KB 2UYNB 2RHJA 1QAHA 3MCAB 5HXZA 1U43A 3N4YA 2N48A 5HWEA 2BTQB 3VYUC 2KTUA 3CCEF 5IJ9B 4C8GA 3CB2A 5FNVB 2VAPA 5LOVB 4X1KB 2Z01A 2HP0B 4X3LA 3RYFA 4G4ZA 2CWJA 3CPWF 3D54A 5BMVB 2IG8A 2I6DA 2UYPA 4O4IA 3T80A 2R751 3I56F 3C9UA 2H8CA 3RYCB 2Q1YA 3WPWA 4YJ2A 3HTNA 3WGLA 4ZI7B 1UFYA 5HY2A 3I55F 3MCQA 1CLIA 1VQVA 3HKDA 2RB9A 3JALB 3VYTC 3P4EA 3PAFA 5JQGA 4DRXA 5EIBD 2GVIA 5IJ0B 4LCKA 3FBAA 1W5BA 3KHNA 2LBXA 4KWEA 1H47A 2BTUA 2OTLF 4IHJA 2Z1UA 3S0HA 1YIJF 1DBFA 1W40A 4I55A 3AGKA 3IMPA 3MBMA 2CZWA 2VXYA 1OFUA 3WJPA 3CCLF 3CYQA 1W41A 2L26A 3OW2F 3U0OA 2AIZP 4XCQA 3TD4A 5GANK 1JJ2F 4TZZA 3JAWA 5LP6A 2HS0A 1VQMF 2KG4A 4ZOLA 3JATB 1ONIA 4X1IA 3CCVF 1DT9A 5EB1B 4R40B 2KGWA 5JCOA 3I3FA 1NQ3A 3HJWC 1FNKA 3JARB 4M8IA 3KJKA 3ZP7A 1W57A 2HX0A 1VQLF 2ZVYA 3QTYA 4IIJA 3G71F 4F6RA 4NUTA 3VCZA 5LA6A 3N2GA 4O2BA 4EI9A 3DDNA 5GONA 3IEWA 4I4TA 4X20A 1YI2F 1J7HA 1XRGA 4EI8A 4BT4A 3O85A 1H7MA 5J2UB 4ZHYB 1W5FA 4G4YA 5FLXM 2BTOA 3L7QA 4C8EA 5J2TA 3GYQA 1JN1A 2VGMA 1X7OA 1K9MH 3ESJA 5AVMA 4TUYA 5JQGB 1Q86H 3GHZA 2BO1A 5CB4B 2HS3A 2ZOVA 4LNUB 4YJ3A 3HKCA 4NQ3A 5EIBC 5CA0B 2HVYD 4IHJB 3ZOPA 3B6NA 1YHQF 3F0DA 3CG6A 3V7QA 4WBNA 4I55B 2RHOA 3JAKA 2UZHA 3TD5A 2QTPA 2IAFA 4X3MA 1XHOA 5A2QM 1VQ4F 5GAPK 4HNAA 4BVSA 3M4SA 1VQKF 3R0PA 2OTMA 5LP6B 5MN4A 4ZOLB 4X1IB 1KQSF 2K1SA 3LWOC 1RLGA 4DXDA 5LYJA 3CCMF 2OTJF 3ON1A 2ZF8A 1W42A 3G6EF 4C8IA 2YYEA 1VQPF 5IYZB 5JH7B 5EYPB 4O4HB 3CC7F 2I6RA 2B33A 1Z5VA 5KX5A 1W59A 3J80M 3S0YA 1JFFA 3HKEA 1TVKA 1IV4A 3VYSC 3E20B 4B5CA 3CC4F 5EWRA 4C82A 3KIZA 3J81M 1ODEA 2ZVZA 3F0EA 5G4VC 3LWVC 2EWCA 3K2XA 3N2GB 3OBYA 4O2BB 3RYIA 4E6EA 5KMGA 4NWOB 2F9ZC 3NVKE 1U40A 5LXTA 3RA5A 1H48A 2PHNA 3CCUF 2KTVA 3OBWA 1VK3A 3MQWA 4O4JB 5GIPC 4O4LA 2CHTA 1SZQA 1YGYA 2HQSC 4TV8A 4BVRA 3WJQA 3LYBA 5EZYA 1K8AH 1M90H 1CK2A 4BVQA 1VQ9F 4O2AA 4TUYB 3UT5A 1OAPA 1FNJA 1K73H 1XBIA 3HKCB 3QHDA 3F0GA 3C9RA 5EAZA 1Q82H 4C81A 1CN7A 1JD1A 3CMEF 3PLAC 1VQ8F 4X1YA 3VMFB 4WBNB 1QVFF 3FPIA 4BT2A 1T0KB 2MQEA 5DCVA 5GINC 3VOAA 3LMEA 3CPQA 3N2KA 2UYNA 3CCSF 2WALA 1YJNF 2AIFA 2AMTA 5JVDA 2P6YA 1VQ5F 4G4VA 1X7PA 1JY8A 2QI2A 4G4WA 2CVLA 3WGMA 1N8RH 3KJJA 3QUWA 4X1KA 1U3PA 3HWUA 3RYFB 2HP0A
chains in the Genus database with same CATH topology
3V3TA 3CPWF 2ALEA 3RA6A 2I6DA 2FGYA 1YHQF 1NMUB 3CG6A 1ZWZA 3V7QA 3I56F 2VGNA 3J7AR 2LBWA 1W2BF 4X3MA 2QEXF 5A2QM 1Q7YH 5HY2A 5GAPK 1VQ4F 3E1YA 3I55F 1SDSA 4BVSA 5HY1A 1Q81H 1VQKF 1RA4A 1KQSF 3LWOC 1RLGA 3PAFA 3CCMF 1YJ9F 2OTJF 3ON1A 3D00A 2JNBA 1W42A 1VQ6F 4LCKA 3CCRF 2LBXA 3G6EF 1VQPF 1GZ0A 2OTLF 1NJIH 1VQ7F 3CC7F 2GLZA 1YIJF 1W40A 1PXWA 5HY4A 3CMAF 3SIUA 3N4ZA 3IR9A 3J80M 3AGKA 5G4UC 2QA4F 3CXCF 2CZWA 3CCLF 3E20B 1QVGF 5HY0A 1W41A 3OW2F 3CC4F 4XCQA 5EWRA 3J81M 1KD1H 5GANK 5G4VC 3LWVC 1JJ2F 4TZZA 4BY9D 1VQMF 1GO1A 2KG4A 3OBYA 3FFMA 3CCJF 3CCVF 1DT9A 1M1KH 3V7EA 2F9ZC 3LWRC 3NVKE 1W3EX 3RA5A 5GIOC 1VQNF 5FJ4C 3CCUF 2KTVA 1VQOF 3LFOA 3OBWA 3HAXD 3HJWC 5GIPC 4BW0B 2OHWA 3VI6A 1YITF 4EI7A 4BVRA 3LWQC 5EO3A 1VQLF 1E7KA 1GO0A 5IT9M 5HXUA 1K8AH 1M90H 1CK2A 4BVQA 3G71F 1VQ9F 1YJWF 3G4SF 3NMUC 3JCMM 4BVTA 1K73H 1XBIA 3JAMM 1Q82H 4NUTA 3WXMB 4C4WC 3CMEF 3PLAC 2FC3A 3NK7A 1CN7A 4EI9A 3CD6F 3LWPC 1VQ8F 3SIVA 1YI2F 3VMFB 3NVIB 3NK6A 1QVFF 1IPAA 4EI8A 2OZBA 3O85A 3CC2F 1T0KB 5DCVA 5GINC 1H7MA 3CCQF 3CPQA 3CCSF 2WALA 3MCAB 5HXZA 5FLXM 3N4YA 1YJNF 1S72F 1KC8H 2AIFA 5HWEA 3GYQA 2KTUA 3CCEF 1X52A 2VGMA 1X7OA 1VQ5F 1K9MH 1X7PA 2QI2A 1Q86H 1N8RH 2BO1A 4NQ3A 4X3LA 2HVYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW F;  2ALE A;  3RA6 A;  2I6D A;  1YHQ F;  1NMU B;  3CG6 A;  1ZWZ A;  3V7Q A;  3I56 F;  2VGN A;  3J7A R;  2LBW A;  1W2B F;  4X3M A;  2QEX F;  5A2Q M;  1Q7Y H;  1VQ4 F;  5GAP K;  1SDS A;  3E1Y A;  3I55 F;  1Q81 H;  1VQK F;  1RA4 A;  1KQS F;  3LWO C;  1RLG A;  3PAF A;  3CCM F;  1YJ9 F;  2OTJ F;  3ON1 A;  2JNB A;  1W42 A;  1VQ6 F;  4LCK A;  3CCR F;  2LBX A;  3G6E F;  1VQP F;  1GZ0 A;  2OTL F;  1NJI H;  1VQ7 F;  3CC7 F;  1YIJ F;  1W40 A;  1PXW A;  3CMA F;  3SIU A;  3N4Z A;  3IR9 A;  3J80 M;  3AGK A;  5G4U C;  2QA4 F;  3CXC F;  2CZW A;  3CCL F;  3E20 B;  1QVG F;  1W41 A;  3OW2 F;  3CC4 F;  5EWR A;  3J81 M;  1KD1 H;  5GAN K;  5G4V C;  3LWV C;  1JJ2 F;  4TZZ A;  4BY9 D;  1VQM F;  1GO1 A;  2KG4 A;  3OBY A;  3FFM A;  3CCJ F;  3CCV F;  1DT9 A;  1M1K H;  3V7E A;  3NVK E;  3LWR C;  1W3E X;  3RA5 A;  5GIO C;  1VQN F;  5FJ4 C;  3CCU F;  2KTV A;  1VQO F;  3LFO A;  3OBW A;  3HAX D;  3HJW C;  5GIP C;  4BW0 B;  2OHW A;  3VI6 A;  1YIT F;  3LWQ C;  5EO3 A;  1VQL F;  1E7K A;  1GO0 A;  5IT9 M;  1K8A H;  1M90 H;  1CK2 A;  1VQ9 F;  3G71 F;  1YJW F;  3G4S F;  3NMU C;  3JCM M;  1K73 H;  1XBI A;  3JAM M;  1Q82 H;  4NUT A;  3WXM B;  4C4W C;  3CME F;  3PLA C;  2FC3 A;  3NK7 A;  1CN7 A;  3CD6 F;  3LWP C;  1VQ8 F;  3SIV A;  1YI2 F;  3VMF B;  3NVI B;  3NK6 A;  1QVF F;  1IPA A;  2OZB A;  3O85 A;  3CC2 F;  1T0K B;  5DCV A;  5GIN C;  1H7M A;  3CCQ F;  3CPQ A;  3CCS F;  2WAL A;  3MCA B;  5FLX M;  3N4Y A;  1YJN F;  1S72 F;  1KC8 H;  2AIF A;  3GYQ A;  2KTU A;  3CCE F;  1X52 A;  2VGM A;  1X7O A;  1VQ5 F;  1K9M H;  1X7P A;  2QI2 A;  1Q86 H;  1N8R H;  2BO1 A;  4X3L A;  2HVY D; 
#chains in the Genus database with same CATH topology
 3WGN A;  2HS4 A;  3V3T A;  2Q1X A;  2ALE A;  1KNJ A;  2UYJ A;  2FGY A;  1NMU B;  4RHA A;  4O4I B;  4YJ2 B;  4ZHQ A;  3S06 A;  1JFF B;  2VGN A;  3RYC A;  2HRU A;  3HKE B;  4B62 A;  1TVK B;  3WPX A;  4EB6 A;  5CA1 A;  4BT5 A;  2QEX F;  1SDS A;  3Q8H A;  1COM A;  3JVH A;  1IV3 A;  3HKD B;  2H8E A;  3RYI B;  3JAL A;  4DRX B;  1VQ6 F;  2ZOD A;  2Z1E A;  3GTZ A;  5LXT B;  3VOB A;  3CCR F;  3V4D A;  1GZ0 A;  2HP3 A;  2YXZ A;  4B46 A;  3S02 A;  1NJI H;  1VQ7 F;  3M84 A;  1IV1 A;  3EOR A;  5HY4 A;  4TV8 B;  3CMA F;  3SIU A;  3TD3 A;  3IR9 A;  5G4U C;  2VAW A;  4FFB A;  1RQ2 A;  3ERN A;  1QVG F;  3UT5 B;  5HY0 A;  1RLU A;  3K14 A;  1TUB A;  3JAW B;  4BY9 D;  2G9I A;  1GO1 A;  3RYH A;  3CCJ F;  1W55 A;  3FD6 A;  1YQN A;  1M1K H;  3CYP B;  3V7E A;  2HRY A;  1W3E X;  5EB0 A;  1W5A A;  3WGJ A;  5GIO C;  5ITZ A;  4BT7 A;  5FJ4 C;  1RQ7 A;  1VQO F;  3LFO A;  3S0W A;  3JAR A;  4BW0 B;  2CHS A;  3M1X A;  3LWQ C;  3FD5 A;  5JVD B;  1W58 1;  3E22 A;  1GO0 A;  4IIJ B;  5HXU A;  3HKB A;  3JCM M;  4BVT A;  4F6R B;  1FFX A;  5LA6 B;  3WGK A;  2FC3 A;  3D01 A;  3NK7 A;  2GZL A;  5GON B;  3CD6 F;  4I4T B;  4X20 B;  5C8Y A;  3SIV A;  3DC2 A;  4ERH A;  1VH8 A;  3NK6 A;  4ZHQ B;  4BT6 A;  4ZK7 A;  3VO8 A;  3P0Z A;  2Z1T A;  1VHA A;  4EB6 B;  5CA1 B;  3CCQ F;  2RHH A;  5J2U A;  1FSZ A;  1S72 F;  5J2T B;  1KC8 H;  4TV9 A;  1X52 A;  4U3J A;  4B45 A;  4I50 A;  2UYK A;  1W5E A;  4YJ3 B;  5CB4 A;  4LNU A;  2R6R 1;  1PF5 A;  2RHL A;  2Z1F A;  3OON A;  1U3L A;  1SA0 A;  5CA0 A;  1Z5W A;  3RA6 A;  3IKE A;  2LBT A;  3JAS A;  1QU9 A;  1ZWZ A;  4FFB B;  3JAK B;  3J7A R;  2H6L A;  2LBW A;  1W2B F;  3F6M A;  1Q7Y H;  2CSL A;  4HNA B;  3E1Y A;  5B8F A;  5HY1 A;  1Q81 H;  2PMP A;  1TUB B;  3IEQ A;  5IJ9 A;  1RA4 A;  3MDO A;  3RYH B;  5FNV A;  3WJR A;  5LYJ B;  5LOV A;  2NMU A;  1YJ9 F;  4ZHW A;  3D00 A;  2DT4 A;  2JNB A;  5LP6 C;  1R1M A;  1KNK A;  4U39 A;  1XV2 A;  5ITZ B;  5IYZ A;  5JH7 A;  1QD9 A;  1IV2 A;  2W8B C;  4RQO A;  5EYP A;  5BMV A;  3I7T A;  2GLZ A;  4O4H A;  3VTI C;  2V9Y A;  5JCO C;  3KE1 A;  5MN5 A;  1PXW A;  5KX5 B;  2VAM A;  3N4Z A;  3E22 B;  2QA4 F;  3CXC F;  3HKB B;  3K12 A;  4ZI7 A;  3RE3 A;  3IKF A;  1X25 A;  3F0F A;  1FFX B;  3BYQ A;  1KD1 H;  2LCA A;  5MN6 A;  5HP8 A;  5KMG B;  3FFM A;  3ZP4 A;  5C8Y B;  2ZAU A;  5IJ0 A;  3LWR C;  3ZO8 A;  1VQN F;  5HP7 A;  4G88 A;  3HAX D;  3K0T A;  4O4L B;  3P10 A;  3VI6 A;  2OHW A;  4O4J A;  4BT3 A;  4EI7 A;  1YIT F;  1Q8R A;  3LDT A;  4TV9 B;  5EO3 A;  1T0A A;  5EZY B;  1E7K A;  3C9T A;  5IT9 M;  4U3J B;  2CW4 A;  4G4X A;  4I50 B;  4O2A B;  4PWT A;  1YJW F;  3G4S F;  3NMU C;  3JAM M;  3C8L A;  3C9S A;  3WXM B;  4C4W C;  1SA0 B;  3S03 A;  3JAT A;  3LWP C;  1GX1 A;  4ZHV A;  2DYY A;  3VIU A;  4X1Y B;  3JAS B;  2IQQ A;  3ELC A;  3NVI B;  1IPA A;  2OZB A;  1UI9 A;  3CC2 F;  3N2K B;  2UYN B;  2RHJ A;  1QAH A;  3MCA B;  5HXZ A;  1U43 A;  3N4Y A;  2N48 A;  5HWE A;  2BTQ B;  3VYU C;  2KTU A;  3CCE F;  5IJ9 B;  4C8G A;  3CB2 A;  5FNV B;  2VAP A;  5LOV B;  4X1K B;  2Z01 A;  2HP0 B;  4X3L A;  3RYF A;  4G4Z A;  2CWJ A;  3CPW F;  3D54 A;  5BMV B;  2IG8 A;  2I6D A;  2UYP A;  4O4I A;  3T80 A;  2R75 1;  3I56 F;  3C9U A;  2H8C A;  3RYC B;  2Q1Y A;  3WPW A;  4YJ2 A;  3HTN A;  3WGL A;  4ZI7 B;  1UFY A;  5HY2 A;  3I55 F;  3MCQ A;  1CLI A;  1VQV A;  3HKD A;  2RB9 A;  3JAL B;  3VYT C;  3P4E A;  3PAF A;  5JQG A;  4DRX A;  5EIB D;  2GVI A;  5IJ0 B;  4LCK A;  3FBA A;  1W5B A;  3KHN A;  2LBX A;  4KWE A;  1H47 A;  2BTU A;  2OTL F;  4IHJ A;  2Z1U A;  3S0H A;  1YIJ F;  1DBF A;  1W40 A;  4I55 A;  3AGK A;  3IMP A;  3MBM A;  2CZW A;  2VXY A;  1OFU A;  3WJP A;  3CCL F;  3CYQ A;  1W41 A;  2L26 A;  3OW2 F;  3U0O A;  2AIZ P;  4XCQ A;  3TD4 A;  5GAN K;  1JJ2 F;  4TZZ A;  3JAW A;  5LP6 A;  2HS0 A;  1VQM F;  2KG4 A;  4ZOL A;  3JAT B;  1ONI A;  4X1I A;  3CCV F;  1DT9 A;  5EB1 B;  4R40 B;  2KGW A;  5JCO A;  3I3F A;  1NQ3 A;  3HJW C;  1FNK A;  3JAR B;  4M8I A;  3KJK A;  3ZP7 A;  1W57 A;  2HX0 A;  1VQL F;  2ZVY A;  3QTY A;  4IIJ A;  3G71 F;  4F6R A;  4NUT A;  3VCZ A;  5LA6 A;  3N2G A;  4O2B A;  4EI9 A;  3DDN A;  5GON A;  3IEW A;  4I4T A;  4X20 A;  1YI2 F;  1J7H A;  1XRG A;  4EI8 A;  4BT4 A;  3O85 A;  1H7M A;  5J2U B;  4ZHY B;  1W5F A;  4G4Y A;  5FLX M;  2BTO A;  3L7Q A;  4C8E A;  5J2T A;  3GYQ A;  1JN1 A;  2VGM A;  1X7O A;  1K9M H;  3ESJ A;  5AVM A;  4TUY A;  5JQG B;  1Q86 H;  3GHZ A;  2BO1 A;  5CB4 B;  2HS3 A;  2ZOV A;  4LNU B;  4YJ3 A;  3HKC A;  4NQ3 A;  5EIB C;  5CA0 B;  2HVY D;  4IHJ B;  3ZOP A;  3B6N A;  1YHQ F;  3F0D A;  3CG6 A;  3V7Q A;  4WBN A;  4I55 B;  2RHO A;  3JAK A;  2UZH A;  3TD5 A;  2QTP A;  2IAF A;  4X3M A;  1XHO A;  5A2Q M;  1VQ4 F;  5GAP K;  4HNA A;  4BVS A;  3M4S A;  1VQK F;  3R0P A;  2OTM A;  5LP6 B;  5MN4 A;  4ZOL B;  4X1I B;  1KQS F;  2K1S A;  3LWO C;  1RLG A;  4DXD A;  5LYJ A;  3CCM F;  2OTJ F;  3ON1 A;  2ZF8 A;  1W42 A;  3G6E F;  4C8I A;  2YYE A;  1VQP F;  5IYZ B;  5JH7 B;  5EYP B;  4O4H B;  3CC7 F;  2I6R A;  2B33 A;  1Z5V A;  5KX5 A;  1W59 A;  3J80 M;  3S0Y A;  1JFF A;  3HKE A;  1TVK A;  1IV4 A;  3VYS C;  3E20 B;  4B5C A;  3CC4 F;  5EWR A;  4C82 A;  3KIZ A;  3J81 M;  1ODE A;  2ZVZ A;  3F0E A;  5G4V C;  3LWV C;  2EWC A;  3K2X A;  3N2G B;  3OBY A;  4O2B B;  3RYI A;  4E6E A;  5KMG A;  4NWO B;  2F9Z C;  3NVK E;  1U40 A;  5LXT A;  3RA5 A;  1H48 A;  2PHN A;  3CCU F;  2KTV A;  3OBW A;  1VK3 A;  3MQW A;  4O4J B;  5GIP C;  4O4L A;  2CHT A;  1SZQ A;  1YGY A;  2HQS C;  4TV8 A;  4BVR A;  3WJQ A;  3LYB A;  5EZY A;  1K8A H;  1M90 H;  1CK2 A;  4BVQ A;  1VQ9 F;  4O2A A;  4TUY B;  3UT5 A;  1OAP A;  1FNJ A;  1K73 H;  1XBI A;  3HKC B;  3QHD A;  3F0G A;  3C9R A;  5EAZ A;  1Q82 H;  4C81 A;  1CN7 A;  1JD1 A;  3CME F;  3PLA C;  1VQ8 F;  4X1Y A;  3VMF B;  4WBN B;  1QVF F;  3FPI A;  4BT2 A;  1T0K B;  2MQE A;  5DCV A;  5GIN C;  3VOA A;  3LME A;  3CPQ A;  3N2K A;  2UYN A;  3CCS F;  2WAL A;  1YJN F;  2AIF A;  2AMT A;  5JVD A;  2P6Y A;  1VQ5 F;  4G4V A;  1X7P A;  1JY8 A;  2QI2 A;  4G4W A;  2CVL A;  3WGM A;  1N8R H;  3KJJ A;  3QUW A;  4X1K A;  1U3P A;  3HWU A;  3RYF B;  2HP0 A; 
#chains in the Genus database with same CATH homology
 3V3T A;  3CPW F;  2ALE A;  3RA6 A;  2I6D A;  2FGY A;  1YHQ F;  1NMU B;  3CG6 A;  1ZWZ A;  3V7Q A;  3I56 F;  2VGN A;  3J7A R;  2LBW A;  1W2B F;  4X3M A;  2QEX F;  5A2Q M;  1Q7Y H;  5HY2 A;  5GAP K;  1VQ4 F;  3E1Y A;  3I55 F;  1SDS A;  4BVS A;  5HY1 A;  1Q81 H;  1VQK F;  1RA4 A;  1KQS F;  3LWO C;  1RLG A;  3PAF A;  3CCM F;  1YJ9 F;  2OTJ F;  3ON1 A;  3D00 A;  2JNB A;  1W42 A;  1VQ6 F;  4LCK A;  3CCR F;  2LBX A;  3G6E F;  1VQP F;  1GZ0 A;  2OTL F;  1NJI H;  1VQ7 F;  3CC7 F;  2GLZ A;  1YIJ F;  1W40 A;  1PXW A;  5HY4 A;  3CMA F;  3SIU A;  3N4Z A;  3IR9 A;  3J80 M;  3AGK A;  5G4U C;  2QA4 F;  3CXC F;  2CZW A;  3CCL F;  3E20 B;  1QVG F;  5HY0 A;  1W41 A;  3OW2 F;  3CC4 F;  4XCQ A;  5EWR A;  3J81 M;  1KD1 H;  5GAN K;  5G4V C;  3LWV C;  1JJ2 F;  4TZZ A;  4BY9 D;  1VQM F;  1GO1 A;  2KG4 A;  3OBY A;  3FFM A;  3CCJ F;  3CCV F;  1DT9 A;  1M1K H;  3V7E A;  2F9Z C;  3LWR C;  3NVK E;  1W3E X;  3RA5 A;  5GIO C;  1VQN F;  5FJ4 C;  3CCU F;  2KTV A;  1VQO F;  3LFO A;  3OBW A;  3HAX D;  3HJW C;  5GIP C;  4BW0 B;  2OHW A;  3VI6 A;  1YIT F;  4EI7 A;  4BVR A;  3LWQ C;  5EO3 A;  1VQL F;  1E7K A;  1GO0 A;  5IT9 M;  5HXU A;  1K8A H;  1M90 H;  1CK2 A;  4BVQ A;  3G71 F;  1VQ9 F;  1YJW F;  3G4S F;  3NMU C;  3JCM M;  4BVT A;  1K73 H;  1XBI A;  3JAM M;  1Q82 H;  4NUT A;  3WXM B;  4C4W C;  3CME F;  3PLA C;  2FC3 A;  3NK7 A;  1CN7 A;  4EI9 A;  3CD6 F;  3LWP C;  1VQ8 F;  3SIV A;  1YI2 F;  3VMF B;  3NVI B;  3NK6 A;  1QVF F;  1IPA A;  4EI8 A;  2OZB A;  3O85 A;  3CC2 F;  1T0K B;  5DCV A;  5GIN C;  1H7M A;  3CCQ F;  3CPQ A;  3CCS F;  2WAL A;  3MCA B;  5HXZ A;  5FLX M;  3N4Y A;  1YJN F;  1S72 F;  1KC8 H;  2AIF A;  5HWE A;  3GYQ A;  2KTU A;  3CCE F;  1X52 A;  2VGM A;  1X7O A;  1VQ5 F;  1K9M H;  1X7P A;  2QI2 A;  1Q86 H;  1N8R H;  2BO1 A;  4NQ3 A;  4X3L A;  2HVY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...