2QA4F

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qa4F00
3E1YA 3CCLF 3FFMA 1VQLF 3GYQA 1X52A 1K8AH 1W2BF 3CPWF 2KTVA 1VQ7F 5G4UC 3RA6A 3CPQA 5GIOC 1RA4A 1M90H 3OBYA 3CCQF 3O85A 5DCVA 3VI6A 3J81M 3LWVC 2KG4A 2VGNA 2JNBA 4TZZA 1S72F 1W41A 3CD6F 4NUTA 3SIVA 3CXCF 3JAMM 2QEXF 3CCEF 1YIJF 1YI2F 3MCAB 2ALEA 2WALA 1VQ5F 3V7QA 2BO1A 3CCUF 3CCJF 1DT9A 2OHWA 3V7EA 2QA4F 1XBIA 3JCMM 5GINC 1IPAA 3E20B 3N4YA 2I6DA 3NK7A 1YJWF 1W3EX 2FC3A 1QVFF 3J7AR 3J80M 1GO1A 5FLXM 4X3MA 1KD1H 1RLGA 1M1KH 1VQ4F 1PXWA 3OW2F 1Q86H 5A2QM 3HJWC 3CG6A 1X7OA 5FJ4C 5EWRA 1H7MA 1QVGF 3CCMF 2LBXA 3I56F 2OTJF 1SDSA 3CC2F 3NVIB 1ZWZA 5GANK 3G71F 4BY9D 4C4WC 1Q81H 4LCKA 3LWOC 5IT9M 1T0KB 1VQKF 3LFOA 1KC8H 3LWPC 5EO3A 3NMUC 3NK6A 3CCRF 3PAFA 3G4SF 1VQMF 1VQOF 2LBWA 1VQPF 3CMEF 3AGKA 4BW0B 2KTUA 2OTLF 3CC4F 3CMAF 1YJ9F 3ON1A 1YHQF 3N4ZA 1Q7YH 3RA5A 1VQNF 3SIUA 1Q82H 1K73H 3WXMB 1N8RH 1CN7A 3LWQC 1YJNF 3HAXD 1NJIH 3NVKE 3LWRC 3OBWA 2CZWA 5GIPC 1VQ9F 1YITF 3VMFB 1VQ6F 1KQSF 1GO0A 2OZBA 2QI2A 5GAPK 2VGMA 1W40A 4X3LA 1K9MH 1GZ0A 1X7PA 1VQ8F 3I55F 2HVYD 3IR9A 1W42A 2AIFA 5G4VC 3CCSF 3PLAC 1CK2A 3G6EF 1E7KA 1NMUB 3CC7F 3CCVF 1JJ2F
chains in the Genus database with same CATH superfamily
3E1YA 1X25A 1XHOA 3E22B 3JAWB 2KTVA 2UYNB 1VQ7F 3CPQA 1RA4A 1U3PA 4X20B 1JFFB 3E22A 3WJPA 3JAWA 2UYNA 4TV9B 1NQ3A 3CCQF 3O85A 1JFFA 1Z5VA 5EB1B 3QTYA 4TV9A 2KG4A 5EZYB 2BTUA 2JNBA 5EYPB 4F6RB 3VCZA 1S72F 2GVIA 1W55A 3D00A 4I55B 1W41A 3CD6F 4F6RA 2VXYA 4I4TB 4I55A 2QEXF 4G4ZA 2L26A 4PWTA 3MCAB 2ALEA 2WALA 2YYEA 3ZO8A 4BVQA 2BO1A 2ZVZA 2Z01A 2ZOVA 5LP6B 3CCJF 3CCUF 2OHWA 1KNJA 1XBIA 3JCMM 5GINC 4BT2A 5GONA 3MBMA 4B46A 3KIZA 1IV1A 1YJWF 1W3EX 2EWCA 3IMPA 5JCOC 4NWOB 2UYJA 3HKDB 4B45A 1VQ4F 3IKEA 5A2QM 1JN1A 4EI8A 3HKDA 2PMPA 2Z1UA 5EAZA 3CCMF 4O4LA 2OTJF 3NVIB 3VOBA 4ZHWA 4BVSA 3RYCB 1ODEA 5IT9M 1T0KB 3LFOA 3TD5A 4U39A 5BMVB 3NMUC 1VQOF 3F0GA 5BMVA 4O2BB 4LNUB 2CHTA 4X1KB 3WPXA 4G4VA 1ONIA 3N4ZA 4O2BA 2DYYA 4LNUA 4EB6A 1Q82H 2HP0A 4ZHQB 4ZK7A 3HKEB 1VQVA 3F0DA 3JALB 2ZAUA 3VMFB 1VQ6F 3C9RA 1KQSF 5AVMA 2Z1FA 2QI2A 3K14A 3CB2A 2Q1YA 1H47A 1W5AA 3IR9A 2GLZA 2HRYA 5KX5B 5J2TB 3G6EF 3CYPB 3EORA 3CC7F 3V4DA 4I50B 3CCVF 4BT4A 3RYFB 4C82A 5EIBD 3MDOA 4DXDA 3KJJA 4I50A 4C8GA 5G4UC 3S0HA 3WJRA 5HXUA 5IJ0A 5GIOC 4G88A 1IV4A 2VAMA 4ERHA 2HS0A 1RQ7A 3JAKA 5IYZB 5ITZB 3IEWA 1RLUA 1FNKA 3F0EA 3ZP7A 5IYZA 4R40B 5ITZA 1YQNA 2RHLA 3ZP4A 3CXCF 1W5BA 3CCEF 1YIJF 3D54A 1YI2F 3ESJA 4O4IB 2Z1TA 2UYKA 4O4IA 3JASB 3JATB 3E20B 3M84A 2ZODA 4C81A 5JH7B 3NK7A 2FC3A 3JASA 3JATA 1GO1A 3S03A 2KGWA 4G4WA 5JH7A 4M8IA 1PF5A 2OTMA 5LA6B 1RLGA 1M1KH 3VO8A 3ELCA 1Q86H 3DDNA 5LXTA 5LA6A 2CVLA 5B8FA 5CA1B 3JARA 3HKBB 2HQSC 4U3JB 2LBXA 1SDSA 5KMGB 3U0OA 1ZWZA 1DBFA 5CA1A 3HKBA 5GONB 3M4SA 4U3JA 5GANK 3G71F 4BY9D 1Q81H 4LCKA 1FSZA 3LWOC 2H8CA 5KMGA 3C9UA 1VQKF 1KC8H 4C8IA 4O4JA 3WPWA 4FFBA 2LBWA 3P0ZA 4BW0B 2KTUA 4EI9A 3HKCB 5JVDB 3VYUC 3C9SA 3FBAA 4O4LB 1VHAA 1Q7YH 3RA5A 3HKCA 3SIUA 4DRXA 5JVDA 2CSLA 1SZQA 2IG8A 1K73H 2BTOA 4YJ2A 3WXMB 1CN7A 1NJIH 1J7HA 2CZWA 1TUBB 4ZHVA 3MCQA 2R751 1JD1A 2VGMA 1TUBA 1Q8RA 2RHOA 1W40A 3LDTA 2N48A 5HP8A 3I55F 1W5FA 3QHDA 5G4VC 2UZHA 3F0FA 2H8EA 3I3FA 1QU9A 3RYHB 4EB6B 2HP0B 4BVTA 3BYQA 3LMEA 4X1IA 5FNVA 5HWEA 3WJQA 4ZOLA 3RYHA 3FFMA 4NQ3A 2QTPA 2R6R1 1X52A 2YXZA 4G4XA 4BT5A 1K8AH 4BT3A 2FGYA 3RA6A 3WGJA 4X1YA 3OBYA 3TD3A 4TV8B 2CW4A 2HRUA 5JQGB 3LWVC 3I7TA 4TV8A 4O2AA 1YGYA 1XV2A 2VAPA 2VGNA 3QUWA 5JQGA 3TD4A 4NUTA 3SIVA 2G9IA 3HWUA 1IV2A 1VK3A 5IJ0B 3RYIB 3R0PA 3S0WA 3WGNA 5CA0B 3V7EA 2QA4F 2MQEA 3JAKB 3RYIA 1IPAA 3K2XA 5CA0A 3L7QA 1QVFF 3N2KB 5HY4A 4IHJB 4X3MA 1KD1H 4WBNA 1PXWA 3OW2F 1JY8A 3N2KA 4HNAA 4IHJA 4C8EA 3CG6A 1SA0B 1X7OA 5CB4B 5FJ4C 2VAWA 5EWRA 1H7MA 4O4HB 1U43A 1W581 2ZF8A 1W57A 1SA0A 3CC2F 2RB9A 5CB4A 4XCQA 5MN4A 4O4HA 3OONA 5EB0A 5EIBC 2IAFA 3HTNA 1OAPA 5J2UA 5C8YB 4B5CA 3NK6A 1CLIA 3P4EA 1TVKA 3VYSC 3LYBA 2AIZP 5LXTB 1Z5WA 3AGKA 3N2GB 5C8YA 2OTLF 3B6NA 2AMTA 3MQWA 3JARB 3N2GA 1RQ2A 3ON1A 5IJ9B 5MN5A 4ZHYB 1VQNF 4G4YA 1VH8A 3JVHA 4IIJB 5IJ9A 3S06A 3NVKE 2GZLA 3KE1A 2HS4A 3OBWA 5GIPC 1VQ9F 1XRGA 4IIJA 4O4JB 2RHJA 1GO0A 1COMA 3Q8HA 2OZBA 3C8LA 4FFBB 1IV3A 4X3LA 1K9MH 4X20A 4RHAA 2Q1XA 1VQ8F 3K12A 2HVYD 3RE3A 5HY2A 2BTQB 4ZI7B 3CCSF 1CK2A 2HS3A 2H6LA 1QD9A 4B62A 4BT6A 3S0YA 4DRXB 5EZYA 5EYPA 1OFUA 1FFXB 4ZI7A 4YJ2B 1FNJA 3CCLF 1QAHA 1VQLF 1FFXA 4I4TA 3GYQA 3GHZA 4BT7A 3FPIA 4EI7A 1W2BF 3CPWF 1M90H 2F9ZC 5HY0A 5LP6A 1UI9A 2CHSA 1R1MA 3P10A 2HP3A 5DCVA 3VI6A 3J81M 3VIUA 2RHHA 3D01A 3ERNA 4TUYB 4TZZA 3M1XA 4X1IB 5FNVB 5LOVB 4ZOLB 4BVRA 4TUYA 2IQQA 3JAMM 1H48A 5LOVA 1GX1A 1U40A 1VQ5F 3V7QA 4X1YB 3GTZA 3VOAA 3IEQA 1T0AA 2NMUA 1DT9A 2LBTA 2Z1EA 3N4YA 3RYCA 2I6DA 4O2AB 3J7AR 3J80M 5FLXM 3F6MA 2LCAA 3WGKA 3HJWC 3KJKA 1W5EA 4X1KA 3ZOPA 1QVGF 5LP6C 3V3TA 3I56F 1U3LA 2HX0A 3IKFA 2CWJA 4ZHQA 3HKEA 2PHNA 4C4WC 4KWEA 3JALA 2V9YA 3LWPC 4YJ3B 5EO3A 2B33A 3CCRF 3PAFA 3G4SF 4WBNB 1VQMF 3DC2A 1VQPF 3FD6A 3CMEF 4HNAB 4YJ3A 3CC4F 5HY1A 2I6RA 3CMAF 1YJ9F 3C9TA 1UFYA 5KX5A 5J2TA 1YHQF 2DT4A 3VTIC 3UT5B 3WGLA 4E6EA 5HP7A 1N8RH 1W59A 3KHNA 3WGMA 3LWQC 1YJNF 3HAXD 3RYFA 3LWRC 3UT5A 1YITF 5J2UB 5LYJB 3K0TA 5GAPK 1TVKB 2ZVYA 1KNKA 5MN6A 1GZ0A 1X7PA 5LYJA 2UYPA 1W42A 2AIFA 3PLAC 5HXZA 2P6YA 1E7KA 2K1SA 1NMUB 2W8BC 3VYTC 3CYQA 5JCOA 4RQOA 3T80A 3FD5A 1JJ2F 3S02A
chains in the Genus database with same CATH topology
3E1YA 3CCLF 3FFMA 4NQ3A 1VQLF 3GYQA 1X52A 4EI7A 1W2BF 1K8AH 3CPWF 2KTVA 1VQ7F 5G4UC 2FGYA 3RA6A 3CPQA 5HXUA 1RA4A 5GIOC 1M90H 3OBYA 2F9ZC 5HY0A 3CCQF 3O85A 5DCVA 3VI6A 3J81M 3LWVC 2KG4A 2VGNA 2JNBA 4TZZA 1S72F 3D00A 1W41A 3CD6F 4NUTA 4BVRA 3SIVA 3CXCF 3JAMM 2QEXF 3CCEF 1YIJF 1YI2F 3MCAB 2ALEA 2WALA 1VQ5F 3V7QA 4BVQA 2BO1A 3CCUF 3CCJF 1DT9A 2OHWA 3V7EA 2QA4F 1XBIA 3JCMM 5GINC 1IPAA 3E20B 3N4YA 2I6DA 3NK7A 1YJWF 1W3EX 2FC3A 1QVFF 3J7AR 3J80M 1GO1A 5HY4A 4X3MA 5FLXM 1KD1H 1RLGA 1M1KH 1VQ4F 1PXWA 3OW2F 1Q86H 5A2QM 4EI8A 3HJWC 3CG6A 1X7OA 5FJ4C 5EWRA 1H7MA 1QVGF 3CCMF 2LBXA 3V3TA 3I56F 2OTJF 1SDSA 3CC2F 3NVIB 1ZWZA 4XCQA 4BVSA 5GANK 3G71F 4BY9D 4C4WC 1Q81H 4LCKA 3LWOC 5IT9M 1T0KB 1VQKF 3LFOA 1KC8H 3LWPC 5EO3A 3NMUC 3NK6A 3CCRF 3PAFA 3G4SF 1VQMF 1VQOF 2LBWA 1VQPF 3CMEF 3AGKA 4BW0B 2KTUA 4EI9A 2OTLF 3CC4F 5HY1A 3CMAF 1YJ9F 3ON1A 1YHQF 3N4ZA 1Q7YH 3RA5A 1VQNF 3SIUA 1Q82H 1K73H 3WXMB 1N8RH 1CN7A 3LWQC 1YJNF 3HAXD 1NJIH 3NVKE 3LWRC 3OBWA 2CZWA 5GIPC 1VQ9F 1YITF 3VMFB 1VQ6F 1KQSF 1GO0A 2OZBA 2QI2A 5GAPK 2VGMA 1W40A 4X3LA 1K9MH 1GZ0A 1X7PA 1VQ8F 3I55F 2HVYD 3IR9A 5HY2A 1W42A 2AIFA 2GLZA 5G4VC 3CCSF 5HXZA 1CK2A 3PLAC 3G6EF 1E7KA 1NMUB 4BVTA 3CC7F 3CCVF 1JJ2F 5HWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1Y A;  3CCL F;  3FFM A;  1VQL F;  3GYQ A;  1X52 A;  1K8A H;  1W2B F;  3CPW F;  2KTV A;  1VQ7 F;  5G4U C;  3RA6 A;  3CPQ A;  5GIO C;  1RA4 A;  1M90 H;  3OBY A;  3CCQ F;  3O85 A;  5DCV A;  3VI6 A;  3J81 M;  3LWV C;  2KG4 A;  2VGN A;  2JNB A;  4TZZ A;  1S72 F;  1W41 A;  3CD6 F;  4NUT A;  3SIV A;  3CXC F;  3JAM M;  2QEX F;  3CCE F;  1YIJ F;  1YI2 F;  3MCA B;  2ALE A;  2WAL A;  1VQ5 F;  3V7Q A;  2BO1 A;  3CCU F;  3CCJ F;  1DT9 A;  2OHW A;  3V7E A;  2QA4 F;  1XBI A;  3JCM M;  5GIN C;  1IPA A;  3E20 B;  3N4Y A;  2I6D A;  3NK7 A;  1YJW F;  1W3E X;  2FC3 A;  1QVF F;  3J7A R;  3J80 M;  1GO1 A;  5FLX M;  4X3M A;  1KD1 H;  1RLG A;  1M1K H;  1VQ4 F;  1PXW A;  3OW2 F;  1Q86 H;  5A2Q M;  3HJW C;  3CG6 A;  1X7O A;  5FJ4 C;  5EWR A;  1H7M A;  1QVG F;  3CCM F;  2LBX A;  3I56 F;  2OTJ F;  1SDS A;  3CC2 F;  3NVI B;  1ZWZ A;  5GAN K;  3G71 F;  4BY9 D;  4C4W C;  1Q81 H;  4LCK A;  3LWO C;  5IT9 M;  1T0K B;  1VQK F;  3LFO A;  1KC8 H;  3LWP C;  5EO3 A;  3NMU C;  3NK6 A;  3CCR F;  3PAF A;  3G4S F;  1VQM F;  1VQO F;  2LBW A;  1VQP F;  3CME F;  3AGK A;  4BW0 B;  2KTU A;  2OTL F;  3CC4 F;  3CMA F;  1YJ9 F;  3ON1 A;  1YHQ F;  3N4Z A;  1Q7Y H;  3RA5 A;  1VQN F;  3SIU A;  1Q82 H;  1K73 H;  3WXM B;  1N8R H;  1CN7 A;  3LWQ C;  1YJN F;  3HAX D;  1NJI H;  3NVK E;  3LWR C;  3OBW A;  2CZW A;  5GIP C;  1VQ9 F;  1YIT F;  3VMF B;  1VQ6 F;  1KQS F;  1GO0 A;  2OZB A;  2QI2 A;  5GAP K;  2VGM A;  1W40 A;  4X3L A;  1K9M H;  1GZ0 A;  1X7P A;  1VQ8 F;  3I55 F;  2HVY D;  3IR9 A;  1W42 A;  2AIF A;  5G4V C;  3CCS F;  3PLA C;  1CK2 A;  3G6E F;  1E7K A;  1NMU B;  3CC7 F;  3CCV F;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 3E1Y A;  1X25 A;  1XHO A;  3E22 B;  3JAW B;  2KTV A;  2UYN B;  1VQ7 F;  3CPQ A;  1RA4 A;  1U3P A;  4X20 B;  1JFF B;  3E22 A;  3WJP A;  3JAW A;  2UYN A;  4TV9 B;  1NQ3 A;  3CCQ F;  3O85 A;  1JFF A;  1Z5V A;  5EB1 B;  3QTY A;  4TV9 A;  2KG4 A;  5EZY B;  2BTU A;  2JNB A;  5EYP B;  4F6R B;  3VCZ A;  1S72 F;  2GVI A;  1W55 A;  3D00 A;  4I55 B;  1W41 A;  3CD6 F;  4F6R A;  2VXY A;  4I4T B;  4I55 A;  2QEX F;  4G4Z A;  2L26 A;  4PWT A;  3MCA B;  2ALE A;  2WAL A;  2YYE A;  3ZO8 A;  4BVQ A;  2BO1 A;  2ZVZ A;  2Z01 A;  2ZOV A;  5LP6 B;  3CCJ F;  3CCU F;  2OHW A;  1KNJ A;  1XBI A;  3JCM M;  5GIN C;  4BT2 A;  5GON A;  3MBM A;  4B46 A;  3KIZ A;  1IV1 A;  1YJW F;  1W3E X;  2EWC A;  3IMP A;  5JCO C;  4NWO B;  2UYJ A;  3HKD B;  4B45 A;  1VQ4 F;  3IKE A;  5A2Q M;  1JN1 A;  4EI8 A;  3HKD A;  2PMP A;  2Z1U A;  5EAZ A;  3CCM F;  4O4L A;  2OTJ F;  3NVI B;  3VOB A;  4ZHW A;  4BVS A;  3RYC B;  1ODE A;  5IT9 M;  1T0K B;  3LFO A;  3TD5 A;  4U39 A;  5BMV B;  3NMU C;  1VQO F;  3F0G A;  5BMV A;  4O2B B;  4LNU B;  2CHT A;  4X1K B;  3WPX A;  4G4V A;  1ONI A;  3N4Z A;  4O2B A;  2DYY A;  4LNU A;  4EB6 A;  1Q82 H;  2HP0 A;  4ZHQ B;  4ZK7 A;  3HKE B;  1VQV A;  3F0D A;  3JAL B;  2ZAU A;  3VMF B;  1VQ6 F;  3C9R A;  1KQS F;  5AVM A;  2Z1F A;  2QI2 A;  3K14 A;  3CB2 A;  2Q1Y A;  1H47 A;  1W5A A;  3IR9 A;  2GLZ A;  2HRY A;  5KX5 B;  5J2T B;  3G6E F;  3CYP B;  3EOR A;  3CC7 F;  3V4D A;  4I50 B;  3CCV F;  4BT4 A;  3RYF B;  4C82 A;  5EIB D;  3MDO A;  4DXD A;  3KJJ A;  4I50 A;  4C8G A;  5G4U C;  3S0H A;  3WJR A;  5HXU A;  5IJ0 A;  5GIO C;  4G88 A;  1IV4 A;  2VAM A;  4ERH A;  2HS0 A;  1RQ7 A;  3JAK A;  5IYZ B;  5ITZ B;  3IEW A;  1RLU A;  1FNK A;  3F0E A;  3ZP7 A;  5IYZ A;  4R40 B;  5ITZ A;  1YQN A;  2RHL A;  3ZP4 A;  3CXC F;  1W5B A;  3CCE F;  1YIJ F;  3D54 A;  1YI2 F;  3ESJ A;  4O4I B;  2Z1T A;  2UYK A;  4O4I A;  3JAS B;  3JAT B;  3E20 B;  3M84 A;  2ZOD A;  4C81 A;  5JH7 B;  3NK7 A;  2FC3 A;  3JAS A;  3JAT A;  1GO1 A;  3S03 A;  2KGW A;  4G4W A;  5JH7 A;  4M8I A;  1PF5 A;  2OTM A;  5LA6 B;  1RLG A;  1M1K H;  3VO8 A;  3ELC A;  1Q86 H;  3DDN A;  5LXT A;  5LA6 A;  2CVL A;  5B8F A;  5CA1 B;  3JAR A;  3HKB B;  2HQS C;  4U3J B;  2LBX A;  1SDS A;  5KMG B;  3U0O A;  1ZWZ A;  1DBF A;  5CA1 A;  3HKB A;  5GON B;  3M4S A;  4U3J A;  5GAN K;  3G71 F;  4BY9 D;  1Q81 H;  4LCK A;  1FSZ A;  3LWO C;  2H8C A;  5KMG A;  3C9U A;  1VQK F;  1KC8 H;  4C8I A;  4O4J A;  3WPW A;  4FFB A;  2LBW A;  3P0Z A;  4BW0 B;  2KTU A;  4EI9 A;  3HKC B;  5JVD B;  3VYU C;  3C9S A;  3FBA A;  4O4L B;  1VHA A;  1Q7Y H;  3RA5 A;  3HKC A;  3SIU A;  4DRX A;  5JVD A;  2CSL A;  1SZQ A;  2IG8 A;  1K73 H;  2BTO A;  4YJ2 A;  3WXM B;  1CN7 A;  1NJI H;  1J7H A;  2CZW A;  1TUB B;  4ZHV A;  3MCQ A;  2R75 1;  1JD1 A;  2VGM A;  1TUB A;  1Q8R A;  2RHO A;  1W40 A;  3LDT A;  2N48 A;  5HP8 A;  3I55 F;  1W5F A;  3QHD A;  5G4V C;  2UZH A;  3F0F A;  2H8E A;  3I3F A;  1QU9 A;  3RYH B;  4EB6 B;  2HP0 B;  4BVT A;  3BYQ A;  3LME A;  4X1I A;  5FNV A;  5HWE A;  3WJQ A;  4ZOL A;  3RYH A;  3FFM A;  4NQ3 A;  2QTP A;  2R6R 1;  1X52 A;  2YXZ A;  4G4X A;  4BT5 A;  1K8A H;  4BT3 A;  2FGY A;  3RA6 A;  3WGJ A;  4X1Y A;  3OBY A;  3TD3 A;  4TV8 B;  2CW4 A;  2HRU A;  5JQG B;  3LWV C;  3I7T A;  4TV8 A;  4O2A A;  1YGY A;  1XV2 A;  2VAP A;  2VGN A;  3QUW A;  5JQG A;  3TD4 A;  4NUT A;  3SIV A;  2G9I A;  3HWU A;  1IV2 A;  1VK3 A;  5IJ0 B;  3RYI B;  3R0P A;  3S0W A;  3WGN A;  5CA0 B;  3V7E A;  2QA4 F;  2MQE A;  3JAK B;  3RYI A;  1IPA A;  3K2X A;  5CA0 A;  3L7Q A;  1QVF F;  3N2K B;  5HY4 A;  4IHJ B;  4X3M A;  1KD1 H;  4WBN A;  1PXW A;  3OW2 F;  1JY8 A;  3N2K A;  4HNA A;  4IHJ A;  4C8E A;  3CG6 A;  1SA0 B;  1X7O A;  5CB4 B;  5FJ4 C;  2VAW A;  5EWR A;  1H7M A;  4O4H B;  1U43 A;  1W58 1;  2ZF8 A;  1W57 A;  1SA0 A;  3CC2 F;  2RB9 A;  5CB4 A;  4XCQ A;  5MN4 A;  4O4H A;  3OON A;  5EB0 A;  5EIB C;  2IAF A;  3HTN A;  1OAP A;  5J2U A;  5C8Y B;  4B5C A;  3NK6 A;  1CLI A;  3P4E A;  1TVK A;  3VYS C;  3LYB A;  2AIZ P;  5LXT B;  1Z5W A;  3AGK A;  3N2G B;  5C8Y A;  2OTL F;  3B6N A;  2AMT A;  3MQW A;  3JAR B;  3N2G A;  1RQ2 A;  3ON1 A;  5IJ9 B;  5MN5 A;  4ZHY B;  1VQN F;  4G4Y A;  1VH8 A;  3JVH A;  4IIJ B;  5IJ9 A;  3S06 A;  3NVK E;  2GZL A;  3KE1 A;  2HS4 A;  3OBW A;  5GIP C;  1VQ9 F;  1XRG A;  4IIJ A;  4O4J B;  2RHJ A;  1GO0 A;  1COM A;  3Q8H A;  2OZB A;  3C8L A;  4FFB B;  1IV3 A;  4X3L A;  1K9M H;  4X20 A;  4RHA A;  2Q1X A;  1VQ8 F;  3K12 A;  2HVY D;  3RE3 A;  5HY2 A;  2BTQ B;  4ZI7 B;  3CCS F;  1CK2 A;  2HS3 A;  2H6L A;  1QD9 A;  4B62 A;  4BT6 A;  3S0Y A;  4DRX B;  5EZY A;  5EYP A;  1OFU A;  1FFX B;  4ZI7 A;  4YJ2 B;  1FNJ A;  3CCL F;  1QAH A;  1VQL F;  1FFX A;  4I4T A;  3GYQ A;  3GHZ A;  4BT7 A;  3FPI A;  4EI7 A;  1W2B F;  3CPW F;  1M90 H;  2F9Z C;  5HY0 A;  5LP6 A;  1UI9 A;  2CHS A;  1R1M A;  3P10 A;  2HP3 A;  5DCV A;  3VI6 A;  3J81 M;  3VIU A;  2RHH A;  3D01 A;  3ERN A;  4TUY B;  4TZZ A;  3M1X A;  4X1I B;  5FNV B;  5LOV B;  4ZOL B;  4BVR A;  4TUY A;  2IQQ A;  3JAM M;  1H48 A;  5LOV A;  1GX1 A;  1U40 A;  1VQ5 F;  3V7Q A;  4X1Y B;  3GTZ A;  3VOA A;  3IEQ A;  1T0A A;  2NMU A;  1DT9 A;  2LBT A;  2Z1E A;  3N4Y A;  3RYC A;  2I6D A;  4O2A B;  3J7A R;  3J80 M;  5FLX M;  3F6M A;  2LCA A;  3WGK A;  3HJW C;  3KJK A;  1W5E A;  4X1K A;  3ZOP A;  1QVG F;  5LP6 C;  3V3T A;  3I56 F;  1U3L A;  2HX0 A;  3IKF A;  2CWJ A;  4ZHQ A;  3HKE A;  2PHN A;  4C4W C;  4KWE A;  3JAL A;  2V9Y A;  3LWP C;  4YJ3 B;  5EO3 A;  2B33 A;  3CCR F;  3PAF A;  3G4S F;  4WBN B;  1VQM F;  3DC2 A;  1VQP F;  3FD6 A;  3CME F;  4HNA B;  4YJ3 A;  3CC4 F;  5HY1 A;  2I6R A;  3CMA F;  1YJ9 F;  3C9T A;  1UFY A;  5KX5 A;  5J2T A;  1YHQ F;  2DT4 A;  3VTI C;  3UT5 B;  3WGL A;  4E6E A;  5HP7 A;  1N8R H;  1W59 A;  3KHN A;  3WGM A;  3LWQ C;  1YJN F;  3HAX D;  3RYF A;  3LWR C;  3UT5 A;  1YIT F;  5J2U B;  5LYJ B;  3K0T A;  5GAP K;  1TVK B;  2ZVY A;  1KNK A;  5MN6 A;  1GZ0 A;  1X7P A;  5LYJ A;  2UYP A;  1W42 A;  2AIF A;  3PLA C;  5HXZ A;  2P6Y A;  1E7K A;  2K1S A;  1NMU B;  2W8B C;  3VYT C;  3CYQ A;  5JCO A;  4RQO A;  3T80 A;  3FD5 A;  1JJ2 F;  3S02 A; 
#chains in the Genus database with same CATH homology
 3E1Y A;  3CCL F;  3FFM A;  4NQ3 A;  1VQL F;  3GYQ A;  1X52 A;  4EI7 A;  1W2B F;  1K8A H;  3CPW F;  2KTV A;  1VQ7 F;  5G4U C;  2FGY A;  3RA6 A;  3CPQ A;  5HXU A;  1RA4 A;  5GIO C;  1M90 H;  3OBY A;  2F9Z C;  5HY0 A;  3CCQ F;  3O85 A;  5DCV A;  3VI6 A;  3J81 M;  3LWV C;  2KG4 A;  2VGN A;  2JNB A;  4TZZ A;  1S72 F;  3D00 A;  1W41 A;  3CD6 F;  4NUT A;  4BVR A;  3SIV A;  3CXC F;  3JAM M;  2QEX F;  3CCE F;  1YIJ F;  1YI2 F;  3MCA B;  2ALE A;  2WAL A;  1VQ5 F;  3V7Q A;  4BVQ A;  2BO1 A;  3CCU F;  3CCJ F;  1DT9 A;  2OHW A;  3V7E A;  2QA4 F;  1XBI A;  3JCM M;  5GIN C;  1IPA A;  3E20 B;  3N4Y A;  2I6D A;  3NK7 A;  1YJW F;  1W3E X;  2FC3 A;  1QVF F;  3J7A R;  3J80 M;  1GO1 A;  5HY4 A;  4X3M A;  5FLX M;  1KD1 H;  1RLG A;  1M1K H;  1VQ4 F;  1PXW A;  3OW2 F;  1Q86 H;  5A2Q M;  4EI8 A;  3HJW C;  3CG6 A;  1X7O A;  5FJ4 C;  5EWR A;  1H7M A;  1QVG F;  3CCM F;  2LBX A;  3V3T A;  3I56 F;  2OTJ F;  1SDS A;  3CC2 F;  3NVI B;  1ZWZ A;  4XCQ A;  4BVS A;  5GAN K;  3G71 F;  4BY9 D;  4C4W C;  1Q81 H;  4LCK A;  3LWO C;  5IT9 M;  1T0K B;  1VQK F;  3LFO A;  1KC8 H;  3LWP C;  5EO3 A;  3NMU C;  3NK6 A;  3CCR F;  3PAF A;  3G4S F;  1VQM F;  1VQO F;  2LBW A;  1VQP F;  3CME F;  3AGK A;  4BW0 B;  2KTU A;  4EI9 A;  2OTL F;  3CC4 F;  5HY1 A;  3CMA F;  1YJ9 F;  3ON1 A;  1YHQ F;  3N4Z A;  1Q7Y H;  3RA5 A;  1VQN F;  3SIU A;  1Q82 H;  1K73 H;  3WXM B;  1N8R H;  1CN7 A;  3LWQ C;  1YJN F;  3HAX D;  1NJI H;  3NVK E;  3LWR C;  3OBW A;  2CZW A;  5GIP C;  1VQ9 F;  1YIT F;  3VMF B;  1VQ6 F;  1KQS F;  1GO0 A;  2OZB A;  2QI2 A;  5GAP K;  2VGM A;  1W40 A;  4X3L A;  1K9M H;  1GZ0 A;  1X7P A;  1VQ8 F;  3I55 F;  2HVY D;  3IR9 A;  5HY2 A;  1W42 A;  2AIF A;  2GLZ A;  5G4V C;  3CCS F;  5HXZ A;  1CK2 A;  3PLA C;  3G6E F;  1E7K A;  1NMU B;  4BVT A;  3CC7 F;  3CCV F;  1JJ2 F;  5HWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...