1VQNF

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqnF00
3RA5A 3CXCF 3HJWC 1YI2F 5DCVA 1ZWZA 2ALEA 3JAMM 1GO1A 5GIPC 3LWRC 2OTLF 3CPQA 1E7KA 4C4WC 4BY9D 1YJNF 1PXWA 1Q7YH 3G71F 1M1KH 1RLGA 1YIJF 1QVFF 5FLXM 1RA4A 3G4SF 3J80M 1NMUB 1XBIA 2WALA 1VQ5F 1YHQF 3N4YA 1W41A 3RA6A 5EWRA 3OBWA 3CCJF 1M90H 3NMUC 3CCLF 3N4ZA 4BW0B 1YITF 1W40A 3NK7A 5GIOC 1NJIH 3VMFB 3LWQC 2CZWA 2OZBA 3OBYA 3AGKA 1T0KB 1VQ9F 5FJ4C 2OHWA 3CCEF 3LWPC 3GYQA 1W3EX 3PAFA 1VQLF 1VQNF 1S72F 3NK6A 3SIVA 4TZZA 3CC4F 3E1YA 1JJ2F 3LWOC 1SDSA 1VQ6F 3J81M 1VQ4F 3WXMB 1YJ9F 1X52A 1VQ7F 2KTVA 3CCSF 3IR9A 4NUTA 2KTUA 3CCRF 3O85A 5G4UC 1VQOF 3CC2F 1VQ8F 3ON1A 1N8RH 3E20B 3LWVC 3NVKE 5EO3A 3V7QA 1VQKF 2OTJF 5G4VC 2I6DA 1VQMF 2VGMA 1QVGF 2JNBA 2QEXF 1KC8H 1GO0A 1X7OA 3CD6F 3HAXD 1Q86H 1K73H 3CPWF 3V7EA 3CC7F 1IPAA 2AIFA 1KQSF 3JCMM 5GANK 2LBXA 3CMAF 2KG4A 5GAPK 3G6EF 1YJWF 2VGNA 3I55F 1K9MH 3CCVF 2HVYD 5A2QM 3LFOA 3J7AR 1CK2A 1VQPF 4X3MA 3OW2F 1W2BF 2LBWA 2BO1A 3VI6A 1CN7A 1GZ0A 1Q82H 3NVIB 1H7MA 3CG6A 3I56F 2QI2A 1DT9A 1K8AH 1Q81H 3SIUA 5IT9M 3CMEF 1X7PA 3MCAB 5GINC 4X3LA 3FFMA 3CCUF 1W42A 3CCMF 3PLAC 2QA4F 4LCKA 3CCQF 1KD1H 2FC3A
chains in the Genus database with same CATH superfamily
5LYJB 2CHTA 5HXUA 2B33A 3N2GA 4HNAA 1TUBB 1SZQA 2IAFA 4B5CA 5EIBC 3KJJA 2ZODA 1QVFF 1RA4A 1W55A 3RE3A 1VH8A 3QUWA 2FGYA 4FFBA 5JQGB 4YJ3A 1XBIA 2RB9A 1VQ5F 1YHQF 3N4YA 5EYPB 3V3TA 4F6RB 3JATB 1QU9A 4ERHA 4I50A 3N4ZA 1QAHA 3BYQA 4BW0B 3NK7A 3VOAA 5J2TA 5GIOC 2EWCA 3K12A 3K2XA 3IKEA 4C8EA 1W59A 1UI9A 3S0HA 3C9UA 5FJ4C 1FNJA 1U43A 3F0GA 3NK6A 3SIVA 4TZZA 3JAWA 3TD3A 2UYJA 3E1YA 3CC4F 3B6NA 3LWOC 3FD5A 1VQ4F 2GLZA 2HS3A 1X52A 3T80A 3D54A 4G4YA 3WGMA 3C9RA 4O4JB 5LP6A 2BTOA 1RLUA 1GX1A 4X1YB 1W5AA 1XHOA 2OTJF 5G4VC 3HKDB 5KMGA 5HY4A 3HKEB 3DDNA 1JN1A 4YJ2B 4BVTA 5MN4A 3FD6A 5HWEA 3C9SA 4X20B 3KE1A 1FFXA 3KHNA 5CA1B 5KX5A 2I6RA 2DYYA 4O2AB 3CMAF 2PHNA 1XRGA 5GAPK 2UYNB 3ZP7A 4IHJA 4XCQA 1W581 4BVSA 5A2QM 5B8FA 5BMVA 1VQPF 4X3MA 3OW2F 2G9IA 5HY1A 3LMEA 3DC2A 2BO1A 1GZ0A 4TUYB 1K8AH 3WJQA 1Q81H 3JARA 5IT9M 3CB2A 4BVQA 3HTNA 2F9ZC 3HKBB 3JASA 4TV8B 5IYZA 3CCUF 5JH7B 3CCMF 5LOVA 1W5FA 3OONA 2R751 2K1SA 4B62A 3MCQA 3CYQA 3RA5A 1Q8RA 1JFFA 3HJWC 4G4VA 1YI2F 5DCVA 1ZWZA 5J2UA 5GIPC 3MQWA 5CB4A 2OTLF 4C4WC 3HKCB 2N48A 5LYJA 4DXDA 3E22B 3GTZA 3Q8HA 5JVDB 3TD4A 1M1KH 4U3JB 4DRXB 1TUBA 2MQEA 4G4WA 5FLXM 3G4SF 3J80M 1NMUB 4LNUA 3U0OA 4G4XA 4E6EA 4ZI7B 1U3PA 1SA0A 3CCLF 1YITF 1W40A 3CYPB 4EI9A 4BT3A 3JATA 4I4TA 5CA0A 1TVKA 2OZBA 3RYHA 5GONB 2H8CA 1PF5A 1OAPA 5MN5A 3AGKA 4U39A 2Q1XA 3JALB 3GYQA 2Z1UA 4EB6A 3F6MA 3PAFA 4X1IB 1VQNF 4O4HB 5JCOA 1S72F 5MN6A 5LXTB 1JD1A 4ZOLB 1QD9A 4I55B 4BVRA 3RYCA 1YJ9F 3FBAA 3LYBA 4BT6A 3S03A 3CCSF 2ZAUA 4O4IA 5IJ0A 3F0DA 3WJRA 1COMA 3S06A 3JVHA 5HXZA 1VQ8F 1XV2A 3LWVC 3NVKE 5EO3A 4PWTA 3V7QA 4X1KB 4WBNB 1VQMF 4G4ZA 3S02A 4IIJB 2QEXF 1KC8H 3HAXD 1Q86H 3CPWF 5LA6A 3CC7F 4BT5A 3RYIA 3K14A 5ITZB 2LBXA 2LCAA 2Q1YA 3N2GB 1W5BA 1YJWF 4HNAB 2VGNA 2AIZP 4KWEA 4O4LA 2HVYD 1NQ3A 3VCZA 2VAMA 1CK2A 5FNVA 1W2BF 2P6YA 2H6LA 2ZOVA 5EAZA 4FFBB 1Z5VA 4YJ3B 2QI2A 3D01A 3RYFA 4ZHQA 5EZYA 3IMPA 4I50B 3GHZA 3M4SA 3FFMA 4RQOA 3JAKA 1KNKA 2HRUA 4X3LA 3R0PA 5J2TB 1IV2A 2YXZA 3UT5A 4C8IA 2NMUA 2QA4F 5IJ9A 3VYUC 1VHAA 1ONIA 1H47A 3CXCF 4BT7A 1X25A 2ALEA 4O2BA 3CPQA 2HRYA 3QTYA 4BY9D 1YJNF 3K0TA 2ZF8A 3G71F 1RLGA 3KJKA 4R40B 2V9YA 5LP6B 3N2KA 3P4EA 3WGJA 2HP0A 2WALA 1W41A 5EWRA 4BT2A 4TV9A 1M90H 3NMUC 1IV1A 1R1MA 5KMGB 5EIBD 5C8YA 1YQNA 3L7QA 1NJIH 2Z1TA 1H48A 1FFXB 1ODEA 5KX5B 4ZHYB 3OBYA 1FSZA 2RHOA 1T0KB 2OHWA 3CCEF 3ELCA 1VQLF 4IHJB 4RHAA 2GVIA 3WJPA 1VQVA 1Z5WA 1KNJA 1JJ2F 1VQ6F 4ZHWA 5BMVB 2GZLA 2RHLA 2PMPA 4NUTA 2KTUA 5AVMA 3O85A 5JQGA 3CC2F 2OTMA 3JARB 5EYPA 3FPIA 3ON1A 1N8RH 3E20B 4F6RA 2H8EA 3P10A 2CW4A 2RHJA 2VGMA 3ERNA 3I3FA 3JASB 5IYZB 1QVGF 1T0AA 2JNBA 3C9TA 2BTQB 3ZP4A 2CWJA 1X7OA 5LOVB 3V7EA 1UFYA 5GANK 3D00A 1JFFB 2VAWA 3P0ZA 5J2UB 5CB4B 3I55F 3LFOA 2ZVZA 2IG8A 3J7AR 2QTPA 4G88A 2W8BC 3VI6A 4C82A 1Q82H 3NVIB 3CG6A 4O4JA 3I56F 4ZHVA 4LNUB 1DT9A 2RHHA 3SIUA 3QHDA 4X1YA 3WPXA 2ZVYA 3CMEF 3V4DA 1SA0B 3MCAB 1RQ7A 1RQ2A 3HKDA 1IV3A 2Z1EA 3HKEA 2BTUA 4YJ2A 3PLAC 3VOBA 1CLIA 4I4TB 4X20A 5CA0B 1TVKB 2R6R1 3RYHB 3F0FA 2FC3A 2HP3A 5CA1A 1DBFA 5HY0A 4O2AA 2CVLA 4EB6B 2UYNA 3JAMM 2VAPA 1GO1A 1W5EA 3LWRC 3M1XA 1E7KA 4B46A 3WGKA 3RYCB 1PXWA 2VXYA 1Q7YH 3WGLA 1VK3A 4EI8A 1YIJF 3M84A 4C8GA 4O4IB 5IJ0B 4TUYA 5EB1B 2HS4A 3EORA 3RA6A 3OBWA 3CCJF 2UYKA 3IEQA 3HKBA 4TV8A 3TD5A 5HY2A 2Z1FA 5JH7A 5LA6B 2CSLA 3VMFB 3VYSC 3LWQC 2CZWA 3RYIB 5JCOC 3ZOPA 3JAWB 3I7TA 3S0YA 1VQ9F 1U3LA 3ESJA 3LWPC 1W3EX 2HQSC 3WGNA 2Z01A 3MBMA 1JY8A 4O4LB 1OFUA 2UZHA 3HKCA 1SDSA 3IEWA 3E22A 3J81M 5FNVB 3WXMB 4BT4A 5JVDA 1U40A 4U3JA 4DRXA 2LBTA 1VQ7F 2KTVA 1IV4A 3IR9A 3ZO8A 4C81A 3CCRF 4ZK7A 3RYFB 4ZHQB 5G4UC 1VQOF 3VO8A 5EZYB 3C8LA 3HWUA 2IQQA 1VQKF 2I6DA 4ZI7A 3JAKB 2YYEA 4EI7A 1GO0A 3VIUA 3CD6F 3UT5B 3F0EA 1K73H 3VYTC 3KIZA 5IJ9B 1IPAA 2AIFA 1KQSF 3JCMM 2HS0A 5GONA 2KG4A 3VTIC 5LP6C 3JALA 3G6EF 2AMTA 4X1IA 3S0WA 4O4HA 4O2BB 5HP8A 5LXTA 3IKFA 1K9MH 3CCVF 4ZOLA 4I55A 4B45A 4NWOB 2LBWA 1W57A 3N2KB 1CN7A 4NQ3A 1J7HA 1H7MA 2HP0B 3LDTA 2DT4A 4TV9B 3MDOA 4M8IA 1X7PA 5EB0A 5GINC 4X1KA 1FNKA 4WBNA 5C8YB 1W42A 4IIJA 5HP7A 2L26A 3WPWA 2CHSA 4LCKA 1YGYA 2UYPA 3CCQF 1KD1H 2HX0A 5ITZA 2KGWA
chains in the Genus database with same CATH topology
5HY0A 3RA5A 3CXCF 3HJWC 1YI2F 5HXUA 5DCVA 1ZWZA 2ALEA 3JAMM 1GO1A 5GIPC 3LWRC 2OTLF 3CPQA 1E7KA 4C4WC 4BY9D 1YJNF 1PXWA 1Q7YH 3G71F 1M1KH 1RLGA 4EI8A 1YIJF 1QVFF 5FLXM 1RA4A 3G4SF 2FGYA 3J80M 1NMUB 1XBIA 2WALA 1VQ5F 1YHQF 3N4YA 3V3TA 1W41A 3RA6A 5EWRA 3OBWA 3CCJF 1M90H 3NMUC 3CCLF 3N4ZA 4BW0B 5HY2A 1YITF 1W40A 3NK7A 5GIOC 4EI9A 3VMFB 1NJIH 3LWQC 2CZWA 2OZBA 3OBYA 3AGKA 1T0KB 1VQ9F 5FJ4C 2OHWA 3CCEF 3LWPC 3GYQA 1W3EX 3PAFA 1VQLF 1VQNF 1S72F 3NK6A 3SIVA 4TZZA 3CC4F 3E1YA 1JJ2F 3LWOC 1SDSA 1VQ6F 3J81M 4BVRA 3WXMB 1VQ4F 1YJ9F 2GLZA 1X52A 1VQ7F 2KTVA 3CCSF 3IR9A 4NUTA 2KTUA 3CCRF 3O85A 5G4UC 1VQOF 3CC2F 5HXZA 1VQ8F 3ON1A 1N8RH 3E20B 3LWVC 3NVKE 5EO3A 3V7QA 1VQKF 2OTJF 5G4VC 2I6DA 1VQMF 2VGMA 5HY4A 1QVGF 2JNBA 4EI7A 2QEXF 1KC8H 1X7OA 1GO0A 3CD6F 3HAXD 1Q86H 4BVTA 1K73H 3CPWF 3V7EA 5HWEA 3CC7F 1IPAA 2AIFA 1KQSF 3JCMM 5GANK 3D00A 2LBXA 3CMAF 2KG4A 5GAPK 3G6EF 1YJWF 4XCQA 2VGNA 4BVSA 3I55F 1K9MH 3CCVF 2HVYD 5A2QM 3LFOA 3J7AR 1CK2A 1VQPF 4X3MA 3OW2F 1W2BF 5HY1A 2LBWA 2BO1A 3VI6A 1CN7A 1GZ0A 4NQ3A 1Q82H 3NVIB 1H7MA 3CG6A 3I56F 2QI2A 1DT9A 1K8AH 1Q81H 3SIUA 5IT9M 4BVQA 3CMEF 2F9ZC 1X7PA 3MCAB 5GINC 4X3LA 3FFMA 3CCUF 1W42A 3CCMF 3PLAC 2QA4F 4LCKA 3CCQF 1KD1H 2FC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RA5 A;  3CXC F;  3HJW C;  1YI2 F;  5DCV A;  1ZWZ A;  2ALE A;  3JAM M;  1GO1 A;  5GIP C;  3LWR C;  2OTL F;  3CPQ A;  1E7K A;  4C4W C;  4BY9 D;  1YJN F;  1PXW A;  1Q7Y H;  3G71 F;  1M1K H;  1RLG A;  1YIJ F;  1QVF F;  5FLX M;  1RA4 A;  3G4S F;  3J80 M;  1NMU B;  1XBI A;  2WAL A;  1VQ5 F;  1YHQ F;  3N4Y A;  1W41 A;  3RA6 A;  5EWR A;  3OBW A;  3CCJ F;  1M90 H;  3NMU C;  3CCL F;  3N4Z A;  4BW0 B;  1YIT F;  1W40 A;  3NK7 A;  5GIO C;  1NJI H;  3VMF B;  3LWQ C;  2CZW A;  2OZB A;  3OBY A;  3AGK A;  1T0K B;  1VQ9 F;  5FJ4 C;  2OHW A;  3CCE F;  3LWP C;  3GYQ A;  1W3E X;  3PAF A;  1VQL F;  1VQN F;  1S72 F;  3NK6 A;  3SIV A;  4TZZ A;  3CC4 F;  3E1Y A;  1JJ2 F;  3LWO C;  1SDS A;  1VQ6 F;  3J81 M;  1VQ4 F;  3WXM B;  1YJ9 F;  1X52 A;  1VQ7 F;  2KTV A;  3CCS F;  3IR9 A;  4NUT A;  2KTU A;  3CCR F;  3O85 A;  5G4U C;  1VQO F;  3CC2 F;  1VQ8 F;  3ON1 A;  1N8R H;  3E20 B;  3LWV C;  3NVK E;  5EO3 A;  3V7Q A;  1VQK F;  2OTJ F;  5G4V C;  2I6D A;  1VQM F;  2VGM A;  1QVG F;  2JNB A;  2QEX F;  1KC8 H;  1GO0 A;  1X7O A;  3CD6 F;  3HAX D;  1Q86 H;  1K73 H;  3CPW F;  3V7E A;  3CC7 F;  1IPA A;  2AIF A;  1KQS F;  3JCM M;  5GAN K;  2LBX A;  3CMA F;  2KG4 A;  5GAP K;  3G6E F;  1YJW F;  2VGN A;  3I55 F;  1K9M H;  3CCV F;  2HVY D;  5A2Q M;  3LFO A;  3J7A R;  1CK2 A;  1VQP F;  4X3M A;  3OW2 F;  1W2B F;  2LBW A;  2BO1 A;  3VI6 A;  1CN7 A;  1GZ0 A;  1Q82 H;  3NVI B;  1H7M A;  3CG6 A;  3I56 F;  2QI2 A;  1DT9 A;  1K8A H;  1Q81 H;  3SIU A;  5IT9 M;  3CME F;  1X7P A;  3MCA B;  5GIN C;  4X3L A;  3FFM A;  3CCU F;  1W42 A;  3CCM F;  3PLA C;  2QA4 F;  4LCK A;  3CCQ F;  1KD1 H;  2FC3 A; 
#chains in the Genus database with same CATH topology
 5LYJ B;  2CHT A;  5HXU A;  2B33 A;  3N2G A;  4HNA A;  1TUB B;  1SZQ A;  2IAF A;  4B5C A;  5EIB C;  3KJJ A;  2ZOD A;  1QVF F;  1RA4 A;  1W55 A;  3RE3 A;  1VH8 A;  3QUW A;  2FGY A;  4FFB A;  5JQG B;  4YJ3 A;  1XBI A;  2RB9 A;  1VQ5 F;  1YHQ F;  3N4Y A;  5EYP B;  3V3T A;  4F6R B;  3JAT B;  1QU9 A;  4ERH A;  4I50 A;  3N4Z A;  1QAH A;  3BYQ A;  4BW0 B;  3NK7 A;  3VOA A;  5J2T A;  5GIO C;  2EWC A;  3K12 A;  3K2X A;  3IKE A;  4C8E A;  1W59 A;  1UI9 A;  3S0H A;  3C9U A;  5FJ4 C;  1FNJ A;  1U43 A;  3F0G A;  3NK6 A;  3SIV A;  4TZZ A;  3JAW A;  3TD3 A;  2UYJ A;  3E1Y A;  3CC4 F;  3B6N A;  3LWO C;  3FD5 A;  1VQ4 F;  2GLZ A;  2HS3 A;  1X52 A;  3T80 A;  3D54 A;  4G4Y A;  3WGM A;  3C9R A;  4O4J B;  5LP6 A;  2BTO A;  1RLU A;  1GX1 A;  4X1Y B;  1W5A A;  1XHO A;  2OTJ F;  5G4V C;  3HKD B;  5KMG A;  5HY4 A;  3HKE B;  3DDN A;  1JN1 A;  4YJ2 B;  4BVT A;  5MN4 A;  3FD6 A;  5HWE A;  3C9S A;  4X20 B;  3KE1 A;  1FFX A;  3KHN A;  5CA1 B;  5KX5 A;  2I6R A;  2DYY A;  4O2A B;  3CMA F;  2PHN A;  1XRG A;  5GAP K;  2UYN B;  3ZP7 A;  4IHJ A;  4XCQ A;  1W58 1;  4BVS A;  5A2Q M;  5B8F A;  5BMV A;  1VQP F;  4X3M A;  3OW2 F;  2G9I A;  5HY1 A;  3LME A;  3DC2 A;  2BO1 A;  1GZ0 A;  4TUY B;  1K8A H;  3WJQ A;  1Q81 H;  3JAR A;  5IT9 M;  3CB2 A;  4BVQ A;  3HTN A;  2F9Z C;  3HKB B;  3JAS A;  4TV8 B;  5IYZ A;  3CCU F;  5JH7 B;  3CCM F;  5LOV A;  1W5F A;  3OON A;  2R75 1;  2K1S A;  4B62 A;  3MCQ A;  3CYQ A;  3RA5 A;  1Q8R A;  1JFF A;  3HJW C;  4G4V A;  1YI2 F;  5DCV A;  1ZWZ A;  5J2U A;  5GIP C;  3MQW A;  5CB4 A;  2OTL F;  4C4W C;  3HKC B;  2N48 A;  5LYJ A;  4DXD A;  3E22 B;  3GTZ A;  3Q8H A;  5JVD B;  3TD4 A;  1M1K H;  4U3J B;  4DRX B;  1TUB A;  2MQE A;  4G4W A;  5FLX M;  3G4S F;  3J80 M;  1NMU B;  4LNU A;  3U0O A;  4G4X A;  4E6E A;  4ZI7 B;  1U3P A;  1SA0 A;  3CCL F;  1YIT F;  1W40 A;  3CYP B;  4EI9 A;  4BT3 A;  3JAT A;  4I4T A;  5CA0 A;  1TVK A;  2OZB A;  3RYH A;  5GON B;  2H8C A;  1PF5 A;  1OAP A;  5MN5 A;  3AGK A;  4U39 A;  2Q1X A;  3JAL B;  3GYQ A;  2Z1U A;  4EB6 A;  3F6M A;  3PAF A;  4X1I B;  1VQN F;  4O4H B;  5JCO A;  1S72 F;  5MN6 A;  5LXT B;  1JD1 A;  4ZOL B;  1QD9 A;  4I55 B;  4BVR A;  3RYC A;  1YJ9 F;  3FBA A;  3LYB A;  4BT6 A;  3S03 A;  3CCS F;  2ZAU A;  4O4I A;  5IJ0 A;  3F0D A;  3WJR A;  1COM A;  3S06 A;  3JVH A;  5HXZ A;  1VQ8 F;  1XV2 A;  3LWV C;  3NVK E;  5EO3 A;  4PWT A;  3V7Q A;  4X1K B;  4WBN B;  1VQM F;  4G4Z A;  3S02 A;  4IIJ B;  2QEX F;  1KC8 H;  3HAX D;  1Q86 H;  3CPW F;  5LA6 A;  3CC7 F;  4BT5 A;  3RYI A;  3K14 A;  5ITZ B;  2LBX A;  2LCA A;  2Q1Y A;  3N2G B;  1W5B A;  1YJW F;  4HNA B;  2VGN A;  2AIZ P;  4KWE A;  4O4L A;  2HVY D;  1NQ3 A;  3VCZ A;  2VAM A;  1CK2 A;  5FNV A;  1W2B F;  2P6Y A;  2H6L A;  2ZOV A;  5EAZ A;  4FFB B;  1Z5V A;  4YJ3 B;  2QI2 A;  3D01 A;  3RYF A;  4ZHQ A;  5EZY A;  3IMP A;  4I50 B;  3GHZ A;  3M4S A;  3FFM A;  4RQO A;  3JAK A;  1KNK A;  2HRU A;  4X3L A;  3R0P A;  5J2T B;  1IV2 A;  2YXZ A;  3UT5 A;  4C8I A;  2NMU A;  2QA4 F;  5IJ9 A;  3VYU C;  1VHA A;  1ONI A;  1H47 A;  3CXC F;  4BT7 A;  1X25 A;  2ALE A;  4O2B A;  3CPQ A;  2HRY A;  3QTY A;  4BY9 D;  1YJN F;  3K0T A;  2ZF8 A;  3G71 F;  1RLG A;  3KJK A;  4R40 B;  2V9Y A;  5LP6 B;  3N2K A;  3P4E A;  3WGJ A;  2HP0 A;  2WAL A;  1W41 A;  5EWR A;  4BT2 A;  4TV9 A;  1M90 H;  3NMU C;  1IV1 A;  1R1M A;  5KMG B;  5EIB D;  5C8Y A;  1YQN A;  3L7Q A;  1NJI H;  2Z1T A;  1H48 A;  1FFX B;  1ODE A;  5KX5 B;  4ZHY B;  3OBY A;  1FSZ A;  2RHO A;  1T0K B;  2OHW A;  3CCE F;  3ELC A;  1VQL F;  4IHJ B;  4RHA A;  2GVI A;  3WJP A;  1VQV A;  1Z5W A;  1KNJ A;  1JJ2 F;  1VQ6 F;  4ZHW A;  5BMV B;  2GZL A;  2RHL A;  2PMP A;  4NUT A;  2KTU A;  5AVM A;  3O85 A;  5JQG A;  3CC2 F;  2OTM A;  3JAR B;  5EYP A;  3FPI A;  3ON1 A;  1N8R H;  3E20 B;  4F6R A;  2H8E A;  3P10 A;  2CW4 A;  2RHJ A;  2VGM A;  3ERN A;  3I3F A;  3JAS B;  5IYZ B;  1QVG F;  1T0A A;  2JNB A;  3C9T A;  2BTQ B;  3ZP4 A;  2CWJ A;  1X7O A;  5LOV B;  3V7E A;  1UFY A;  5GAN K;  3D00 A;  1JFF B;  2VAW A;  3P0Z A;  5J2U B;  5CB4 B;  3I55 F;  3LFO A;  2ZVZ A;  2IG8 A;  3J7A R;  2QTP A;  4G88 A;  2W8B C;  3VI6 A;  4C82 A;  1Q82 H;  3NVI B;  3CG6 A;  4O4J A;  3I56 F;  4ZHV A;  4LNU B;  1DT9 A;  2RHH A;  3SIU A;  3QHD A;  4X1Y A;  3WPX A;  2ZVY A;  3CME F;  3V4D A;  1SA0 B;  3MCA B;  1RQ7 A;  1RQ2 A;  3HKD A;  1IV3 A;  2Z1E A;  3HKE A;  2BTU A;  4YJ2 A;  3PLA C;  3VOB A;  1CLI A;  4I4T B;  4X20 A;  5CA0 B;  1TVK B;  2R6R 1;  3RYH B;  3F0F A;  2FC3 A;  2HP3 A;  5CA1 A;  1DBF A;  5HY0 A;  4O2A A;  2CVL A;  4EB6 B;  2UYN A;  3JAM M;  2VAP A;  1GO1 A;  1W5E A;  3LWR C;  3M1X A;  1E7K A;  4B46 A;  3WGK A;  3RYC B;  1PXW A;  2VXY A;  1Q7Y H;  3WGL A;  1VK3 A;  4EI8 A;  1YIJ F;  3M84 A;  4C8G A;  4O4I B;  5IJ0 B;  4TUY A;  5EB1 B;  2HS4 A;  3EOR A;  3RA6 A;  3OBW A;  3CCJ F;  2UYK A;  3IEQ A;  3HKB A;  4TV8 A;  3TD5 A;  5HY2 A;  2Z1F A;  5JH7 A;  5LA6 B;  2CSL A;  3VMF B;  3VYS C;  3LWQ C;  2CZW A;  3RYI B;  5JCO C;  3ZOP A;  3JAW B;  3I7T A;  3S0Y A;  1VQ9 F;  1U3L A;  3ESJ A;  3LWP C;  1W3E X;  2HQS C;  3WGN A;  2Z01 A;  3MBM A;  1JY8 A;  4O4L B;  1OFU A;  2UZH A;  3HKC A;  1SDS A;  3IEW A;  3E22 A;  3J81 M;  5FNV B;  3WXM B;  4BT4 A;  5JVD A;  1U40 A;  4U3J A;  4DRX A;  2LBT A;  1VQ7 F;  2KTV A;  1IV4 A;  3IR9 A;  3ZO8 A;  4C81 A;  3CCR F;  4ZK7 A;  3RYF B;  4ZHQ B;  5G4U C;  1VQO F;  3VO8 A;  5EZY B;  3C8L A;  3HWU A;  2IQQ A;  1VQK F;  2I6D A;  4ZI7 A;  3JAK B;  2YYE A;  4EI7 A;  1GO0 A;  3VIU A;  3CD6 F;  3UT5 B;  3F0E A;  1K73 H;  3VYT C;  3KIZ A;  5IJ9 B;  1IPA A;  2AIF A;  1KQS F;  3JCM M;  2HS0 A;  5GON A;  2KG4 A;  3VTI C;  5LP6 C;  3JAL A;  3G6E F;  2AMT A;  4X1I A;  3S0W A;  4O4H A;  4O2B B;  5HP8 A;  5LXT A;  3IKF A;  1K9M H;  3CCV F;  4ZOL A;  4I55 A;  4B45 A;  4NWO B;  2LBW A;  1W57 A;  3N2K B;  1CN7 A;  4NQ3 A;  1J7H A;  1H7M A;  2HP0 B;  3LDT A;  2DT4 A;  4TV9 B;  3MDO A;  4M8I A;  1X7P A;  5EB0 A;  5GIN C;  4X1K A;  1FNK A;  4WBN A;  5C8Y B;  1W42 A;  4IIJ A;  5HP7 A;  2L26 A;  3WPW A;  2CHS A;  4LCK A;  1YGY A;  2UYP A;  3CCQ F;  1KD1 H;  2HX0 A;  5ITZ A;  2KGW A; 
#chains in the Genus database with same CATH homology
 5HY0 A;  3RA5 A;  3CXC F;  3HJW C;  1YI2 F;  5HXU A;  5DCV A;  1ZWZ A;  2ALE A;  3JAM M;  1GO1 A;  5GIP C;  3LWR C;  2OTL F;  3CPQ A;  1E7K A;  4C4W C;  4BY9 D;  1YJN F;  1PXW A;  1Q7Y H;  3G71 F;  1M1K H;  1RLG A;  4EI8 A;  1YIJ F;  1QVF F;  5FLX M;  1RA4 A;  3G4S F;  2FGY A;  3J80 M;  1NMU B;  1XBI A;  2WAL A;  1VQ5 F;  1YHQ F;  3N4Y A;  3V3T A;  1W41 A;  3RA6 A;  5EWR A;  3OBW A;  3CCJ F;  1M90 H;  3NMU C;  3CCL F;  3N4Z A;  4BW0 B;  5HY2 A;  1YIT F;  1W40 A;  3NK7 A;  5GIO C;  4EI9 A;  3VMF B;  1NJI H;  3LWQ C;  2CZW A;  2OZB A;  3OBY A;  3AGK A;  1T0K B;  1VQ9 F;  5FJ4 C;  2OHW A;  3CCE F;  3LWP C;  3GYQ A;  1W3E X;  3PAF A;  1VQL F;  1VQN F;  1S72 F;  3NK6 A;  3SIV A;  4TZZ A;  3CC4 F;  3E1Y A;  1JJ2 F;  3LWO C;  1SDS A;  1VQ6 F;  3J81 M;  4BVR A;  3WXM B;  1VQ4 F;  1YJ9 F;  2GLZ A;  1X52 A;  1VQ7 F;  2KTV A;  3CCS F;  3IR9 A;  4NUT A;  2KTU A;  3CCR F;  3O85 A;  5G4U C;  1VQO F;  3CC2 F;  5HXZ A;  1VQ8 F;  3ON1 A;  1N8R H;  3E20 B;  3LWV C;  3NVK E;  5EO3 A;  3V7Q A;  1VQK F;  2OTJ F;  5G4V C;  2I6D A;  1VQM F;  2VGM A;  5HY4 A;  1QVG F;  2JNB A;  4EI7 A;  2QEX F;  1KC8 H;  1X7O A;  1GO0 A;  3CD6 F;  3HAX D;  1Q86 H;  4BVT A;  1K73 H;  3CPW F;  3V7E A;  5HWE A;  3CC7 F;  1IPA A;  2AIF A;  1KQS F;  3JCM M;  5GAN K;  3D00 A;  2LBX A;  3CMA F;  2KG4 A;  5GAP K;  3G6E F;  1YJW F;  4XCQ A;  2VGN A;  4BVS A;  3I55 F;  1K9M H;  3CCV F;  2HVY D;  5A2Q M;  3LFO A;  3J7A R;  1CK2 A;  1VQP F;  4X3M A;  3OW2 F;  1W2B F;  5HY1 A;  2LBW A;  2BO1 A;  3VI6 A;  1CN7 A;  1GZ0 A;  4NQ3 A;  1Q82 H;  3NVI B;  1H7M A;  3CG6 A;  3I56 F;  2QI2 A;  1DT9 A;  1K8A H;  1Q81 H;  3SIU A;  5IT9 M;  4BVQ A;  3CME F;  2F9Z C;  1X7P A;  3MCA B;  5GIN C;  4X3L A;  3FFM A;  3CCU F;  1W42 A;  3CCM F;  3PLA C;  2QA4 F;  4LCK A;  3CCQ F;  1KD1 H;  2FC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...