2QA4F

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qa4F00
3CCLF 1RA4A 1VQOF 1K9MH 2QEXF 3NVIB 3CCRF 3IR9A 3WXMB 1SDSA 2ALEA 1M90H 1X7PA 5GAPK 3G71F 3JCMM 1VQ8F 3O85A 3MCAB 5GANK 5FLXM 1VQPF 1YJWF 3PLAC 1VQ5F 5FJ4C 1H7MA 3CPWF 1KD1H 2BO1A 3LFOA 3FFMA 5A2QM 5IT9M 3CCSF 3VI6A 2WALA 3OW2F 2JNBA 3CXCF 1IPAA 2QA4F 3V7QA 3CMAF 4TZZA 1Q86H 1GO1A 2VGMA 3LWOC 3CCQF 1QVFF 1W41A 3CCMF 3NK6A 1YITF 1VQ9F 2VGNA 1YJNF 1KQSF 3HAXD 5DCVA 3VMFB 3N4ZA 1JJ2F 1NJIH 3CMEF 2AIFA 3I55F 1YHQF 1T0KB 3PAFA 1N8RH 1RLGA 3SIUA 3OBYA 2LBWA 3RA6A 1QVGF 1X52A 2KG4A 5G4VC 1GZ0A 3CPQA 2HVYD 1Q7YH 3CCJF 1CN7A 3CD6F 3CCEF 3JAMM 1XBIA 3N4YA 3CC7F 2OTLF 1VQ7F 4BY9D 2LBXA 5GIOC 1KC8H 1K8AH 1VQ6F 1Q81H 2KTUA 3CCVF 3CG6A 3GYQA 3RA5A 5GIPC 1VQKF 5EO3A 3LWRC 4LCKA 2KTVA 3CC4F 5G4UC 3AGKA 1NMUB 2OHWA 3J7AR 3SIVA 3I56F 1W3EX 3E1YA 2OZBA 1M1KH 4C4WC 1ZWZA 1YJ9F 3G4SF 1VQLF 2QI2A 3NVKE 1S72F 1E7KA 3LWQC 1YI2F 1VQ4F 1DT9A 1W40A 5GINC 1W2BF 4NUTA 2OTJF 1CK2A 3V7EA 1GO0A 3G6EF 3NMUC 1PXWA 1YIJF 3CCUF 3LWVC 2I6DA 3HJWC 3CC2F 3J80M 3NK7A 3J81M 1VQNF 5EWRA 3OBWA 1W42A 3LWPC 1K73H 2CZWA 4X3MA 2FC3A 4BW0B 1Q82H 1VQMF 1X7OA 4X3LA 3ON1A 3E20B
chains in the Genus database with same CATH superfamily
2HP0A 3FBAA 5IYZA 2OTMA 1VQOF 4BT3A 3RYHB 2QEXF 3VIUA 3NVIB 2W8BC 3UT5B 3T80A 3WXMB 3S0HA 1VQ8F 2YXZA 5LP6C 4C8GA 2ZVZA 5HP8A 1U43A 3WJRA 4EB6B 1FNJA 1VQPF 3D54A 4TV9B 1H7MA 3CPWF 1KD1H 3FFMA 5A2QM 3I3FA 5IT9M 3CCSF 3VI6A 3R0PA 3HTNA 1TVKA 3MCQA 2AIZP 4FFBB 3P0ZA 2NMUA 1GO1A 1U40A 2VGMA 3CCQF 2MQEA 3GHZA 3CCMF 3JASB 2VGNA 4DRXB 4F6RA 3RYFA 3VMFB 5DCVA 4LNUA 1IV3A 1NJIH 2LCAA 5MN4A 1QU9A 3I55F 1VK3A 2V9YA 1N8RH 1RLGA 1QVGF 2RB9A 4O4IA 3M84A 2H8CA 3WJPA 2KG4A 2Z1UA 4PWTA 3CPQA 4BT7A 3CCJF 1CN7A 3IMPA 3DC2A 2FGYA 3WPWA 3JAMM 1XBIA 3L7QA 3HKBB 4BT5A 3CC7F 1VQVA 4NQ3A 4G4YA 4BY9D 5GIOC 4TUYA 5CA0A 2KTUA 4X1YA 3CG6A 3M1XA 5GIPC 3C8LA 3F6MA 4G4XA 2CHSA 2N48A 2LBTA 2KTVA 2OHWA 4F6RB 1W3EX 4C4WC 4IIJA 3HKEA 3NVKE 2I6RA 1E7KA 1YI2F 4G4WA 1RQ7A 1VQ4F 3IEQA 1DT9A 1W40A 5GINC 2Z01A 3CYPB 3V7EA 2RHHA 1JD1A 4ZOLA 1YIJF 5EAZA 4G4VA 3LWVC 5JCOA 1IV4A 5CB4B 4I50A 3CC2F 1W5BA 5HY0A 3WGMA 2F9ZC 1FNKA 4TUYB 5JQGA 5KX5B 1JN1A 3JARA 1UFYA 2CZWA 4X3MA 5LA6B 3CB2A 4IHJB 3D01A 5EB0A 4G4ZA 5IJ9A 3E22A 3LMEA 1X7OA 4BT6A 5C8YB 5CA1A 3E20B 1RA4A 3LYBA 2HP3A 3HKDA 3KJKA 5J2UB 5KMGA 3HKEB 1W55A 2HX0A 3JAKA 3IR9A 1SDSA 1JFFA 1J7HA 4I4TB 5J2TB 4X20A 5GAPK 3G71F 3KJJA 3KHNA 4ERHA 3TD5A 5IJ0A 5GANK 5HP7A 1RQ2A 1YJWF 4ZI7A 5AVMA 1XV2A 4I55A 4NWOB 4I50B 4YJ3A 3OW2F 1UI9A 2HS4A 5JQGB 3HKCA 3JAWA 3CMAF 1RLUA 3JARB 1QVFF 4HNAB 4U3JA 2IG8A 3C9RA 3E22B 4TV8A 5LYJA 3HAXD 5ITZA 5JCOC 5CA1B 1JJ2F 5KMGB 3DDNA 1YHQF 1IV2A 3RYCA 3JAKB 3PAFA 2VXYA 3FD5A 3OBYA 2LBWA 2Z1EA 2DYYA 3KIZA 5HY4A 5JH7A 4U39A 3ZP7A 5IJ0B 2EWCA 3D00A 1GZ0A 1YQNA 4B62A 3TD3A 3CCEF 4O4JB 1FFXB 2OTLF 1VQ7F 4R40B 1VQ6F 1K8AH 1Q81H 3JALA 4YJ3B 3CCVF 3GYQA 2ZAUA 4O4LB 3TD4A 2HP0B 5IYZB 3LWRC 1NQ3A 3QUWA 2BTQB 3V4DA 4U3JB 4ZK7A 1CLIA 4X1KA 4TV8B 5LYJB 1ONIA 1ZWZA 3G4SF 2RHOA 3HWUA 1W57A 2HRYA 3OONA 5JVDA 2K1SA 4C8EA 3RYCB 1OFUA 3MDOA 2RHLA 4B45A 1DBFA 2YYEA 1W2BF 4B46A 4NUTA 3M4SA 1GO0A 5EYPA 4EI9A 1W5AA 1PXWA 3CCUF 3N2KA 1TVKB 3HJWC 5HY2A 3NK7A 3J81M 2Q1XA 1VQNF 4G88A 4M8IA 5EWRA 3JALB 3OBWA 4DXDA 2HS3A 1VHAA 2P6YA 3RYFB 2FC3A 2BTUA 4LNUB 3RE3A 3WGJA 3VTIC 3IKEA 1XRGA 5EB1B 1U3PA 3ON1A 2B33A 1Z5WA 3CCLF 4X1KB 4ZHQA 4O2BA 2GVIA 4C8IA 1K9MH 3VOAA 3MQWA 4O4IB 4YJ2A 2GLZA 5JVDB 1X7PA 1SZQA 3F0DA 3JCMM 3JVHA 3O85A 5GONA 5FLXM 5EYPB 2UYNA 5FJ4C 5CA0B 1VH8A 4BVSA 2ZOVA 5B8FA 4X1YB 4BVTA 1W581 5EZYA 4O4HA 3VYSC 4C82A 4RHAA 1Z5VA 3F0GA 5FNVA 3S02A 3CXCF 1OAPA 1IPAA 3ZO8A 5EIBC 1Q86H 3VYTC 3LWOC 4C81A 2KGWA 1GX1A 4IIJB 1ODEA 3NK6A 1YITF 1VQ9F 1YJNF 1KQSF 1KNKA 4ZHQB 2R6R1 4O2BB 5HXUA 3CMEF 2AIFA 4WBNA 3K2XA 3WGNA 4YJ2B 4RQOA 3GTZA 3RYHA 4EI8A 3SIUA 2R751 3EORA 3RA6A 4ZOLB 1YGYA 3FD6A 3RYIA 2HVYD 1Q7YH 5LXTA 3CD6F 4BVRA 2UYNB 3WPXA 3CYQA 3N4YA 4EB6A 2LBXA 5EZYB 4O4HB 4BVQA 4TV9A 3IEWA 5IJ9B 5LOVA 1SA0A 2G9IA 1TUBA 3I7TA 3JATA 5MN5A 3HKDB 2ZODA 2RHJA 5G4UC 3AGKA 1NMUB 3SIVA 3I56F 1JFFB 2OZBA 3BYQA 2Z1FA 4X20B 1M1KH 4BT4A 4DRXA 1VQLF 2QI2A 4WBNB 3K14A 3LWQC 2H8EA 2GZLA 1H48A 3MBMA 4ZI7B 2OTJF 1CK2A 4I55B 5HXZA 3RYIB 2BTOA 2H6LA 3ELCA 5LXTB 2VAWA 1H47A 2HQSC 3HKCB 2AMTA 3JAWB 3B6NA 3J80M 2IQQA 3Q8HA 1W5EA 4EI7A 3HKBA 1W59A 1W42A 3LWPC 5LOVB 3ESJA 1SA0B 1TUBB 5ITZB 3VCZA 3ERNA 1Q82H 3JATB 2HS0A 2UZHA 1VQMF 4X3LA 3VYUC 3IKFA 3QHDA 3C9UA 5BMVA 3F0FA 4BT2A 5JH7B 4O2AA 3CCRF 3WGKA 2ALEA 1T0AA 1M90H 1FSZA 1KNJA 3VO8A 1U3LA 3VOBA 3V3TA 3MCAB 4XCQA 3WGLA 4KWEA 3ZOPA 1W5FA 3PLAC 1VQ5F 5EIBD 5MN6A 2CHTA 2BO1A 3S06A 3LFOA 1COMA 2WALA 3FPIA 5HY1A 5CB4A 3ZP4A 2QA4F 3K0TA 2VAMA 3V7QA 4TZZA 3WJQA 3KE1A 1W41A 5KX5A 3P4EA 4ZHYB 2UYJA 5LA6A 4IHJA 2Z1TA 3S0YA 5BMVB 2CSLA 1QD9A 5C8YA 1T0KB 4O2AB 3QTYA 5J2UA 1PF5A 1X52A 3N2KB 4X1IA 2Q1YA 5G4VC 4I4TA 5J2TA 2ZF8A 4E6EA 4ZHVA 1KC8H 2CWJA 3C9SA 2ZVYA 2CVLA 1QAHA 3RA5A 1VQKF 1JY8A 5EO3A 3N2GA 4LCKA 3S0WA 5LP6A 3CC4F 3J7AR 2UYPA 2QTPA 3E1YA 4HNAA 2DT4A 2UYKA 1YJ9F 2PMPA 1S72F 3UT5A 3K12A 3C9TA 5GONB 2VAPA 1XHOA 1IV1A 2IAFA 4X1IB 2PHNA 1R1MA 3G6EF 3S03A 1Q8RA 3NMUC 5FNVB 4ZHWA 2I6DA 3F0EA 2L26A 4O4JA 3P10A 4FFBA 1FFXA 3LDTA 1K73H 2CW4A 4BW0B 2HRUA 4B5CA 3JASA 3N2GB 3U0OA 5HWEA 5LP6B 4O4LA 3N4ZA 1X25A 2JNBA
chains in the Genus database with same CATH topology
3CCLF 1RA4A 1VQOF 1K9MH 2QEXF 3NVIB 3CCRF 2GLZA 3IR9A 3WXMB 2ALEA 1M90H 1SDSA 1X7PA 5GAPK 3G71F 3JCMM 3V3TA 1VQ8F 3O85A 3MCAB 4XCQA 5GANK 5FLXM 1VQPF 1YJWF 3PLAC 1VQ5F 5FJ4C 1H7MA 4BVSA 3CPWF 1KD1H 2BO1A 3LFOA 3FFMA 4BVTA 5A2QM 5IT9M 3CCSF 3VI6A 2WALA 3OW2F 2JNBA 5HY1A 3CXCF 1IPAA 2QA4F 3V7QA 3CMAF 4TZZA 1Q86H 1GO1A 2VGMA 3LWOC 3CCQF 1QVFF 1W41A 3CCMF 3NK6A 1YITF 1VQ9F 2VGNA 1YJNF 1KQSF 3HAXD 5DCVA 3VMFB 3N4ZA 1JJ2F 1NJIH 5HXUA 3CMEF 2AIFA 3I55F 1YHQF 1T0KB 3PAFA 1N8RH 4EI8A 1RLGA 3SIUA 3OBYA 2LBWA 3RA6A 1QVGF 5HY4A 1X52A 2KG4A 3D00A 5G4VC 1GZ0A 3CPQA 2HVYD 1Q7YH 3CCJF 1CN7A 3CD6F 4BVRA 3CCEF 2FGYA 3JAMM 1XBIA 3N4YA 3CC7F 2OTLF 4NQ3A 1VQ7F 4BY9D 2LBXA 5GIOC 1KC8H 1K8AH 1VQ6F 4BVQA 1Q81H 2KTUA 3CCVF 3CG6A 3GYQA 3RA5A 5GIPC 1VQKF 5EO3A 3LWRC 4LCKA 2KTVA 3CC4F 5G4UC 3AGKA 1NMUB 2OHWA 3J7AR 3SIVA 3I56F 1W3EX 3E1YA 2OZBA 1M1KH 4C4WC 1ZWZA 1YJ9F 3G4SF 1VQLF 2QI2A 3NVKE 1S72F 1E7KA 3LWQC 1YI2F 1VQ4F 1DT9A 1W40A 5GINC 1W2BF 4NUTA 2OTJF 1CK2A 3V7EA 5HXZA 3G6EF 1GO0A 4EI9A 3NMUC 1PXWA 1YIJF 3CCUF 3LWVC 2I6DA 3HJWC 3CC2F 5HY2A 5HY0A 3NK7A 3J81M 3J80M 1VQNF 2F9ZC 4EI7A 5EWRA 3OBWA 1W42A 3LWPC 1K73H 2CZWA 4X3MA 2FC3A 4BW0B 1Q82H 5HWEA 1VQMF 1X7OA 4X3LA 3ON1A 3E20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL F;  1RA4 A;  1VQO F;  1K9M H;  2QEX F;  3NVI B;  3CCR F;  3IR9 A;  3WXM B;  1SDS A;  2ALE A;  1M90 H;  1X7P A;  5GAP K;  3G71 F;  3JCM M;  1VQ8 F;  3O85 A;  3MCA B;  5GAN K;  5FLX M;  1VQP F;  1YJW F;  3PLA C;  1VQ5 F;  5FJ4 C;  1H7M A;  3CPW F;  1KD1 H;  2BO1 A;  3LFO A;  3FFM A;  5A2Q M;  5IT9 M;  3CCS F;  3VI6 A;  2WAL A;  3OW2 F;  2JNB A;  3CXC F;  1IPA A;  2QA4 F;  3V7Q A;  3CMA F;  4TZZ A;  1Q86 H;  1GO1 A;  2VGM A;  3LWO C;  3CCQ F;  1QVF F;  1W41 A;  3CCM F;  3NK6 A;  1YIT F;  1VQ9 F;  2VGN A;  1YJN F;  1KQS F;  3HAX D;  5DCV A;  3VMF B;  3N4Z A;  1JJ2 F;  1NJI H;  3CME F;  2AIF A;  3I55 F;  1YHQ F;  1T0K B;  3PAF A;  1N8R H;  1RLG A;  3SIU A;  3OBY A;  2LBW A;  3RA6 A;  1QVG F;  1X52 A;  2KG4 A;  5G4V C;  1GZ0 A;  3CPQ A;  2HVY D;  1Q7Y H;  3CCJ F;  1CN7 A;  3CD6 F;  3CCE F;  3JAM M;  1XBI A;  3N4Y A;  3CC7 F;  2OTL F;  1VQ7 F;  4BY9 D;  2LBX A;  5GIO C;  1KC8 H;  1K8A H;  1VQ6 F;  1Q81 H;  2KTU A;  3CCV F;  3CG6 A;  3GYQ A;  3RA5 A;  5GIP C;  1VQK F;  5EO3 A;  3LWR C;  4LCK A;  2KTV A;  3CC4 F;  5G4U C;  3AGK A;  1NMU B;  2OHW A;  3J7A R;  3SIV A;  3I56 F;  1W3E X;  3E1Y A;  2OZB A;  1M1K H;  4C4W C;  1ZWZ A;  1YJ9 F;  3G4S F;  1VQL F;  2QI2 A;  3NVK E;  1S72 F;  1E7K A;  3LWQ C;  1YI2 F;  1VQ4 F;  1DT9 A;  1W40 A;  5GIN C;  1W2B F;  4NUT A;  2OTJ F;  1CK2 A;  3V7E A;  1GO0 A;  3G6E F;  3NMU C;  1PXW A;  1YIJ F;  3CCU F;  3LWV C;  2I6D A;  3HJW C;  3CC2 F;  3J80 M;  3NK7 A;  3J81 M;  1VQN F;  5EWR A;  3OBW A;  1W42 A;  3LWP C;  1K73 H;  2CZW A;  4X3M A;  2FC3 A;  4BW0 B;  1Q82 H;  1VQM F;  1X7O A;  4X3L A;  3ON1 A;  3E20 B; 
#chains in the Genus database with same CATH topology
 2HP0 A;  3FBA A;  5IYZ A;  2OTM A;  1VQO F;  4BT3 A;  3RYH B;  2QEX F;  3VIU A;  3NVI B;  2W8B C;  3UT5 B;  3T80 A;  3WXM B;  3S0H A;  1VQ8 F;  2YXZ A;  5LP6 C;  4C8G A;  2ZVZ A;  5HP8 A;  1U43 A;  3WJR A;  4EB6 B;  1FNJ A;  1VQP F;  3D54 A;  4TV9 B;  1H7M A;  3CPW F;  1KD1 H;  3FFM A;  5A2Q M;  3I3F A;  5IT9 M;  3CCS F;  3VI6 A;  3R0P A;  3HTN A;  1TVK A;  3MCQ A;  2AIZ P;  4FFB B;  3P0Z A;  2NMU A;  1GO1 A;  1U40 A;  2VGM A;  3CCQ F;  2MQE A;  3GHZ A;  3CCM F;  3JAS B;  2VGN A;  4DRX B;  4F6R A;  3RYF A;  3VMF B;  5DCV A;  4LNU A;  1IV3 A;  1NJI H;  2LCA A;  5MN4 A;  1QU9 A;  3I55 F;  1VK3 A;  2V9Y A;  1N8R H;  1RLG A;  1QVG F;  2RB9 A;  4O4I A;  3M84 A;  2H8C A;  3WJP A;  2KG4 A;  2Z1U A;  4PWT A;  3CPQ A;  4BT7 A;  3CCJ F;  1CN7 A;  3IMP A;  3DC2 A;  2FGY A;  3WPW A;  3JAM M;  1XBI A;  3L7Q A;  3HKB B;  4BT5 A;  3CC7 F;  1VQV A;  4NQ3 A;  4G4Y A;  4BY9 D;  5GIO C;  4TUY A;  5CA0 A;  2KTU A;  4X1Y A;  3CG6 A;  3M1X A;  5GIP C;  3C8L A;  3F6M A;  4G4X A;  2CHS A;  2N48 A;  2LBT A;  2KTV A;  2OHW A;  4F6R B;  1W3E X;  4C4W C;  4IIJ A;  3HKE A;  3NVK E;  2I6R A;  1E7K A;  1YI2 F;  4G4W A;  1RQ7 A;  1VQ4 F;  3IEQ A;  1DT9 A;  1W40 A;  5GIN C;  2Z01 A;  3CYP B;  3V7E A;  2RHH A;  1JD1 A;  4ZOL A;  1YIJ F;  5EAZ A;  4G4V A;  3LWV C;  5JCO A;  1IV4 A;  5CB4 B;  4I50 A;  3CC2 F;  1W5B A;  5HY0 A;  3WGM A;  2F9Z C;  1FNK A;  4TUY B;  5JQG A;  5KX5 B;  1JN1 A;  3JAR A;  1UFY A;  2CZW A;  4X3M A;  5LA6 B;  3CB2 A;  4IHJ B;  3D01 A;  5EB0 A;  4G4Z A;  5IJ9 A;  3E22 A;  3LME A;  1X7O A;  4BT6 A;  5C8Y B;  5CA1 A;  3E20 B;  1RA4 A;  3LYB A;  2HP3 A;  3HKD A;  3KJK A;  5J2U B;  5KMG A;  3HKE B;  1W55 A;  2HX0 A;  3JAK A;  3IR9 A;  1SDS A;  1JFF A;  1J7H A;  4I4T B;  5J2T B;  4X20 A;  5GAP K;  3G71 F;  3KJJ A;  3KHN A;  4ERH A;  3TD5 A;  5IJ0 A;  5GAN K;  5HP7 A;  1RQ2 A;  1YJW F;  4ZI7 A;  5AVM A;  1XV2 A;  4I55 A;  4NWO B;  4I50 B;  4YJ3 A;  3OW2 F;  1UI9 A;  2HS4 A;  5JQG B;  3HKC A;  3JAW A;  3CMA F;  1RLU A;  3JAR B;  1QVF F;  4HNA B;  4U3J A;  2IG8 A;  3C9R A;  3E22 B;  4TV8 A;  5LYJ A;  3HAX D;  5ITZ A;  5JCO C;  5CA1 B;  1JJ2 F;  5KMG B;  3DDN A;  1YHQ F;  1IV2 A;  3RYC A;  3JAK B;  3PAF A;  2VXY A;  3FD5 A;  3OBY A;  2LBW A;  2Z1E A;  2DYY A;  3KIZ A;  5HY4 A;  5JH7 A;  4U39 A;  3ZP7 A;  5IJ0 B;  2EWC A;  3D00 A;  1GZ0 A;  1YQN A;  4B62 A;  3TD3 A;  3CCE F;  4O4J B;  1FFX B;  2OTL F;  1VQ7 F;  4R40 B;  1VQ6 F;  1K8A H;  1Q81 H;  3JAL A;  4YJ3 B;  3CCV F;  3GYQ A;  2ZAU A;  4O4L B;  3TD4 A;  2HP0 B;  5IYZ B;  3LWR C;  1NQ3 A;  3QUW A;  2BTQ B;  3V4D A;  4U3J B;  4ZK7 A;  1CLI A;  4X1K A;  4TV8 B;  5LYJ B;  1ONI A;  1ZWZ A;  3G4S F;  2RHO A;  3HWU A;  1W57 A;  2HRY A;  3OON A;  5JVD A;  2K1S A;  4C8E A;  3RYC B;  1OFU A;  3MDO A;  2RHL A;  4B45 A;  1DBF A;  2YYE A;  1W2B F;  4B46 A;  4NUT A;  3M4S A;  1GO0 A;  5EYP A;  4EI9 A;  1W5A A;  1PXW A;  3CCU F;  3N2K A;  1TVK B;  3HJW C;  5HY2 A;  3NK7 A;  3J81 M;  2Q1X A;  1VQN F;  4G88 A;  4M8I A;  5EWR A;  3JAL B;  3OBW A;  4DXD A;  2HS3 A;  1VHA A;  2P6Y A;  3RYF B;  2FC3 A;  2BTU A;  4LNU B;  3RE3 A;  3WGJ A;  3VTI C;  3IKE A;  1XRG A;  5EB1 B;  1U3P A;  3ON1 A;  2B33 A;  1Z5W A;  3CCL F;  4X1K B;  4ZHQ A;  4O2B A;  2GVI A;  4C8I A;  1K9M H;  3VOA A;  3MQW A;  4O4I B;  4YJ2 A;  2GLZ A;  5JVD B;  1X7P A;  1SZQ A;  3F0D A;  3JCM M;  3JVH A;  3O85 A;  5GON A;  5FLX M;  5EYP B;  2UYN A;  5FJ4 C;  5CA0 B;  1VH8 A;  4BVS A;  2ZOV A;  5B8F A;  4X1Y B;  4BVT A;  1W58 1;  5EZY A;  4O4H A;  3VYS C;  4C82 A;  4RHA A;  1Z5V A;  3F0G A;  5FNV A;  3S02 A;  3CXC F;  1OAP A;  1IPA A;  3ZO8 A;  5EIB C;  1Q86 H;  3VYT C;  3LWO C;  4C81 A;  2KGW A;  1GX1 A;  4IIJ B;  1ODE A;  3NK6 A;  1YIT F;  1VQ9 F;  1YJN F;  1KQS F;  1KNK A;  4ZHQ B;  2R6R 1;  4O2B B;  5HXU A;  3CME F;  2AIF A;  4WBN A;  3K2X A;  3WGN A;  4YJ2 B;  4RQO A;  3GTZ A;  3RYH A;  4EI8 A;  3SIU A;  2R75 1;  3EOR A;  3RA6 A;  4ZOL B;  1YGY A;  3FD6 A;  3RYI A;  2HVY D;  1Q7Y H;  5LXT A;  3CD6 F;  4BVR A;  2UYN B;  3WPX A;  3CYQ A;  3N4Y A;  4EB6 A;  2LBX A;  5EZY B;  4O4H B;  4BVQ A;  4TV9 A;  3IEW A;  5IJ9 B;  5LOV A;  1SA0 A;  2G9I A;  1TUB A;  3I7T A;  3JAT A;  5MN5 A;  3HKD B;  2ZOD A;  2RHJ A;  5G4U C;  3AGK A;  1NMU B;  3SIV A;  3I56 F;  1JFF B;  2OZB A;  3BYQ A;  2Z1F A;  4X20 B;  1M1K H;  4BT4 A;  4DRX A;  1VQL F;  2QI2 A;  4WBN B;  3K14 A;  3LWQ C;  2H8E A;  2GZL A;  1H48 A;  3MBM A;  4ZI7 B;  2OTJ F;  1CK2 A;  4I55 B;  5HXZ A;  3RYI B;  2BTO A;  2H6L A;  3ELC A;  5LXT B;  2VAW A;  1H47 A;  2HQS C;  3HKC B;  2AMT A;  3JAW B;  3B6N A;  3J80 M;  2IQQ A;  3Q8H A;  1W5E A;  4EI7 A;  3HKB A;  1W59 A;  1W42 A;  3LWP C;  5LOV B;  3ESJ A;  1SA0 B;  1TUB B;  5ITZ B;  3VCZ A;  3ERN A;  1Q82 H;  3JAT B;  2HS0 A;  2UZH A;  1VQM F;  4X3L A;  3VYU C;  3IKF A;  3QHD A;  3C9U A;  5BMV A;  3F0F A;  4BT2 A;  5JH7 B;  4O2A A;  3CCR F;  3WGK A;  2ALE A;  1T0A A;  1M90 H;  1FSZ A;  1KNJ A;  3VO8 A;  1U3L A;  3VOB A;  3V3T A;  3MCA B;  4XCQ A;  3WGL A;  4KWE A;  3ZOP A;  1W5F A;  3PLA C;  1VQ5 F;  5EIB D;  5MN6 A;  2CHT A;  2BO1 A;  3S06 A;  3LFO A;  1COM A;  2WAL A;  3FPI A;  5HY1 A;  5CB4 A;  3ZP4 A;  2QA4 F;  3K0T A;  2VAM A;  3V7Q A;  4TZZ A;  3WJQ A;  3KE1 A;  1W41 A;  5KX5 A;  3P4E A;  4ZHY B;  2UYJ A;  5LA6 A;  4IHJ A;  2Z1T A;  3S0Y A;  5BMV B;  2CSL A;  1QD9 A;  5C8Y A;  1T0K B;  4O2A B;  3QTY A;  5J2U A;  1PF5 A;  1X52 A;  3N2K B;  4X1I A;  2Q1Y A;  5G4V C;  4I4T A;  5J2T A;  2ZF8 A;  4E6E A;  4ZHV A;  1KC8 H;  2CWJ A;  3C9S A;  2ZVY A;  2CVL A;  1QAH A;  3RA5 A;  1VQK F;  1JY8 A;  5EO3 A;  3N2G A;  4LCK A;  3S0W A;  5LP6 A;  3CC4 F;  3J7A R;  2UYP A;  2QTP A;  3E1Y A;  4HNA A;  2DT4 A;  2UYK A;  1YJ9 F;  2PMP A;  1S72 F;  3UT5 A;  3K12 A;  3C9T A;  5GON B;  2VAP A;  1XHO A;  1IV1 A;  2IAF A;  4X1I B;  2PHN A;  1R1M A;  3G6E F;  3S03 A;  1Q8R A;  3NMU C;  5FNV B;  4ZHW A;  2I6D A;  3F0E A;  2L26 A;  4O4J A;  3P10 A;  4FFB A;  1FFX A;  3LDT A;  1K73 H;  2CW4 A;  4BW0 B;  2HRU A;  4B5C A;  3JAS A;  3N2G B;  3U0O A;  5HWE A;  5LP6 B;  4O4L A;  3N4Z A;  1X25 A;  2JNB A; 
#chains in the Genus database with same CATH homology
 3CCL F;  1RA4 A;  1VQO F;  1K9M H;  2QEX F;  3NVI B;  3CCR F;  2GLZ A;  3IR9 A;  3WXM B;  2ALE A;  1M90 H;  1SDS A;  1X7P A;  5GAP K;  3G71 F;  3JCM M;  3V3T A;  1VQ8 F;  3O85 A;  3MCA B;  4XCQ A;  5GAN K;  5FLX M;  1VQP F;  1YJW F;  3PLA C;  1VQ5 F;  5FJ4 C;  1H7M A;  4BVS A;  3CPW F;  1KD1 H;  2BO1 A;  3LFO A;  3FFM A;  4BVT A;  5A2Q M;  5IT9 M;  3CCS F;  3VI6 A;  2WAL A;  3OW2 F;  2JNB A;  5HY1 A;  3CXC F;  1IPA A;  2QA4 F;  3V7Q A;  3CMA F;  4TZZ A;  1Q86 H;  1GO1 A;  2VGM A;  3LWO C;  3CCQ F;  1QVF F;  1W41 A;  3CCM F;  3NK6 A;  1YIT F;  1VQ9 F;  2VGN A;  1YJN F;  1KQS F;  3HAX D;  5DCV A;  3VMF B;  3N4Z A;  1JJ2 F;  1NJI H;  5HXU A;  3CME F;  2AIF A;  3I55 F;  1YHQ F;  1T0K B;  3PAF A;  1N8R H;  4EI8 A;  1RLG A;  3SIU A;  3OBY A;  2LBW A;  3RA6 A;  1QVG F;  5HY4 A;  1X52 A;  2KG4 A;  3D00 A;  5G4V C;  1GZ0 A;  3CPQ A;  2HVY D;  1Q7Y H;  3CCJ F;  1CN7 A;  3CD6 F;  4BVR A;  3CCE F;  2FGY A;  3JAM M;  1XBI A;  3N4Y A;  3CC7 F;  2OTL F;  4NQ3 A;  1VQ7 F;  4BY9 D;  2LBX A;  5GIO C;  1KC8 H;  1K8A H;  1VQ6 F;  4BVQ A;  1Q81 H;  2KTU A;  3CCV F;  3CG6 A;  3GYQ A;  3RA5 A;  5GIP C;  1VQK F;  5EO3 A;  3LWR C;  4LCK A;  2KTV A;  3CC4 F;  5G4U C;  3AGK A;  1NMU B;  2OHW A;  3J7A R;  3SIV A;  3I56 F;  1W3E X;  3E1Y A;  2OZB A;  1M1K H;  4C4W C;  1ZWZ A;  1YJ9 F;  3G4S F;  1VQL F;  2QI2 A;  3NVK E;  1S72 F;  1E7K A;  3LWQ C;  1YI2 F;  1VQ4 F;  1DT9 A;  1W40 A;  5GIN C;  1W2B F;  4NUT A;  2OTJ F;  1CK2 A;  3V7E A;  5HXZ A;  3G6E F;  1GO0 A;  4EI9 A;  3NMU C;  1PXW A;  1YIJ F;  3CCU F;  3LWV C;  2I6D A;  3HJW C;  3CC2 F;  5HY2 A;  5HY0 A;  3NK7 A;  3J81 M;  3J80 M;  1VQN F;  2F9Z C;  4EI7 A;  5EWR A;  3OBW A;  1W42 A;  3LWP C;  1K73 H;  2CZW A;  4X3M A;  2FC3 A;  4BW0 B;  1Q82 H;  5HWE A;  1VQM F;  1X7O A;  4X3L A;  3ON1 A;  3E20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...