2QA4F

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2qa4F00
3CCJF 3OW2F 1VQPF 3LWVC 3NVIB 3J7AR 2KTUA 3N4ZA 1SDSA 3PAFA 1QVGF 5GANK 5FJ4C 1Q7YH 3CPWF 1S72F 3VI6A 2CZWA 3NVKE 2OZBA 3LWPC 1YJNF 3OBWA 5EO3A 3OBYA 1QVFF 1CN7A 2FC3A 3G6EF 1XBIA 3RA6A 1YJ9F 3ON1A 3CCRF 3V7EA 2WALA 1X7OA 3V7QA 4X3LA 2KG4A 3CMEF 1YIJF 5GIPC 4NUTA 3I56F 2QEXF 5EWRA 2JNBA 3I55F 3CCEF 1M90H 3MCAB 5DCVA 4X3MA 3NK7A 5IT9M 3SIVA 1JJ2F 1VQOF 1VQ4F 3CCSF 3E1YA 2ALEA 3PLAC 3SIUA 1H7MA 1KC8H 1GO0A 1GZ0A 1X52A 2AIFA 3WXMB 1VQ7F 1IPAA 2VGMA 5A2QM 4TZZA 1VQMF 3NMUC 1VQ5F 2OHWA 3CXCF 3CCLF 1T0KB 1DT9A 3AGKA 1NJIH 3NK6A 2QA4F 1KQSF 3LWRC 2VGNA 5GAPK 1VQ6F 3CCUF 1W2BF 5GIOC 1GO1A 3IR9A 3CD6F 4BY9D 2KTVA 3CC7F 3LWOC 1VQ8F 1W41A 3LFOA 3O85A 1CK2A 5G4VC 4LCKA 2OTJF 1W42A 1M1KH 2LBWA 1Q82H 1RLGA 1KD1H 1Q81H 3JAMM 5G4UC 1X7PA 3CCVF 5GINC 1RA4A 1VQLF 1YI2F 2HVYD 2LBXA 1Q86H 1YJWF 1VQNF 3G4SF 3RA5A 3CG6A 3CPQA 3JCMM 3CCMF 4BW0B 1VQ9F 5FLXM 1N8RH 1E7KA 1YHQF 3CMAF 3HJWC 1YITF 2OTLF 1K73H 2QI2A 1VQKF 1K8AH 3N4YA 3HAXD 3CCQF 3J81M 4C4WC 3LWQC 3VMFB 2BO1A 3E20B 3J80M 3CC2F 1W40A 1K9MH 2I6DA 3CC4F 1ZWZA 3GYQA 3FFMA 1NMUB 1PXWA 1W3EX 3G71F
chains in the Genus database with same CATH superfamily
3OW2F 5EYPB 3VOBA 1VQPF 2HS4A 5HXZA 5HY1A 1XHOA 5JH7B 1QVGF 1IV2A 5IYZA 2EWCA 5FJ4C 1S72F 1J7HA 2H8CA 2CZWA 4TUYB 2UYNB 3ZO8A 3LWPC 4R40B 1YJNF 3HKBB 5JCOC 5EIBC 1QVFF 1W57A 2FC3A 4ZOLB 1JD1A 3RA6A 1YJ9F 4U3JB 4ZI7B 3OONA 1SA0B 4X3LA 3ELCA 3IEWA 4O4JB 3RYFB 4NUTA 2QEXF 3CCEF 4HNAA 5LA6A 1H48A 3F0FA 3RYHA 1CLIA 4B5CA 3LDTA 4G4YA 1W5FA 3SIUA 3N2KA 1IPAA 4EI9A 3NMUC 3CXCF 4DXDA 1UI9A 1T0KB 1DT9A 3K14A 1VK3A 5J2UA 2B33A 4TV8B 5LXTA 4X1IA 3MBMA 4EB6A 4C8GA 3L7QA 4X1YA 1U43A 1TUBB 1VQVA 1Q8RA 3QHDA 2FGYA 3LWOC 3JAWB 2IAFA 4IIJB 1RLUA 5HWEA 3RYIA 3UT5A 3JVHA 5KX5B 2PHNA 5IJ9A 3HKBA 3JAMM 1FFXB 2VXYA 2CSLA 1X7PA 1RA4A 2VAPA 4O4HB 1YI2F 4G4VA 1T0AA 5LYJB 3RYCA 4ZI7A 5MN4A 3HKEA 1YJWF 3G4SF 5BMVA 3RA5A 4O2AB 3JCMM 2RHOA 5JVDB 3CCMF 2HS3A 5FLXM 3N2GB 1E7KA 4M8IA 3R0PA 5KMGB 2IQQA 4ZK7A 3J81M 2Z1EA 5B8FA 3VMFB 3E20B 3J80M 3CC2F 1W40A 1K9MH 3HKDA 3IMPA 4NWOB 3VYUC 2YXZA 2BTUA 5J2UB 2YYEA 1W3EX 2K1SA 3G71F 3LWVC 3VYTC 3WPXA 2KTUA 3DC2A 3N4ZA 4BT5A 4BT2A 4G4ZA 1SDSA 1X25A 5GANK 1H47A 1YQNA 3CPWF 3KE1A 4I55A 3JAWA 4IIJA 2G9IA 3OBYA 3MDOA 4B46A 4WBNB 4ZHVA 1XBIA 4HNAB 1W59A 3WJRA 2CHTA 4XCQA 2WALA 3I3FA 1X7OA 3V7QA 3CMEF 1YIJF 2BTOA 2HP0B 3LYBA 3N2KB 2JNBA 5LP6B 3I55F 3MCAB 3ERNA 4X3MA 3SIVA 5BMVB 1VQ4F 3CCSF 2H8EA 1RQ7A 3E22A 2ALEA 1NQ3A 1GO0A 1X52A 3WXMB 4KWEA 1PF5A 1VQ7F 2VGMA 4TZZA 4X1KA 2L26A 3F0EA 2V9YA 4I50A 4BT7A 5JCOA 3TD3A 5CA0B 3CCLF 3P4EA 4ZHQB 4U39A 3P10A 5HP8A 3WGLA 2MQEA 3BYQA 3WGNA 3LWRC 2VGNA 3CYPB 3TD5A 3GTZA 5GAPK 3CCUF 3WJPA 1XV2A 1Z5VA 2UYJA 3EORA 4BVQA 2W8BC 3VTIC 1JFFA 5FNVB 3F6MA 2KTVA 3CC7F 2VAWA 1VH8A 5KX5A 3K12A 5IJ9B 1FSZA 4LCKA 3O85A 1CK2A 3JASB 5G4VC 2OTJF 3QUWA 4TUYA 3WGKA 1Q82H 4G4XA 1Q81H 2DYYA 3C9UA 2RB9A 4O2AA 2NMUA 5JVDA 5GINC 4WBNA 1COMA 1VQLF 4DRXB 5GONA 2LBXA 3CB2A 5EZYB 1JN1A 2GVIA 3CG6A 2AMTA 3U0OA 2GZLA 4BW0B 5HY2A 1VQ9F 5LA6B 5LP6C 1N8RH 3C9TA 5HY4A 3ZP4A 1XRGA 3HJWC 2OTLF 4F6RB 4O4IA 5ITZB 1VQKF 3V3TA 4G4WA 4YJ2B 2CHSA 4RQOA 4X20B 3QTYA 5LOVB 5J2TB 2RHJA 2GLZA 4I50B 3HKCB 3CC4F 4TV9B 3GYQA 3S06A 4I4TB 3FFMA 3CYQA 1Z5WA 4NQ3A 5HP7A 5C8YA 5JQGB 1KNKA 3MQWA 1W55A 3NVIB 2HQSC 3PAFA 2Z1FA 1U3LA 2QTPA 1TUBA 4O2BB 3JARB 3RE3A 5EYPA 4B45A 4BVSA 5EAZA 3NVKE 2OZBA 2RHHA 3KJKA 5IYZB 3M84A 5EO3A 4C82A 3M4SA 3G6EF 3JALA 2DT4A 2PMPA 3CCRF 4E6EA 2Z1TA 3VYSC 5MN5A 3HWUA 3K0TA 3K2XA 5EWRA 2ZVZA 3JATA 4BVTA 3WPWA 3RYCB 4YJ3A 5IJ0A 2ZF8A 2LBTA 5DCVA 4IHJB 1VQOF 3E1YA 2RHLA 2P6YA 4ZHQA 4C8EA 3PLAC 1KC8H 1QAHA 4BT3A 3N2GA 3F0DA 5CA1A 3VO8A 1VQMF 3Q8HA 3RYHB 1VQ5F 4O4LA 5ITZA 5EB1B 2HRUA 3P0ZA 4BT4A 5LOVA 3KHNA 4B62A 4C81A 1KQSF 3V4DA 3HKCA 3D01A 1VQ6F 1W581 3T80A 5GIOC 3VCZA 3IR9A 4PWTA 4TV8A 3CD6F 4X1IB 2HX0A 4RHAA 5EIBD 3S0WA 3TD4A 4EB6B 1FFXA 1W41A 3LFOA 1VQ8F 1M1KH 4DRXA 5HY0A 5GONB 1KD1H 2IG8A 1ONIA 3HKEB 5CB4A 4C8IA 2Z1UA 3CCVF 5AVMA 1UFYA 3I7TA 3KJJA 2HVYD 1Q86H 1SZQA 1VQNF 4G88A 1VHAA 2F9ZC 2VAMA 4YJ2A 1IV3A 3C9SA 3VOAA 4X20A 5J2TA 3JATB 3F0GA 3FD6A 1GX1A 5EB0A 5LYJA 1IV4A 3MCQA 3CMAF 4IHJA 1YITF 1K73H 2H6LA 1W5BA 2QI2A 3D00A 1K8AH 3E22B 3N4YA 2UZHA 2R6R1 4BVRA 4C4WC 5CA1B 1OAPA 2BTQB 3LWQC 4O4LB 3S0YA 2UYPA 5CA0A 4EI7A 4LNUA 3ESJA 3FD5A 1W5EA 1NMUB 1PXWA 1QU9A 3JARA 3CCJF 1R1MA 3GHZA 1FNJA 2UYKA 3IKFA 1IV1A 2AIZP 3J7AR 2KGWA 3JAKA 3HTNA 3WGJA 3VIUA 1Q7YH 1TVKA 4ZHWA 1KNJA 2LCAA 3VI6A 3RYIB 1W5AA 2HRYA 5JH7A 2CVLA 3KIZA 3OBWA 1CN7A 2HP0A 2UYNA 3ON1A 2N48A 3V7EA 3S03A 5CB4B 2KG4A 2HS0A 4ERHA 3FBAA 1JY8A 5GIPC 1RQ2A 3I56F 4ZOLA 1M90H 5IT9M 3NK7A 2Q1YA 4X1KB 1JJ2F 3ZOPA 2HP3A 4O4JA 1H7MA 3RYFA 3WJQA 1GZ0A 5MN6A 2AIFA 2ZAUA 2CW4A 2ZODA 5A2QM 3ZP7A 2OHWA 4FFBA 4O4IB 3HKDB 4EI8A 2ZVYA 4ZHYB 3IKEA 1FNKA 3AGKA 3NK6A 3S0HA 1NJIH 2QA4F 2OTMA 1JFFB 3C9RA 5FNVA 4TV9A 3IEQA 1W2BF 1OFUA 1GO1A 1DBFA 5JQGA 4BY9D 3DDNA 4I55B 2Q1XA 1TVKB 1U3PA 1W42A 3FPIA 2LBWA 1RLGA 4U3JA 3WGMA 1SA0A 5G4UC 3C8LA 3JASA 5LP6A 3JALB 3UT5B 3S02A 1QD9A 5HXUA 2R751 3CPQA 1U40A 4BT6A 2CWJA 2Z01A 2I6RA 4O4HA 4YJ3B 5IJ0B 1YHQF 5EZYA 2ZOVA 3HAXD 4LNUB 3CCQF 3LMEA 4I4TA 1ODEA 2BO1A 5C8YB 5LXTB 4FFBB 4F6RA 2I6DA 3M1XA 3B6NA 3JAKB 1ZWZA 1YGYA 5KMGA 3D54A 4O2BA 4X1YB
chains in the Genus database with same CATH topology
4NQ3A 3CCJF 3OW2F 1VQPF 5HXZA 3LWVC 5HY1A 3J7AR 2KTUA 3N4ZA 1SDSA 3NVIB 3PAFA 1QVGF 5GANK 5FJ4C 1Q7YH 3CPWF 1S72F 3VI6A 2CZWA 4BVSA 3NVKE 2OZBA 3LWPC 1YJNF 3OBWA 5EO3A 3OBYA 1QVFF 1CN7A 2FC3A 3G6EF 1XBIA 3RA6A 1YJ9F 3ON1A 3CCRF 3V7EA 4XCQA 2WALA 1X7OA 3V7QA 4X3LA 2KG4A 3CMEF 1YIJF 5GIPC 4NUTA 3I56F 2QEXF 5EWRA 2JNBA 3I55F 3CCEF 1M90H 3MCAB 4BVTA 5DCVA 4X3MA 3NK7A 5IT9M 3SIVA 1JJ2F 1VQOF 1VQ4F 3CCSF 3E1YA 2ALEA 3PLAC 3SIUA 1H7MA 1KC8H 1GO0A 1GZ0A 1X52A 2AIFA 3WXMB 1VQ7F 1IPAA 2VGMA 4EI9A 5A2QM 4TZZA 1VQMF 1VQ5F 3NMUC 2OHWA 3CXCF 3CCLF 4EI8A 1T0KB 1DT9A 3AGKA 1NJIH 3NK6A 2QA4F 1KQSF 3LWRC 2VGNA 5GAPK 1VQ6F 3CCUF 1W2BF 5GIOC 4BVQA 1GO1A 3IR9A 3CD6F 4BY9D 2KTVA 3CC7F 2FGYA 3LWOC 1VQ8F 1W41A 3LFOA 3O85A 1CK2A 5G4VC 4LCKA 2OTJF 1W42A 1M1KH 5HWEA 5HY0A 2LBWA 1Q82H 1RLGA 1KD1H 1Q81H 3JAMM 5G4UC 1X7PA 3CCVF 5GINC 1RA4A 1VQLF 1YI2F 2HVYD 2LBXA 1Q86H 1YJWF 1VQNF 3G4SF 5HXUA 2F9ZC 3RA5A 3CG6A 3CPQA 3JCMM 3CCMF 4BW0B 5HY2A 1VQ9F 5FLXM 1N8RH 1E7KA 5HY4A 1YHQF 3CMAF 3HJWC 1YITF 2OTLF 1K73H 2QI2A 3D00A 3V3TA 3N4YA 1K8AH 1VQKF 3HAXD 3CCQF 4BVRA 3J81M 4C4WC 3LWQC 2GLZA 3VMFB 2BO1A 3E20B 3J80M 3CC2F 1W40A 1K9MH 2I6DA 3CC4F 4EI7A 1ZWZA 3GYQA 3FFMA 1NMUB 1PXWA 1W3EX 3G71F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ F;  3OW2 F;  1VQP F;  3LWV C;  3NVI B;  3J7A R;  2KTU A;  3N4Z A;  1SDS A;  3PAF A;  1QVG F;  5GAN K;  5FJ4 C;  1Q7Y H;  3CPW F;  1S72 F;  3VI6 A;  2CZW A;  3NVK E;  2OZB A;  3LWP C;  1YJN F;  3OBW A;  5EO3 A;  3OBY A;  1QVF F;  1CN7 A;  2FC3 A;  3G6E F;  1XBI A;  3RA6 A;  1YJ9 F;  3ON1 A;  3CCR F;  3V7E A;  2WAL A;  1X7O A;  3V7Q A;  4X3L A;  2KG4 A;  3CME F;  1YIJ F;  5GIP C;  4NUT A;  3I56 F;  2QEX F;  5EWR A;  2JNB A;  3I55 F;  3CCE F;  1M90 H;  3MCA B;  5DCV A;  4X3M A;  3NK7 A;  5IT9 M;  3SIV A;  1JJ2 F;  1VQO F;  1VQ4 F;  3CCS F;  3E1Y A;  2ALE A;  3PLA C;  3SIU A;  1H7M A;  1KC8 H;  1GO0 A;  1GZ0 A;  1X52 A;  2AIF A;  3WXM B;  1VQ7 F;  1IPA A;  2VGM A;  5A2Q M;  4TZZ A;  1VQM F;  3NMU C;  1VQ5 F;  2OHW A;  3CXC F;  3CCL F;  1T0K B;  1DT9 A;  3AGK A;  1NJI H;  3NK6 A;  2QA4 F;  1KQS F;  3LWR C;  2VGN A;  5GAP K;  1VQ6 F;  3CCU F;  1W2B F;  5GIO C;  1GO1 A;  3IR9 A;  3CD6 F;  4BY9 D;  2KTV A;  3CC7 F;  3LWO C;  1VQ8 F;  1W41 A;  3LFO A;  3O85 A;  1CK2 A;  5G4V C;  4LCK A;  2OTJ F;  1W42 A;  1M1K H;  2LBW A;  1Q82 H;  1RLG A;  1KD1 H;  1Q81 H;  3JAM M;  5G4U C;  1X7P A;  3CCV F;  5GIN C;  1RA4 A;  1VQL F;  1YI2 F;  2HVY D;  2LBX A;  1Q86 H;  1YJW F;  1VQN F;  3G4S F;  3RA5 A;  3CG6 A;  3CPQ A;  3JCM M;  3CCM F;  4BW0 B;  1VQ9 F;  5FLX M;  1N8R H;  1E7K A;  1YHQ F;  3CMA F;  3HJW C;  1YIT F;  2OTL F;  1K73 H;  2QI2 A;  1VQK F;  1K8A H;  3N4Y A;  3HAX D;  3CCQ F;  3J81 M;  4C4W C;  3LWQ C;  3VMF B;  2BO1 A;  3E20 B;  3J80 M;  3CC2 F;  1W40 A;  1K9M H;  2I6D A;  3CC4 F;  1ZWZ A;  3GYQ A;  3FFM A;  1NMU B;  1PXW A;  1W3E X;  3G71 F; 
#chains in the Genus database with same CATH topology
 3OW2 F;  5EYP B;  3VOB A;  1VQP F;  2HS4 A;  5HXZ A;  5HY1 A;  1XHO A;  5JH7 B;  1QVG F;  1IV2 A;  5IYZ A;  2EWC A;  5FJ4 C;  1S72 F;  1J7H A;  2H8C A;  2CZW A;  4TUY B;  2UYN B;  3ZO8 A;  3LWP C;  4R40 B;  1YJN F;  3HKB B;  5JCO C;  5EIB C;  1QVF F;  1W57 A;  2FC3 A;  4ZOL B;  1JD1 A;  3RA6 A;  1YJ9 F;  4U3J B;  4ZI7 B;  3OON A;  1SA0 B;  4X3L A;  3ELC A;  3IEW A;  4O4J B;  3RYF B;  4NUT A;  2QEX F;  3CCE F;  4HNA A;  5LA6 A;  1H48 A;  3F0F A;  3RYH A;  1CLI A;  4B5C A;  3LDT A;  4G4Y A;  1W5F A;  3SIU A;  3N2K A;  1IPA A;  4EI9 A;  3NMU C;  3CXC F;  4DXD A;  1UI9 A;  1T0K B;  1DT9 A;  3K14 A;  1VK3 A;  5J2U A;  2B33 A;  4TV8 B;  5LXT A;  4X1I A;  3MBM A;  4EB6 A;  4C8G A;  3L7Q A;  4X1Y A;  1U43 A;  1TUB B;  1VQV A;  1Q8R A;  3QHD A;  2FGY A;  3LWO C;  3JAW B;  2IAF A;  4IIJ B;  1RLU A;  5HWE A;  3RYI A;  3UT5 A;  3JVH A;  5KX5 B;  2PHN A;  5IJ9 A;  3HKB A;  3JAM M;  1FFX B;  2VXY A;  2CSL A;  1X7P A;  1RA4 A;  2VAP A;  4O4H B;  1YI2 F;  4G4V A;  1T0A A;  5LYJ B;  3RYC A;  4ZI7 A;  5MN4 A;  3HKE A;  1YJW F;  3G4S F;  5BMV A;  3RA5 A;  4O2A B;  3JCM M;  2RHO A;  5JVD B;  3CCM F;  2HS3 A;  5FLX M;  3N2G B;  1E7K A;  4M8I A;  3R0P A;  5KMG B;  2IQQ A;  4ZK7 A;  3J81 M;  2Z1E A;  5B8F A;  3VMF B;  3E20 B;  3J80 M;  3CC2 F;  1W40 A;  1K9M H;  3HKD A;  3IMP A;  4NWO B;  3VYU C;  2YXZ A;  2BTU A;  5J2U B;  2YYE A;  1W3E X;  2K1S A;  3G71 F;  3LWV C;  3VYT C;  3WPX A;  2KTU A;  3DC2 A;  3N4Z A;  4BT5 A;  4BT2 A;  4G4Z A;  1SDS A;  1X25 A;  5GAN K;  1H47 A;  1YQN A;  3CPW F;  3KE1 A;  4I55 A;  3JAW A;  4IIJ A;  2G9I A;  3OBY A;  3MDO A;  4B46 A;  4WBN B;  4ZHV A;  1XBI A;  4HNA B;  1W59 A;  3WJR A;  2CHT A;  4XCQ A;  2WAL A;  3I3F A;  1X7O A;  3V7Q A;  3CME F;  1YIJ F;  2BTO A;  2HP0 B;  3LYB A;  3N2K B;  2JNB A;  5LP6 B;  3I55 F;  3MCA B;  3ERN A;  4X3M A;  3SIV A;  5BMV B;  1VQ4 F;  3CCS F;  2H8E A;  1RQ7 A;  3E22 A;  2ALE A;  1NQ3 A;  1GO0 A;  1X52 A;  3WXM B;  4KWE A;  1PF5 A;  1VQ7 F;  2VGM A;  4TZZ A;  4X1K A;  2L26 A;  3F0E A;  2V9Y A;  4I50 A;  4BT7 A;  5JCO A;  3TD3 A;  5CA0 B;  3CCL F;  3P4E A;  4ZHQ B;  4U39 A;  3P10 A;  5HP8 A;  3WGL A;  2MQE A;  3BYQ A;  3WGN A;  3LWR C;  2VGN A;  3CYP B;  3TD5 A;  3GTZ A;  5GAP K;  3CCU F;  3WJP A;  1XV2 A;  1Z5V A;  2UYJ A;  3EOR A;  4BVQ A;  2W8B C;  3VTI C;  1JFF A;  5FNV B;  3F6M A;  2KTV A;  3CC7 F;  2VAW A;  1VH8 A;  5KX5 A;  3K12 A;  5IJ9 B;  1FSZ A;  4LCK A;  3O85 A;  1CK2 A;  3JAS B;  5G4V C;  2OTJ F;  3QUW A;  4TUY A;  3WGK A;  1Q82 H;  4G4X A;  1Q81 H;  2DYY A;  3C9U A;  2RB9 A;  4O2A A;  2NMU A;  5JVD A;  5GIN C;  4WBN A;  1COM A;  1VQL F;  4DRX B;  5GON A;  2LBX A;  3CB2 A;  5EZY B;  1JN1 A;  2GVI A;  3CG6 A;  2AMT A;  3U0O A;  2GZL A;  4BW0 B;  5HY2 A;  1VQ9 F;  5LA6 B;  5LP6 C;  1N8R H;  3C9T A;  5HY4 A;  3ZP4 A;  1XRG A;  3HJW C;  2OTL F;  4F6R B;  4O4I A;  5ITZ B;  1VQK F;  3V3T A;  4G4W A;  4YJ2 B;  2CHS A;  4RQO A;  4X20 B;  3QTY A;  5LOV B;  5J2T B;  2RHJ A;  2GLZ A;  4I50 B;  3HKC B;  3CC4 F;  4TV9 B;  3GYQ A;  3S06 A;  4I4T B;  3FFM A;  3CYQ A;  1Z5W A;  4NQ3 A;  5HP7 A;  5C8Y A;  5JQG B;  1KNK A;  3MQW A;  1W55 A;  3NVI B;  2HQS C;  3PAF A;  2Z1F A;  1U3L A;  2QTP A;  1TUB A;  4O2B B;  3JAR B;  3RE3 A;  5EYP A;  4B45 A;  4BVS A;  5EAZ A;  3NVK E;  2OZB A;  2RHH A;  3KJK A;  5IYZ B;  3M84 A;  5EO3 A;  4C82 A;  3M4S A;  3G6E F;  3JAL A;  2DT4 A;  2PMP A;  3CCR F;  4E6E A;  2Z1T A;  3VYS C;  5MN5 A;  3HWU A;  3K0T A;  3K2X A;  5EWR A;  2ZVZ A;  3JAT A;  4BVT A;  3WPW A;  3RYC B;  4YJ3 A;  5IJ0 A;  2ZF8 A;  2LBT A;  5DCV A;  4IHJ B;  1VQO F;  3E1Y A;  2RHL A;  2P6Y A;  4ZHQ A;  4C8E A;  3PLA C;  1KC8 H;  1QAH A;  4BT3 A;  3N2G A;  3F0D A;  5CA1 A;  3VO8 A;  1VQM F;  3Q8H A;  3RYH B;  1VQ5 F;  4O4L A;  5ITZ A;  5EB1 B;  2HRU A;  3P0Z A;  4BT4 A;  5LOV A;  3KHN A;  4B62 A;  4C81 A;  1KQS F;  3V4D A;  3HKC A;  3D01 A;  1VQ6 F;  1W58 1;  3T80 A;  5GIO C;  3VCZ A;  3IR9 A;  4PWT A;  4TV8 A;  3CD6 F;  4X1I B;  2HX0 A;  4RHA A;  5EIB D;  3S0W A;  3TD4 A;  4EB6 B;  1FFX A;  1W41 A;  3LFO A;  1VQ8 F;  1M1K H;  4DRX A;  5HY0 A;  5GON B;  1KD1 H;  2IG8 A;  1ONI A;  3HKE B;  5CB4 A;  4C8I A;  2Z1U A;  3CCV F;  5AVM A;  1UFY A;  3I7T A;  3KJJ A;  2HVY D;  1Q86 H;  1SZQ A;  1VQN F;  4G88 A;  1VHA A;  2F9Z C;  2VAM A;  4YJ2 A;  1IV3 A;  3C9S A;  3VOA A;  4X20 A;  5J2T A;  3JAT B;  3F0G A;  3FD6 A;  1GX1 A;  5EB0 A;  5LYJ A;  1IV4 A;  3MCQ A;  3CMA F;  4IHJ A;  1YIT F;  1K73 H;  2H6L A;  1W5B A;  2QI2 A;  3D00 A;  1K8A H;  3E22 B;  3N4Y A;  2UZH A;  2R6R 1;  4BVR A;  4C4W C;  5CA1 B;  1OAP A;  2BTQ B;  3LWQ C;  4O4L B;  3S0Y A;  2UYP A;  5CA0 A;  4EI7 A;  4LNU A;  3ESJ A;  3FD5 A;  1W5E A;  1NMU B;  1PXW A;  1QU9 A;  3JAR A;  3CCJ F;  1R1M A;  3GHZ A;  1FNJ A;  2UYK A;  3IKF A;  1IV1 A;  2AIZ P;  3J7A R;  2KGW A;  3JAK A;  3HTN A;  3WGJ A;  3VIU A;  1Q7Y H;  1TVK A;  4ZHW A;  1KNJ A;  2LCA A;  3VI6 A;  3RYI B;  1W5A A;  2HRY A;  5JH7 A;  2CVL A;  3KIZ A;  3OBW A;  1CN7 A;  2HP0 A;  2UYN A;  3ON1 A;  2N48 A;  3V7E A;  3S03 A;  5CB4 B;  2KG4 A;  2HS0 A;  4ERH A;  3FBA A;  1JY8 A;  5GIP C;  1RQ2 A;  3I56 F;  4ZOL A;  1M90 H;  5IT9 M;  3NK7 A;  2Q1Y A;  4X1K B;  1JJ2 F;  3ZOP A;  2HP3 A;  4O4J A;  1H7M A;  3RYF A;  3WJQ A;  1GZ0 A;  5MN6 A;  2AIF A;  2ZAU A;  2CW4 A;  2ZOD A;  5A2Q M;  3ZP7 A;  2OHW A;  4FFB A;  4O4I B;  3HKD B;  4EI8 A;  2ZVY A;  4ZHY B;  3IKE A;  1FNK A;  3AGK A;  3NK6 A;  3S0H A;  1NJI H;  2QA4 F;  2OTM A;  1JFF B;  3C9R A;  5FNV A;  4TV9 A;  3IEQ A;  1W2B F;  1OFU A;  1GO1 A;  1DBF A;  5JQG A;  4BY9 D;  3DDN A;  4I55 B;  2Q1X A;  1TVK B;  1U3P A;  1W42 A;  3FPI A;  2LBW A;  1RLG A;  4U3J A;  3WGM A;  1SA0 A;  5G4U C;  3C8L A;  3JAS A;  5LP6 A;  3JAL B;  3UT5 B;  3S02 A;  1QD9 A;  5HXU A;  2R75 1;  3CPQ A;  1U40 A;  4BT6 A;  2CWJ A;  2Z01 A;  2I6R A;  4O4H A;  4YJ3 B;  5IJ0 B;  1YHQ F;  5EZY A;  2ZOV A;  3HAX D;  4LNU B;  3CCQ F;  3LME A;  4I4T A;  1ODE A;  2BO1 A;  5C8Y B;  5LXT B;  4FFB B;  4F6R A;  2I6D A;  3M1X A;  3B6N A;  3JAK B;  1ZWZ A;  1YGY A;  5KMG A;  3D54 A;  4O2B A;  4X1Y B; 
#chains in the Genus database with same CATH homology
 4NQ3 A;  3CCJ F;  3OW2 F;  1VQP F;  5HXZ A;  3LWV C;  5HY1 A;  3J7A R;  2KTU A;  3N4Z A;  1SDS A;  3NVI B;  3PAF A;  1QVG F;  5GAN K;  5FJ4 C;  1Q7Y H;  3CPW F;  1S72 F;  3VI6 A;  2CZW A;  4BVS A;  3NVK E;  2OZB A;  3LWP C;  1YJN F;  3OBW A;  5EO3 A;  3OBY A;  1QVF F;  1CN7 A;  2FC3 A;  3G6E F;  1XBI A;  3RA6 A;  1YJ9 F;  3ON1 A;  3CCR F;  3V7E A;  4XCQ A;  2WAL A;  1X7O A;  3V7Q A;  4X3L A;  2KG4 A;  3CME F;  1YIJ F;  5GIP C;  4NUT A;  3I56 F;  2QEX F;  5EWR A;  2JNB A;  3I55 F;  3CCE F;  1M90 H;  3MCA B;  4BVT A;  5DCV A;  4X3M A;  3NK7 A;  5IT9 M;  3SIV A;  1JJ2 F;  1VQO F;  1VQ4 F;  3CCS F;  3E1Y A;  2ALE A;  3PLA C;  3SIU A;  1H7M A;  1KC8 H;  1GO0 A;  1GZ0 A;  1X52 A;  2AIF A;  3WXM B;  1VQ7 F;  1IPA A;  2VGM A;  4EI9 A;  5A2Q M;  4TZZ A;  1VQM F;  1VQ5 F;  3NMU C;  2OHW A;  3CXC F;  3CCL F;  4EI8 A;  1T0K B;  1DT9 A;  3AGK A;  1NJI H;  3NK6 A;  2QA4 F;  1KQS F;  3LWR C;  2VGN A;  5GAP K;  1VQ6 F;  3CCU F;  1W2B F;  5GIO C;  4BVQ A;  1GO1 A;  3IR9 A;  3CD6 F;  4BY9 D;  2KTV A;  3CC7 F;  2FGY A;  3LWO C;  1VQ8 F;  1W41 A;  3LFO A;  3O85 A;  1CK2 A;  5G4V C;  4LCK A;  2OTJ F;  1W42 A;  1M1K H;  5HWE A;  5HY0 A;  2LBW A;  1Q82 H;  1RLG A;  1KD1 H;  1Q81 H;  3JAM M;  5G4U C;  1X7P A;  3CCV F;  5GIN C;  1RA4 A;  1VQL F;  1YI2 F;  2HVY D;  2LBX A;  1Q86 H;  1YJW F;  1VQN F;  3G4S F;  5HXU A;  2F9Z C;  3RA5 A;  3CG6 A;  3CPQ A;  3JCM M;  3CCM F;  4BW0 B;  5HY2 A;  1VQ9 F;  5FLX M;  1N8R H;  1E7K A;  5HY4 A;  1YHQ F;  3CMA F;  3HJW C;  1YIT F;  2OTL F;  1K73 H;  2QI2 A;  3D00 A;  3V3T A;  3N4Y A;  1K8A H;  1VQK F;  3HAX D;  3CCQ F;  4BVR A;  3J81 M;  4C4W C;  3LWQ C;  2GLZ A;  3VMF B;  2BO1 A;  3E20 B;  3J80 M;  3CC2 F;  1W40 A;  1K9M H;  2I6D A;  3CC4 F;  4EI7 A;  1ZWZ A;  3GYQ A;  3FFM A;  1NMU B;  1PXW A;  1W3E X;  3G71 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...