3CC4F

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cc4F00
3LWOC 5FJ4C 1YI2F 2LBXA 3CMEF 1N8RH 3V7EA 5GIOC 3CCEF 3OBYA 3E1YA 1CK2A 1M90H 1VQOF 1K8AH 1VQ6F 1JJ2F 3GYQA 5A2QM 1KC8H 5GANK 5EO3A 3CPWF 5DCVA 1K73H 3CC4F 3FFMA 3I56F 4BY9D 2WALA 4NUTA 1QVFF 1SDSA 2QA4F 1YITF 3J7AR 2HVYD 3E20B 3CG6A 1YJ9F 2CZWA 2KTVA 3VI6A 3G71F 3CCRF 1QVGF 3CCJF 3NMUC 2KTUA 3HJWC 3CCVF 3LWPC 1Q86H 1VQMF 3PLAC 2KG4A 2JNBA 1VQNF 3IR9A 5EWRA 5GAPK 3CMAF 3N4ZA 3I55F 1Q82H 2AIFA 3NK6A 2LBWA 5G4VC 1YIJF 3LWQC 5GIPC 2OTLF 1X52A 3CD6F 1M1KH 4X3MA 4LCKA 3LWVC 3JAMM 3OBWA 3N4YA 1YHQF 3NK7A 2QI2A 1DT9A 2VGNA 3OW2F 4C4WC 5IT9M 1GO0A 3PAFA 3RA6A 5G4UC 1VQ7F 2ALEA 3VMFB 3CCLF 3J80M 3G4SF 1VQKF 1VQ4F 2VGMA 3O85A 3CXCF 1KQSF 3V7QA 1GZ0A 1GO1A 3AGKA 2QEXF 2I6DA 1VQPF 3WXMB 3JCMM 1NJIH 1NMUB 1YJWF 3CC7F 4TZZA 1S72F 1W42A 3LFOA 1W40A 3CCMF 1W2BF 1Q7YH 3CCSF 2FC3A 1ZWZA 2BO1A 1T0KB 3SIVA 3NVIB 4BW0B 3CCQF 1VQ9F 1VQ8F 3J81M 3NVKE 5GINC 3SIUA 1H7MA 3CPQA 3CCUF 2OHWA 3RA5A 1K9MH 3MCAB 1E7KA 2OTJF 1XBIA 1PXWA 1VQLF 2OZBA 1VQ5F 1W3EX 3G6EF 3HAXD 1W41A 1IPAA 3LWRC 5FLXM 1RA4A 1X7OA 1Q81H 1X7PA 4X3LA 3ON1A 3CC2F 1KD1H 1CN7A 1RLGA 1YJNF
chains in the Genus database with same CATH superfamily
4ZI7A 3N2KA 5FJ4C 4YJ2B 1VHAA 5FNVA 3N2KB 3CMEF 3V7EA 1W5EA 5FNVB 3VYSC 1U43A 1VQOF 2F9ZC 2IAFA 5JVDA 3CPWF 2BTQB 2B33A 3RE3A 3M84A 3FFMA 4O4HB 3JAWB 5KX5A 3FD6A 3MCQA 5IYZB 3RYHB 5IYZA 1YITF 1VK3A 1H47A 4R40B 2GVIA 2CZWA 2KTVA 3VI6A 3WGNA 1OFUA 3HKDA 3CCRF 3I7TA 3NMUC 2KTUA 3HJWC 2EWCA 4RQOA 3LWPC 1VQMF 4X20A 4X20B 4X1IB 1VQNF 3RYIB 5GAPK 5HXUA 2ZAUA 3ERNA 4RHAA 4X1IA 3LWQC 3FD5A 3TD4A 2RHOA 4I50B 3JAMM 3WJRA 1NQ3A 3NK7A 4C4WC 1U40A 1GO0A 5EIBC 3RA6A 5G4UC 3C9SA 5EIBD 4B62A 3CCLF 3VTIC 5EB0A 1VQKF 1UFYA 1Z5VA 4O4IA 4XCQA 1VQ4F 3DDNA 3K12A 3QUWA 3F0FA 4O4IB 5MN4A 4BVTA 4IHJA 3IKFA 4PWTA 1ODEA 5JCOA 3VOAA 4EB6A 4O2AB 1YJWF 1S72F 1SA0A 2Z01A 1W42A 3CCMF 4EB6B 4X1YB 4O2AA 5J2TA 5LA6A 5LOVA 1ZWZA 2BO1A 4X1YA 5J2TB 1T0KB 5AVMA 3CCQF 2HX0A 2L26A 3J81M 5HP8A 5GINC 1VQ8F 4G4XA 4C82A 5GONA 1T0AA 3CPQA 5HY4A 3RA5A 2YYEA 5EB1B 5GONB 4DRXA 1JFFB 1VQLF 3P4EA 3RYCB 1JFFA 1W3EX 4BT2A 4O4JB 4EI9A 4FFBA 3HKCB 1X7OA 4WBNB 3HKCA 3CC2F 5IJ0B 3ESJA 1RLGA 2Q1XA 3LWOC 3TD3A 1QD9A 5J2UB 2P6YA 1RQ2A 4YJ3A 3OBYA 3WJQA 3S02A 1CK2A 4YJ3B 2HRUA 1VQ6F 3WGJA 2OTMA 3JASA 3IKEA 1IV1A 1IV3A 3KHNA 4EI7A 3JASB 3C8LA 3QHDA 1K73H 2Z1FA 3D00A 1VQVA 2R6R1 4NUTA 3WJPA 3T80A 2HQSC 1SDSA 3S06A 3VIUA 2VAWA 3VCZA 3C9UA 3GTZA 2ZODA 2HS0A 4G4WA 3GHZA 2ZVZA 3G71F 4TV8B 3CCJF 3K14A 2N48A 3CCVF 1Q86H 3JATB 5HXZA 4KWEA 1FNJA 3IR9A 3L7QA 3CMAF 3MDOA 3NK6A 3MBMA 5G4VC 1YIJF 1RQ7A 3CD6F 5KMGB 4LCKA 3FPIA 3OBWA 3N4YA 2RHLA 2QI2A 3F6MA 3U0OA 5JQGA 5CB4A 2RHJA 2CW4A 5EYPA 1PF5A 2HRYA 3N2GB 2LCAA 1FSZA 4YJ2A 2ALEA 1Z5WA 2RB9A 3M1XA 3G4SF 1GX1A 3CYPB 3Q8HA 1KNKA 4U39A 2DYYA 5ITZB 2HP3A 3CXCF 4C81A 1DBFA 1RLUA 2QEXF 5CA0A 2UZHA 2I6DA 3JAWA 5KX5B 4BT3A 3JCMM 4TUYB 3CC7F 1R1MA 1W59A 1X25A 3IEQA 4BVSA 1Q7YH 3SIVA 5EAZA 4ERHA 4BW0B 4X1KA 3ZO8A 3HKDB 1QU9A 1H7MA 2AMTA 4ZHWA 1PXWA 3LMEA 1VQ5F 1U3LA 3UT5A 1IPAA 4TV9B 1FFXB 4M8IA 5FLXM 1W5FA 4TV9A 1RA4A 1FFXA 1W5BA 3JALA 4G88A 1X7PA 2R751 3ON1A 2H8EA 5IJ9A 2GLZA 3C9RA 2VAMA 3KE1A 3VOBA 4I55A 4BVQA 1YQNA 4I55B 3CCEF 1IV2A 3S0YA 1M90H 3WGKA 1CLIA 1KNJA 4G4YA 1OAPA 1KC8H 3E22A 3CB2A 5EO3A 3E22B 1W55A 4O2BB 3I56F 4BY9D 2BTUA 2WALA 2PMPA 2HP0B 4ZHVA 4O2BA 4BVRA 1U3PA 4ZHQA 2H6LA 5C8YB 5CA1B 5BMVB 2QA4F 5CA1A 4BT6A 5BMVA 2RHHA 2AIZP 4LNUA 3E20B 3D01A 3CG6A 3HKBA 3IEWA 1XV2A 1QVGF 4U3JA 1UI9A 2NMUA 3B6NA 3HKEA 3PLAC 2IG8A 2KG4A 3VYUC 3HKEB 1W581 5EWRA 4DRXB 2CVLA 2GZLA 3N4ZA 1Q82H 2LBWA 1FNKA 2Z1TA 5B8FA 2OTLF 1J7HA 1Q8RA 1QAHA 4O4JA 1SZQA 3K2XA 4X3MA 4FFBB 2H8CA 3LYBA 3LWVC 5EZYA 2CWJA 1YHQF 4O4LA 5EZYB 1DT9A 3VYTC 1JN1A 3F0GA 4BT5A 3OW2F 4O4LB 3OONA 5IJ0A 4EI8A 1COMA 2PHNA 2VAPA 2IQQA 3PAFA 1H48A 5MN6A 1VQ7F 4C8IA 3J80M 3CYQA 5JVDB 4B5CA 5JH7B 2VGMA 3F0DA 2ZVYA 5JH7A 4O4HA 3ZP7A 2CSLA 2DT4A 1KQSF 1GZ0A 3AGKA 2FGYA 3IMPA 3RYHA 3V3TA 3KJKA 4ZK7A 1VQPF 3WXMB 1NMUB 2HS3A 4I4TA 4NWOB 1W40A 3LFOA 4I4TB 1W2BF 2QTPA 4G4VA 4ZOLA 5MN5A 3CCSF 2K1SA 2FC3A 1IV4A 4ZOLB 1ONIA 2W8BC 3CCUF 1K9MH 3K0TA 3MCAB 3RYIA 1E7KA 2OTJF 3JATA 1XHOA 4C8EA 2UYNA 3P10A 3HAXD 1W41A 1XRGA 2UYNB 2CHSA 4I50A 3WGMA 4DXDA 2CHTA 5HY0A 3LDTA 1KD1H 4BT7A 1YJNF 3JVHA 1TVKB 2YXZA 5CB4B 1YI2F 1TVKA 2LBXA 3F0EA 1N8RH 5GIOC 4F6RB 3N2GA 3E1YA 1K8AH 4F6RA 3VO8A 1JJ2F 4G4ZA 3GYQA 2Z1UA 5A2QM 4IHJB 5GANK 4HNAA 5DCVA 1W57A 3CC4F 5ITZA 1W5AA 4HNAB 2BTOA 1JD1A 2V9YA 1QVFF 3JARB 3BYQA 5CA0B 1SA0B 3TD5A 4E6EA 5HY1A 3WPXA 3JARA 5LA6B 4TUYA 5LOVB 3MQWA 3J7AR 3KJJA 2HVYD 2Z1EA 2HS4A 1YJ9F 3S0HA 4X1KB 2LBTA 4B46A 3RYCA 2JNBA 4BT4A 3ELCA 3I55F 2AIFA 2MQEA 3D54A 3UT5B 4WBNA 4ZHYB 5HY2A 5GIPC 1X52A 2VXYA 1M1KH 3I3FA 3R0PA 3JALB 3C9TA 5IJ9B 2VGNA 2UYKA 3RYFB 5HWEA 5J2UA 1TUBA 2ZF8A 3S03A 5IT9M 3RYFA 1TUBB 3DC2A 5LP6A 4C8GA 5LYJA 3VMFB 5LP6B 3JAKB 5LYJB 3WGLA 3JAKA 2G9IA 3WPWA 3O85A 3ZOPA 3V4DA 3M4SA 3V7QA 1YGYA 1GO1A 3EORA 3HWUA 2HP0A 5C8YA 4ZHQB 1NJIH 4TZZA 2ZOVA 2I6RA 4IIJB 3ZP4A 3P0ZA 4TV8A 3NVIB 4LNUB 4IIJA 1VQ9F 4NQ3A 3KIZA 5HP7A 3NVKE 1VH8A 3HKBB 1JY8A 3SIUA 5LXTA 2OHWA 5JCOC 4U3JB 1XBIA 5LXTB 2OZBA 2UYPA 3HTNA 2Q1YA 3S0WA 3G6EF 4B45A 3LWRC 5KMGA 3FBAA 1Q81H 2UYJA 4X3LA 2KGWA 3QTYA 5LP6C 5JQGB 1CN7A 4ZI7B 5EYPB
chains in the Genus database with same CATH topology
3LWOC 5FJ4C 1YI2F 2LBXA 3CMEF 1N8RH 3V7EA 4BVQA 5GIOC 3OBYA 3CCEF 3E1YA 1CK2A 1M90H 1VQOF 1K8AH 1VQ6F 1JJ2F 2F9ZC 3GYQA 4EI7A 5A2QM 1KC8H 5GANK 5EO3A 3CPWF 5DCVA 1K73H 3CC4F 3D00A 3FFMA 3I56F 4BY9D 2WALA 4NUTA 4BVRA 1QVFF 1SDSA 5HY1A 2QA4F 1YITF 3J7AR 2HVYD 3E20B 3CG6A 1YJ9F 2CZWA 2KTVA 3VI6A 3G71F 3CCRF 1QVGF 3CCJF 3NMUC 2KTUA 3HJWC 3CCVF 3LWPC 1Q86H 1VQMF 5HXZA 3PLAC 2KG4A 2JNBA 1VQNF 3IR9A 5EWRA 5GAPK 3CMAF 5HXUA 3N4ZA 3I55F 1Q82H 2AIFA 3NK6A 2LBWA 5G4VC 1YIJF 3LWQC 5GIPC 5HY2A 2OTLF 1X52A 3CD6F 1M1KH 4X3MA 4LCKA 3LWVC 3JAMM 3OBWA 3N4YA 1YHQF 3NK7A 2QI2A 1DT9A 2VGNA 3OW2F 5HWEA 4C4WC 5IT9M 4EI8A 1GO0A 3PAFA 3RA6A 5G4UC 1VQ7F 2ALEA 3VMFB 3CCLF 3J80M 3G4SF 1VQKF 4XCQA 1VQ4F 2VGMA 3O85A 3CXCF 4BVTA 1KQSF 3V7QA 1GZ0A 1GO1A 3AGKA 2FGYA 2QEXF 2I6DA 3V3TA 1VQPF 3WXMB 3JCMM 1NJIH 1NMUB 1YJWF 3CC7F 4TZZA 1S72F 1W42A 3LFOA 1W40A 3CCMF 1W2BF 4BVSA 1Q7YH 3CCSF 2FC3A 1ZWZA 2BO1A 1T0KB 3SIVA 3NVIB 4BW0B 3CCQF 1VQ9F 4NQ3A 1VQ8F 3J81M 3NVKE 5GINC 3SIUA 1H7MA 3CPQA 5HY4A 3CCUF 2OHWA 3RA5A 1K9MH 3MCAB 1E7KA 2OTJF 1XBIA 1PXWA 1VQLF 2OZBA 1VQ5F 1W3EX 3G6EF 3HAXD 1W41A 1IPAA 3LWRC 4EI9A 5FLXM 1RA4A 1X7OA 5HY0A 1Q81H 1X7PA 4X3LA 3ON1A 3CC2F 1KD1H 2GLZA 1CN7A 1RLGA 1YJNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWO C;  5FJ4 C;  1YI2 F;  2LBX A;  3CME F;  1N8R H;  3V7E A;  5GIO C;  3CCE F;  3OBY A;  3E1Y A;  1CK2 A;  1M90 H;  1VQO F;  1K8A H;  1VQ6 F;  1JJ2 F;  3GYQ A;  5A2Q M;  1KC8 H;  5GAN K;  5EO3 A;  3CPW F;  5DCV A;  1K73 H;  3CC4 F;  3FFM A;  3I56 F;  4BY9 D;  2WAL A;  4NUT A;  1QVF F;  1SDS A;  2QA4 F;  1YIT F;  3J7A R;  2HVY D;  3E20 B;  3CG6 A;  1YJ9 F;  2CZW A;  2KTV A;  3VI6 A;  3G71 F;  3CCR F;  1QVG F;  3CCJ F;  3NMU C;  2KTU A;  3HJW C;  3CCV F;  3LWP C;  1Q86 H;  1VQM F;  3PLA C;  2KG4 A;  2JNB A;  1VQN F;  3IR9 A;  5EWR A;  5GAP K;  3CMA F;  3N4Z A;  3I55 F;  1Q82 H;  2AIF A;  3NK6 A;  2LBW A;  5G4V C;  1YIJ F;  3LWQ C;  5GIP C;  2OTL F;  1X52 A;  3CD6 F;  1M1K H;  4X3M A;  4LCK A;  3LWV C;  3JAM M;  3OBW A;  3N4Y A;  1YHQ F;  3NK7 A;  2QI2 A;  1DT9 A;  2VGN A;  3OW2 F;  4C4W C;  5IT9 M;  1GO0 A;  3PAF A;  3RA6 A;  5G4U C;  1VQ7 F;  2ALE A;  3VMF B;  3CCL F;  3J80 M;  3G4S F;  1VQK F;  1VQ4 F;  2VGM A;  3O85 A;  3CXC F;  1KQS F;  3V7Q A;  1GZ0 A;  1GO1 A;  3AGK A;  2QEX F;  2I6D A;  1VQP F;  3WXM B;  3JCM M;  1NJI H;  1NMU B;  1YJW F;  3CC7 F;  4TZZ A;  1S72 F;  1W42 A;  3LFO A;  1W40 A;  3CCM F;  1W2B F;  1Q7Y H;  3CCS F;  2FC3 A;  1ZWZ A;  2BO1 A;  1T0K B;  3SIV A;  3NVI B;  4BW0 B;  3CCQ F;  1VQ9 F;  1VQ8 F;  3J81 M;  3NVK E;  5GIN C;  3SIU A;  1H7M A;  3CPQ A;  3CCU F;  2OHW A;  3RA5 A;  1K9M H;  3MCA B;  1E7K A;  2OTJ F;  1XBI A;  1PXW A;  1VQL F;  2OZB A;  1VQ5 F;  1W3E X;  3G6E F;  3HAX D;  1W41 A;  1IPA A;  3LWR C;  5FLX M;  1RA4 A;  1X7O A;  1Q81 H;  1X7P A;  4X3L A;  3ON1 A;  3CC2 F;  1KD1 H;  1CN7 A;  1RLG A;  1YJN F; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  3N2K A;  5FJ4 C;  4YJ2 B;  1VHA A;  5FNV A;  3N2K B;  3CME F;  3V7E A;  1W5E A;  5FNV B;  3VYS C;  1U43 A;  1VQO F;  2F9Z C;  2IAF A;  5JVD A;  3CPW F;  2BTQ B;  2B33 A;  3RE3 A;  3M84 A;  3FFM A;  4O4H B;  3JAW B;  5KX5 A;  3FD6 A;  3MCQ A;  5IYZ B;  3RYH B;  5IYZ A;  1YIT F;  1VK3 A;  1H47 A;  4R40 B;  2GVI A;  2CZW A;  2KTV A;  3VI6 A;  3WGN A;  1OFU A;  3HKD A;  3CCR F;  3I7T A;  3NMU C;  2KTU A;  3HJW C;  2EWC A;  4RQO A;  3LWP C;  1VQM F;  4X20 A;  4X20 B;  4X1I B;  1VQN F;  3RYI B;  5GAP K;  5HXU A;  2ZAU A;  3ERN A;  4RHA A;  4X1I A;  3LWQ C;  3FD5 A;  3TD4 A;  2RHO A;  4I50 B;  3JAM M;  3WJR A;  1NQ3 A;  3NK7 A;  4C4W C;  1U40 A;  1GO0 A;  5EIB C;  3RA6 A;  5G4U C;  3C9S A;  5EIB D;  4B62 A;  3CCL F;  3VTI C;  5EB0 A;  1VQK F;  1UFY A;  1Z5V A;  4O4I A;  4XCQ A;  1VQ4 F;  3DDN A;  3K12 A;  3QUW A;  3F0F A;  4O4I B;  5MN4 A;  4BVT A;  4IHJ A;  3IKF A;  4PWT A;  1ODE A;  5JCO A;  3VOA A;  4EB6 A;  4O2A B;  1YJW F;  1S72 F;  1SA0 A;  2Z01 A;  1W42 A;  3CCM F;  4EB6 B;  4X1Y B;  4O2A A;  5J2T A;  5LA6 A;  5LOV A;  1ZWZ A;  2BO1 A;  4X1Y A;  5J2T B;  1T0K B;  5AVM A;  3CCQ F;  2HX0 A;  2L26 A;  3J81 M;  5HP8 A;  5GIN C;  1VQ8 F;  4G4X A;  4C82 A;  5GON A;  1T0A A;  3CPQ A;  5HY4 A;  3RA5 A;  2YYE A;  5EB1 B;  5GON B;  4DRX A;  1JFF B;  1VQL F;  3P4E A;  3RYC B;  1JFF A;  1W3E X;  4BT2 A;  4O4J B;  4EI9 A;  4FFB A;  3HKC B;  1X7O A;  4WBN B;  3HKC A;  3CC2 F;  5IJ0 B;  3ESJ A;  1RLG A;  2Q1X A;  3LWO C;  3TD3 A;  1QD9 A;  5J2U B;  2P6Y A;  1RQ2 A;  4YJ3 A;  3OBY A;  3WJQ A;  3S02 A;  1CK2 A;  4YJ3 B;  2HRU A;  1VQ6 F;  3WGJ A;  2OTM A;  3JAS A;  3IKE A;  1IV1 A;  1IV3 A;  3KHN A;  4EI7 A;  3JAS B;  3C8L A;  3QHD A;  1K73 H;  2Z1F A;  3D00 A;  1VQV A;  2R6R 1;  4NUT A;  3WJP A;  3T80 A;  2HQS C;  1SDS A;  3S06 A;  3VIU A;  2VAW A;  3VCZ A;  3C9U A;  3GTZ A;  2ZOD A;  2HS0 A;  4G4W A;  3GHZ A;  2ZVZ A;  3G71 F;  4TV8 B;  3CCJ F;  3K14 A;  2N48 A;  3CCV F;  1Q86 H;  3JAT B;  5HXZ A;  4KWE A;  1FNJ A;  3IR9 A;  3L7Q A;  3CMA F;  3MDO A;  3NK6 A;  3MBM A;  5G4V C;  1YIJ F;  1RQ7 A;  3CD6 F;  5KMG B;  4LCK A;  3FPI A;  3OBW A;  3N4Y A;  2RHL A;  2QI2 A;  3F6M A;  3U0O A;  5JQG A;  5CB4 A;  2RHJ A;  2CW4 A;  5EYP A;  1PF5 A;  2HRY A;  3N2G B;  2LCA A;  1FSZ A;  4YJ2 A;  2ALE A;  1Z5W A;  2RB9 A;  3M1X A;  3G4S F;  1GX1 A;  3CYP B;  3Q8H A;  1KNK A;  4U39 A;  2DYY A;  5ITZ B;  2HP3 A;  3CXC F;  4C81 A;  1DBF A;  1RLU A;  2QEX F;  5CA0 A;  2UZH A;  2I6D A;  3JAW A;  5KX5 B;  4BT3 A;  3JCM M;  4TUY B;  3CC7 F;  1R1M A;  1W59 A;  1X25 A;  3IEQ A;  4BVS A;  1Q7Y H;  3SIV A;  5EAZ A;  4ERH A;  4BW0 B;  4X1K A;  3ZO8 A;  3HKD B;  1QU9 A;  1H7M A;  2AMT A;  4ZHW A;  1PXW A;  3LME A;  1VQ5 F;  1U3L A;  3UT5 A;  1IPA A;  4TV9 B;  1FFX B;  4M8I A;  5FLX M;  1W5F A;  4TV9 A;  1RA4 A;  1FFX A;  1W5B A;  3JAL A;  4G88 A;  1X7P A;  2R75 1;  3ON1 A;  2H8E A;  5IJ9 A;  2GLZ A;  3C9R A;  2VAM A;  3KE1 A;  3VOB A;  4I55 A;  4BVQ A;  1YQN A;  4I55 B;  3CCE F;  1IV2 A;  3S0Y A;  1M90 H;  3WGK A;  1CLI A;  1KNJ A;  4G4Y A;  1OAP A;  1KC8 H;  3E22 A;  3CB2 A;  5EO3 A;  3E22 B;  1W55 A;  4O2B B;  3I56 F;  4BY9 D;  2BTU A;  2WAL A;  2PMP A;  2HP0 B;  4ZHV A;  4O2B A;  4BVR A;  1U3P A;  4ZHQ A;  2H6L A;  5C8Y B;  5CA1 B;  5BMV B;  2QA4 F;  5CA1 A;  4BT6 A;  5BMV A;  2RHH A;  2AIZ P;  4LNU A;  3E20 B;  3D01 A;  3CG6 A;  3HKB A;  3IEW A;  1XV2 A;  1QVG F;  4U3J A;  1UI9 A;  2NMU A;  3B6N A;  3HKE A;  3PLA C;  2IG8 A;  2KG4 A;  3VYU C;  3HKE B;  1W58 1;  5EWR A;  4DRX B;  2CVL A;  2GZL A;  3N4Z A;  1Q82 H;  2LBW A;  1FNK A;  2Z1T A;  5B8F A;  2OTL F;  1J7H A;  1Q8R A;  1QAH A;  4O4J A;  1SZQ A;  3K2X A;  4X3M A;  4FFB B;  2H8C A;  3LYB A;  3LWV C;  5EZY A;  2CWJ A;  1YHQ F;  4O4L A;  5EZY B;  1DT9 A;  3VYT C;  1JN1 A;  3F0G A;  4BT5 A;  3OW2 F;  4O4L B;  3OON A;  5IJ0 A;  4EI8 A;  1COM A;  2PHN A;  2VAP A;  2IQQ A;  3PAF A;  1H48 A;  5MN6 A;  1VQ7 F;  4C8I A;  3J80 M;  3CYQ A;  5JVD B;  4B5C A;  5JH7 B;  2VGM A;  3F0D A;  2ZVY A;  5JH7 A;  4O4H A;  3ZP7 A;  2CSL A;  2DT4 A;  1KQS F;  1GZ0 A;  3AGK A;  2FGY A;  3IMP A;  3RYH A;  3V3T A;  3KJK A;  4ZK7 A;  1VQP F;  3WXM B;  1NMU B;  2HS3 A;  4I4T A;  4NWO B;  1W40 A;  3LFO A;  4I4T B;  1W2B F;  2QTP A;  4G4V A;  4ZOL A;  5MN5 A;  3CCS F;  2K1S A;  2FC3 A;  1IV4 A;  4ZOL B;  1ONI A;  2W8B C;  3CCU F;  1K9M H;  3K0T A;  3MCA B;  3RYI A;  1E7K A;  2OTJ F;  3JAT A;  1XHO A;  4C8E A;  2UYN A;  3P10 A;  3HAX D;  1W41 A;  1XRG A;  2UYN B;  2CHS A;  4I50 A;  3WGM A;  4DXD A;  2CHT A;  5HY0 A;  3LDT A;  1KD1 H;  4BT7 A;  1YJN F;  3JVH A;  1TVK B;  2YXZ A;  5CB4 B;  1YI2 F;  1TVK A;  2LBX A;  3F0E A;  1N8R H;  5GIO C;  4F6R B;  3N2G A;  3E1Y A;  1K8A H;  4F6R A;  3VO8 A;  1JJ2 F;  4G4Z A;  3GYQ A;  2Z1U A;  5A2Q M;  4IHJ B;  5GAN K;  4HNA A;  5DCV A;  1W57 A;  3CC4 F;  5ITZ A;  1W5A A;  4HNA B;  2BTO A;  1JD1 A;  2V9Y A;  1QVF F;  3JAR B;  3BYQ A;  5CA0 B;  1SA0 B;  3TD5 A;  4E6E A;  5HY1 A;  3WPX A;  3JAR A;  5LA6 B;  4TUY A;  5LOV B;  3MQW A;  3J7A R;  3KJJ A;  2HVY D;  2Z1E A;  2HS4 A;  1YJ9 F;  3S0H A;  4X1K B;  2LBT A;  4B46 A;  3RYC A;  2JNB A;  4BT4 A;  3ELC A;  3I55 F;  2AIF A;  2MQE A;  3D54 A;  3UT5 B;  4WBN A;  4ZHY B;  5HY2 A;  5GIP C;  1X52 A;  2VXY A;  1M1K H;  3I3F A;  3R0P A;  3JAL B;  3C9T A;  5IJ9 B;  2VGN A;  2UYK A;  3RYF B;  5HWE A;  5J2U A;  1TUB A;  2ZF8 A;  3S03 A;  5IT9 M;  3RYF A;  1TUB B;  3DC2 A;  5LP6 A;  4C8G A;  5LYJ A;  3VMF B;  5LP6 B;  3JAK B;  5LYJ B;  3WGL A;  3JAK A;  2G9I A;  3WPW A;  3O85 A;  3ZOP A;  3V4D A;  3M4S A;  3V7Q A;  1YGY A;  1GO1 A;  3EOR A;  3HWU A;  2HP0 A;  5C8Y A;  4ZHQ B;  1NJI H;  4TZZ A;  2ZOV A;  2I6R A;  4IIJ B;  3ZP4 A;  3P0Z A;  4TV8 A;  3NVI B;  4LNU B;  4IIJ A;  1VQ9 F;  4NQ3 A;  3KIZ A;  5HP7 A;  3NVK E;  1VH8 A;  3HKB B;  1JY8 A;  3SIU A;  5LXT A;  2OHW A;  5JCO C;  4U3J B;  1XBI A;  5LXT B;  2OZB A;  2UYP A;  3HTN A;  2Q1Y A;  3S0W A;  3G6E F;  4B45 A;  3LWR C;  5KMG A;  3FBA A;  1Q81 H;  2UYJ A;  4X3L A;  2KGW A;  3QTY A;  5LP6 C;  5JQG B;  1CN7 A;  4ZI7 B;  5EYP B; 
#chains in the Genus database with same CATH homology
 3LWO C;  5FJ4 C;  1YI2 F;  2LBX A;  3CME F;  1N8R H;  3V7E A;  4BVQ A;  5GIO C;  3OBY A;  3CCE F;  3E1Y A;  1CK2 A;  1M90 H;  1VQO F;  1K8A H;  1VQ6 F;  1JJ2 F;  2F9Z C;  3GYQ A;  4EI7 A;  5A2Q M;  1KC8 H;  5GAN K;  5EO3 A;  3CPW F;  5DCV A;  1K73 H;  3CC4 F;  3D00 A;  3FFM A;  3I56 F;  4BY9 D;  2WAL A;  4NUT A;  4BVR A;  1QVF F;  1SDS A;  5HY1 A;  2QA4 F;  1YIT F;  3J7A R;  2HVY D;  3E20 B;  3CG6 A;  1YJ9 F;  2CZW A;  2KTV A;  3VI6 A;  3G71 F;  3CCR F;  1QVG F;  3CCJ F;  3NMU C;  2KTU A;  3HJW C;  3CCV F;  3LWP C;  1Q86 H;  1VQM F;  5HXZ A;  3PLA C;  2KG4 A;  2JNB A;  1VQN F;  3IR9 A;  5EWR A;  5GAP K;  3CMA F;  5HXU A;  3N4Z A;  3I55 F;  1Q82 H;  2AIF A;  3NK6 A;  2LBW A;  5G4V C;  1YIJ F;  3LWQ C;  5GIP C;  5HY2 A;  2OTL F;  1X52 A;  3CD6 F;  1M1K H;  4X3M A;  4LCK A;  3LWV C;  3JAM M;  3OBW A;  3N4Y A;  1YHQ F;  3NK7 A;  2QI2 A;  1DT9 A;  2VGN A;  3OW2 F;  5HWE A;  4C4W C;  5IT9 M;  4EI8 A;  1GO0 A;  3PAF A;  3RA6 A;  5G4U C;  1VQ7 F;  2ALE A;  3VMF B;  3CCL F;  3J80 M;  3G4S F;  1VQK F;  4XCQ A;  1VQ4 F;  2VGM A;  3O85 A;  3CXC F;  4BVT A;  1KQS F;  3V7Q A;  1GZ0 A;  1GO1 A;  3AGK A;  2FGY A;  2QEX F;  2I6D A;  3V3T A;  1VQP F;  3WXM B;  3JCM M;  1NJI H;  1NMU B;  1YJW F;  3CC7 F;  4TZZ A;  1S72 F;  1W42 A;  3LFO A;  1W40 A;  3CCM F;  1W2B F;  4BVS A;  1Q7Y H;  3CCS F;  2FC3 A;  1ZWZ A;  2BO1 A;  1T0K B;  3SIV A;  3NVI B;  4BW0 B;  3CCQ F;  1VQ9 F;  4NQ3 A;  1VQ8 F;  3J81 M;  3NVK E;  5GIN C;  3SIU A;  1H7M A;  3CPQ A;  5HY4 A;  3CCU F;  2OHW A;  3RA5 A;  1K9M H;  3MCA B;  1E7K A;  2OTJ F;  1XBI A;  1PXW A;  1VQL F;  2OZB A;  1VQ5 F;  1W3E X;  3G6E F;  3HAX D;  1W41 A;  1IPA A;  3LWR C;  4EI9 A;  5FLX M;  1RA4 A;  1X7O A;  5HY0 A;  1Q81 H;  1X7P A;  4X3L A;  3ON1 A;  3CC2 F;  1KD1 H;  2GLZ A;  1CN7 A;  1RLG A;  1YJN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...