1VQNF

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqnF00
1VQOF 1QVGF 3WXMB 2JNBA 1M90H 3HJWC 1VQ4F 3CPQA 3NVKE 1GO0A 3J80M 3CPWF 1YI2F 3CC4F 5GAPK 1W3EX 4BY9D 4C4WC 3MCAB 2OHWA 1VQ5F 1RA4A 3NK6A 3FFMA 1X7PA 5GIPC 3CCUF 1CK2A 3O85A 3RA6A 1K8AH 5FJ4C 3NK7A 4X3MA 1YJ9F 5G4VC 3N4ZA 3G6EF 1RLGA 5DCVA 1KD1H 2QEXF 2HVYD 4NUTA 1Q7YH 3CCRF 1K73H 1ZWZA 2ALEA 3IR9A 1X7OA 3G71F 3I55F 3CCLF 3E20B 1CN7A 1NJIH 3LWQC 1YITF 5EO3A 1NMUB 3NVIB 1VQNF 3G4SF 3CC2F 3I56F 1VQPF 5GINC 3LFOA 2WALA 1YJWF 3CCSF 3LWVC 2VGMA 3PAFA 3CCMF 3V7EA 1PXWA 3CXCF 3NMUC 1W41A 5EWRA 2OZBA 3SIVA 1IPAA 1YHQF 2AIFA 1YIJF 1VQ9F 3E1YA 3PLAC 2OTJF 1GO1A 2LBWA 2I6DA 1VQKF 5GANK 3V7QA 3GYQA 3CG6A 1VQ8F 3OW2F 4TZZA 1W42A 1H7MA 1S72F 2QI2A 1Q86H 3CD6F 3CCVF 2VGNA 1K9MH 3VMFB 1T0KB 1KQSF 3ON1A 3CCQF 3CMEF 1Q81H 1KC8H 1VQ7F 2CZWA 1W2BF 1JJ2F 1E7KA 1QVFF 1VQLF 1Q82H 3J81M 5G4UC 4X3LA 5A2QM 2LBXA 3VI6A 3CCJF 2FC3A 4BW0B 2QA4F 3OBWA 3HAXD 1VQ6F 2BO1A 5IT9M 2KTUA 3CC7F 3LWRC 3LWPC 1YJNF 3AGKA 3OBYA 1DT9A 1SDSA 3SIUA 1N8RH 5FLXM 1GZ0A 2OTLF 4LCKA 3CMAF 1X52A 5GIOC 3CCEF 1M1KH 3JCMM 3RA5A 3LWOC 1W40A 1XBIA 3N4YA 3J7AR 3JAMM 2KTVA 2KG4A 1VQMF
chains in the Genus database with same CATH superfamily
3TD4A 5CA0B 2JNBA 3U0OA 3CC4F 2UZHA 5LOVB 2BTUA 3S0WA 2B33A 5EB1B 3TD3A 3HWUA 5EIBD 3CCUF 4O2BA 3RYHB 1K8AH 5IYZA 3NK7A 3N2KB 3N4ZA 3ZO8A 3DC2A 4ZHQB 3VYSC 5HY2A 3JARA 5HP8A 4X20B 3WGLA 2BTQB 3C9TA 3S0HA 3RYIA 2HVYD 1Q7YH 4PWTA 2ALEA 4X1KA 1X7OA 3E20B 1NJIH 2HS4A 1W57A 2KGWA 1RQ7A 3LDTA 3NVIB 3G4SF 1UI9A 3V4DA 4F6RB 3VYTC 3M1XA 3I56F 2UYNA 3HKBB 2RHOA 5HXUA 5JQGB 3P0ZA 1IV4A 4R40B 4HNAA 5IJ9B 2IAFA 3CCMF 3V7EA 1PXWA 3CXCF 2CWJA 1W581 1IPAA 2OTJF 4I55B 4IHJA 4ZHVA 1VHAA 2LBWA 3ZP4A 3V7QA 2Q1YA 3VTIC 3WGMA 3C9UA 4BT3A 4O2BB 2ZVZA 1W42A 1ODEA 4EB6B 1H7MA 1S72F 3HKDB 4U39A 4BT7A 3WJRA 3MCQA 3JATB 1T0KB 4DRXB 5EZYA 3CMEF 3MBMA 1SZQA 2GLZA 4XCQA 1E7KA 3J81M 4B5CA 2LBXA 1H47A 3GTZA 3VIUA 1H48A 4ZI7A 2YYEA 1KNKA 4G4VA 1VH8A 2HQSC 3JAKB 4X1IB 4X1KB 3LWRC 4ERHA 3AGKA 3SIUA 5LXTA 1SA0A 1W5BA 5LP6B 1N8RH 2OTLF 3K14A 2VXYA 4BVTA 2HX0A 3C9RA 3CCEF 4I55A 3K0TA 4C82A 4YJ3B 4O2AA 5C8YB 2FGYA 3WPWA 5J2TA 2RHLA 3FD5A 3J7AR 3VOBA 2PMPA 3MDOA 4U3JB 2GVIA 1TVKB 1QVGF 3UT5A 1TUBA 1M90H 1VQ4F 4IIJA 3T80A 3IKFA 1W55A 4I50A 4ZOLB 3FD6A 1W3EX 2CHTA 4BY9D 5IJ0B 1YGYA 1VQ5F 1W59A 3D00A 3C9SA 3HTNA 5EYPB 2ZOVA 3F0EA 3ZP7A 5JVDB 3VCZA 4DRXA 1U40A 3G6EF 1TUBB 2BTOA 1KD1H 3LYBA 2G9IA 5GONA 3I3FA 1ZWZA 3K2XA 3LMEA 4RQOA 4TUYA 5CB4A 4C8EA 3I55F 3CCLF 5BMVA 4G4XA 5C8YA 3KHNA 4ZHYB 3P4EA 1NMUB 5J2TB 3CYQA 1QU9A 4I4TA 1VQPF 5GINC 3FBAA 1GX1A 5EIBC 2WALA 1YJWF 2V9YA 2OTMA 1NQ3A 4WBNB 3PAFA 4LNUB 4ZOLA 2PHNA 3NMUC 4O2AB 1W41A 1YHQF 1VQ9F 5KMGB 3WJQA 3S0YA 3TD5A 2AMTA 3HKEB 5JCOA 5JVDA 3OW2F 4TZZA 1OAPA 5JQGA 2HP0A 3S03A 4I4TB 1FFXA 3CCVF 2VGNA 1K9MH 3R0PA 1KQSF 4BVSA 3CCQF 1U3LA 1Q81H 1VQ7F 3RYFB 3JVHA 2MQEA 1JJ2F 3V3TA 1VQLF 1Q82H 1VQVA 4G4ZA 5A2QM 3QTYA 5LYJA 1XRGA 1Q8RA 3HKBA 4HNAB 5IJ9A 2HS3A 4BT6A 2RHJA 3D54A 3S02A 1W5EA 3ERNA 4X1YB 4BW0B 3JATA 1ONIA 1JY8A 1R1MA 4O4IB 1FFXB 3WJPA 3KJJA 4YJ2B 3JALB 3Q8HA 1W5FA 3CC7F 1YJNF 2IG8A 2ZF8A 4C8IA 5BMVB 1UFYA 1IV2A 4LCKA 2H8CA 5GIOC 3JCMM 5J2UA 3LWOC 1W40A 1JD1A 1XBIA 3MQWA 5CA0A 4G4WA 3B6NA 2Z1UA 2R6R1 3WXMB 2RB9A 3NVKE 1GO0A 1SA0B 3CPWF 4EI8A 1COMA 1U3PA 4C4WC 1KNJA 3MCAB 5LA6B 2LCAA 3S06A 5JH7A 5HXZA 3JARB 5J2UB 2YXZA 5EB0A 1TVKA 5GIPC 2I6RA 5LOVA 4X20A 3RA6A 3O85A 5LXTB 5FJ4C 4NWOB 4E6EA 4X3MA 1Z5VA 2UYPA 4O4HA 4RHAA 5LP6A 5HP7A 3N2KA 4BVRA 3CCRF 1QD9A 1K73H 2CW4A 3VO8A 2CSLA 3G71F 1CN7A 4X1YA 1Z5WA 4EI7A 4BVQA 5EO3A 1VQNF 2H8EA 3VOAA 5CA1A 3WGKA 3JASA 3KE1A 1JFFA 3BYQA 5IJ0A 4IHJB 3CCSF 5HY1A 2VGMA 1QAHA 4BT4A 4FFBB 5FNVA 2Z01A 3IKEA 2RHHA 3WPXA 3SIVA 2AIFA 1YIJF 3E1YA 1GO1A 3RYCB 2HS0A 2I6DA 4C8GA 1VQKF 3HKDA 3DDNA 3CG6A 1XHOA 3QUWA 2IQQA 3CD6F 4B46A 3D01A 4EB6A 4TUYB 5HY0A 1KC8H 3RE3A 2CZWA 5MN6A 4FFBA 4NQ3A 5FNVB 5HWEA 5EZYB 5MN4A 2GZLA 2HRYA 5G4UC 3F0DA 1CLIA 4O4JB 5AVMA 4O4HB 1X25A 3VI6A 1OFUA 1VK3A 2VAWA 3JAWA 3CCJF 3OONA 2FC3A 4WBNA 3IEQA 3L7QA 4ZI7B 1FNKA 1RLUA 3KIZA 3N2GB 5KX5B 5LP6C 3OBYA 5KMGA 4EI9A 2P6YA 3RYHA 3K12A 2Z1FA 2F9ZC 3RYIB 1M1KH 1T0AA 2HP0B 4BT5A 3IEWA 3QHDA 4DXDA 1IV1A 1JFFB 3JAWB 3IMPA 4ZK7A 3JAMM 2UYJA 4YJ3A 4IIJB 3ESJA 3JALA 1XV2A 2KG4A 1VQMF 1VQOF 3EORA 2VAPA 3GHZA 5IYZB 5JCOC 3CPQA 3HJWC 3J80M 2R751 4F6RA 1YI2F 4G4YA 4O4LB 1U43A 5MN5A 5GAPK 4U3JA 2OHWA 4M8IA 5ITZB 1J7HA 1RA4A 2LBTA 4O4IA 3I7TA 3FFMA 3NK6A 2QTPA 1X7PA 2HP3A 3FPIA 1RQ2A 1DBFA 3M4SA 5GONB 1CK2A 2VAMA 2K1SA 4TV8A 1YJ9F 5G4VC 1YQNA 5CB4B 1RLGA 5DCVA 4B62A 5JH7B 2QEXF 4NUTA 4BT2A 3N2GA 4KWEA 5KX5A 4ZHWA 1JN1A 5ITZA 3IR9A 2DT4A 2W8BC 1FNJA 3LWQC 1YITF 3F0GA 3CC2F 3C8LA 2ZVYA 2AIZP 3HKCB 3E22B 3LFOA 5LA6A 2L26A 4TV9A 3LWVC 3M84A 2DYYA 2Q1XA 4O4LA 2Z1TA 2ZAUA 2NMUA 5EWRA 3VYUC 3CB2A 2OZBA 3PLAC 5GANK 3F0FA 3GYQA 3P10A 5HY4A 4LNUA 3WGNA 1VQ8F 1PF5A 1W5AA 3HKEA 2QI2A 3VMFB 3E22A 3ON1A 2H6LA 3ELCA 3JAKA 4X1IA 3RYCA 1W2BF 5LYJB 1QVFF 3JASB 2ZODA 3UT5B 4X3LA 5CA1B 4TV8B 2EWCA 3RYFA 3KJKA 5EAZA 5EYPA 2QA4F 3OBWA 3HAXD 1VQ6F 2UYKA 2BO1A 3WGJA 5IT9M 1FSZA 2KTUA 4B45A 2CVLA 3LWPC 4ZHQA 1DT9A 1SDSA 2N48A 5FLXM 1GZ0A 4O4JA 3ZOPA 3CMAF 1X52A 4I50B 4C81A 4G88A 1IV3A 4YJ2A 3RA5A 3CYPB 5B8FA 3F6MA 3N4YA 2Z1EA 2HRUA 3HKCA 2KTVA 4TV9B 2UYNB 1Q86H 2CHSA
chains in the Genus database with same CATH topology
1VQOF 1QVGF 3WXMB 2JNBA 1M90H 3HJWC 1VQ4F 3CPQA 3NVKE 1GO0A 3J80M 3CPWF 4EI8A 1YI2F 3CC4F 5GAPK 1W3EX 4BY9D 4C4WC 3MCAB 2OHWA 1VQ5F 1RA4A 3NK6A 3D00A 3FFMA 5HXZA 1X7PA 5GIPC 3CCUF 3RA6A 1CK2A 3O85A 1K8AH 5FJ4C 3NK7A 4X3MA 1YJ9F 5G4VC 3N4ZA 5HY2A 3G6EF 1RLGA 5DCVA 1KD1H 2QEXF 2HVYD 4NUTA 1Q7YH 4BVRA 3CCRF 1K73H 1ZWZA 2ALEA 3IR9A 1X7OA 3G71F 3I55F 3CCLF 3E20B 1CN7A 1NJIH 3LWQC 4EI7A 1YITF 4BVQA 5EO3A 1NMUB 3NVIB 1VQNF 3G4SF 3CC2F 3I56F 1VQPF 5HXUA 5GINC 3LFOA 2WALA 1YJWF 3CCSF 5HY1A 3LWVC 2VGMA 3PAFA 3CCMF 3V7EA 1PXWA 3CXCF 3NMUC 1W41A 5EWRA 2OZBA 3SIVA 1IPAA 1YHQF 2AIFA 1YIJF 1VQ9F 3E1YA 3PLAC 2OTJF 1GO1A 2LBWA 2I6DA 1VQKF 5GANK 3V7QA 3GYQA 5HY4A 3CG6A 1VQ8F 3OW2F 4TZZA 1W42A 1H7MA 1S72F 2QI2A 1Q86H 3CD6F 3CCVF 2VGNA 1K9MH 3VMFB 1T0KB 1KQSF 3ON1A 4BVSA 5HY0A 3CCQF 3CMEF 1Q81H 1KC8H 1VQ7F 2CZWA 4NQ3A 5HWEA 2GLZA 4XCQA 1W2BF 1JJ2F 1E7KA 1QVFF 3V3TA 1VQLF 1Q82H 3J81M 5G4UC 4X3LA 5A2QM 2LBXA 3VI6A 3CCJF 2FC3A 4BW0B 2QA4F 3OBWA 3HAXD 1VQ6F 2BO1A 5IT9M 2KTUA 3CC7F 3LWRC 3LWPC 1YJNF 3AGKA 3OBYA 1DT9A 4EI9A 1SDSA 3SIUA 1N8RH 5FLXM 1GZ0A 2OTLF 4BVTA 4LCKA 3CMAF 1X52A 2F9ZC 5GIOC 3CCEF 1M1KH 3JCMM 3RA5A 3LWOC 1W40A 2FGYA 1XBIA 3N4YA 3J7AR 3JAMM 2KTVA 2KG4A 1VQMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO F;  1QVG F;  3WXM B;  2JNB A;  1M90 H;  3HJW C;  1VQ4 F;  3CPQ A;  3NVK E;  1GO0 A;  3J80 M;  3CPW F;  1YI2 F;  3CC4 F;  5GAP K;  1W3E X;  4BY9 D;  4C4W C;  3MCA B;  2OHW A;  1VQ5 F;  1RA4 A;  3NK6 A;  3FFM A;  1X7P A;  5GIP C;  3CCU F;  1CK2 A;  3O85 A;  3RA6 A;  1K8A H;  5FJ4 C;  3NK7 A;  4X3M A;  1YJ9 F;  5G4V C;  3N4Z A;  3G6E F;  1RLG A;  5DCV A;  1KD1 H;  2QEX F;  2HVY D;  4NUT A;  1Q7Y H;  3CCR F;  1K73 H;  1ZWZ A;  2ALE A;  3IR9 A;  1X7O A;  3G71 F;  3I55 F;  3CCL F;  3E20 B;  1CN7 A;  1NJI H;  3LWQ C;  1YIT F;  5EO3 A;  1NMU B;  3NVI B;  1VQN F;  3G4S F;  3CC2 F;  3I56 F;  1VQP F;  5GIN C;  3LFO A;  2WAL A;  1YJW F;  3CCS F;  3LWV C;  2VGM A;  3PAF A;  3CCM F;  3V7E A;  1PXW A;  3CXC F;  3NMU C;  1W41 A;  5EWR A;  2OZB A;  3SIV A;  1IPA A;  1YHQ F;  2AIF A;  1YIJ F;  1VQ9 F;  3E1Y A;  3PLA C;  2OTJ F;  1GO1 A;  2LBW A;  2I6D A;  1VQK F;  5GAN K;  3V7Q A;  3GYQ A;  3CG6 A;  1VQ8 F;  3OW2 F;  4TZZ A;  1W42 A;  1H7M A;  1S72 F;  2QI2 A;  1Q86 H;  3CD6 F;  3CCV F;  2VGN A;  1K9M H;  3VMF B;  1T0K B;  1KQS F;  3ON1 A;  3CCQ F;  3CME F;  1Q81 H;  1KC8 H;  1VQ7 F;  2CZW A;  1W2B F;  1JJ2 F;  1E7K A;  1QVF F;  1VQL F;  1Q82 H;  3J81 M;  5G4U C;  4X3L A;  5A2Q M;  2LBX A;  3VI6 A;  3CCJ F;  2FC3 A;  4BW0 B;  2QA4 F;  3OBW A;  3HAX D;  1VQ6 F;  2BO1 A;  5IT9 M;  2KTU A;  3CC7 F;  3LWR C;  3LWP C;  1YJN F;  3AGK A;  3OBY A;  1DT9 A;  1SDS A;  3SIU A;  1N8R H;  5FLX M;  1GZ0 A;  2OTL F;  4LCK A;  3CMA F;  1X52 A;  5GIO C;  3CCE F;  1M1K H;  3JCM M;  3RA5 A;  3LWO C;  1W40 A;  1XBI A;  3N4Y A;  3J7A R;  3JAM M;  2KTV A;  2KG4 A;  1VQM F; 
#chains in the Genus database with same CATH topology
 3TD4 A;  5CA0 B;  2JNB A;  3U0O A;  3CC4 F;  2UZH A;  5LOV B;  2BTU A;  3S0W A;  2B33 A;  5EB1 B;  3TD3 A;  3HWU A;  5EIB D;  3CCU F;  4O2B A;  3RYH B;  1K8A H;  5IYZ A;  3NK7 A;  3N2K B;  3N4Z A;  3ZO8 A;  3DC2 A;  4ZHQ B;  3VYS C;  5HY2 A;  3JAR A;  5HP8 A;  4X20 B;  3WGL A;  2BTQ B;  3C9T A;  3S0H A;  3RYI A;  2HVY D;  1Q7Y H;  4PWT A;  2ALE A;  4X1K A;  1X7O A;  3E20 B;  1NJI H;  2HS4 A;  1W57 A;  2KGW A;  1RQ7 A;  3LDT A;  3NVI B;  3G4S F;  1UI9 A;  3V4D A;  4F6R B;  3VYT C;  3M1X A;  3I56 F;  2UYN A;  3HKB B;  2RHO A;  5HXU A;  5JQG B;  3P0Z A;  1IV4 A;  4R40 B;  4HNA A;  5IJ9 B;  2IAF A;  3CCM F;  3V7E A;  1PXW A;  3CXC F;  2CWJ A;  1W58 1;  1IPA A;  2OTJ F;  4I55 B;  4IHJ A;  4ZHV A;  1VHA A;  2LBW A;  3ZP4 A;  3V7Q A;  2Q1Y A;  3VTI C;  3WGM A;  3C9U A;  4BT3 A;  4O2B B;  2ZVZ A;  1W42 A;  1ODE A;  4EB6 B;  1H7M A;  1S72 F;  3HKD B;  4U39 A;  4BT7 A;  3WJR A;  3MCQ A;  3JAT B;  1T0K B;  4DRX B;  5EZY A;  3CME F;  3MBM A;  1SZQ A;  2GLZ A;  4XCQ A;  1E7K A;  3J81 M;  4B5C A;  2LBX A;  1H47 A;  3GTZ A;  3VIU A;  1H48 A;  4ZI7 A;  2YYE A;  1KNK A;  4G4V A;  1VH8 A;  2HQS C;  3JAK B;  4X1I B;  4X1K B;  3LWR C;  4ERH A;  3AGK A;  3SIU A;  5LXT A;  1SA0 A;  1W5B A;  5LP6 B;  1N8R H;  2OTL F;  3K14 A;  2VXY A;  4BVT A;  2HX0 A;  3C9R A;  3CCE F;  4I55 A;  3K0T A;  4C82 A;  4YJ3 B;  4O2A A;  5C8Y B;  2FGY A;  3WPW A;  5J2T A;  2RHL A;  3FD5 A;  3J7A R;  3VOB A;  2PMP A;  3MDO A;  4U3J B;  2GVI A;  1TVK B;  1QVG F;  3UT5 A;  1TUB A;  1M90 H;  1VQ4 F;  4IIJ A;  3T80 A;  3IKF A;  1W55 A;  4I50 A;  4ZOL B;  3FD6 A;  1W3E X;  2CHT A;  4BY9 D;  5IJ0 B;  1YGY A;  1VQ5 F;  1W59 A;  3D00 A;  3C9S A;  3HTN A;  5EYP B;  2ZOV A;  3F0E A;  3ZP7 A;  5JVD B;  3VCZ A;  4DRX A;  1U40 A;  3G6E F;  1TUB B;  2BTO A;  1KD1 H;  3LYB A;  2G9I A;  5GON A;  3I3F A;  1ZWZ A;  3K2X A;  3LME A;  4RQO A;  4TUY A;  5CB4 A;  4C8E A;  3I55 F;  3CCL F;  5BMV A;  4G4X A;  5C8Y A;  3KHN A;  4ZHY B;  3P4E A;  1NMU B;  5J2T B;  3CYQ A;  1QU9 A;  4I4T A;  1VQP F;  5GIN C;  3FBA A;  1GX1 A;  5EIB C;  2WAL A;  1YJW F;  2V9Y A;  2OTM A;  1NQ3 A;  4WBN B;  3PAF A;  4LNU B;  4ZOL A;  2PHN A;  3NMU C;  4O2A B;  1W41 A;  1YHQ F;  1VQ9 F;  5KMG B;  3WJQ A;  3S0Y A;  3TD5 A;  2AMT A;  3HKE B;  5JCO A;  5JVD A;  3OW2 F;  4TZZ A;  1OAP A;  5JQG A;  2HP0 A;  3S03 A;  4I4T B;  1FFX A;  3CCV F;  2VGN A;  1K9M H;  3R0P A;  1KQS F;  4BVS A;  3CCQ F;  1U3L A;  1Q81 H;  1VQ7 F;  3RYF B;  3JVH A;  2MQE A;  1JJ2 F;  3V3T A;  1VQL F;  1Q82 H;  1VQV A;  4G4Z A;  5A2Q M;  3QTY A;  5LYJ A;  1XRG A;  1Q8R A;  3HKB A;  4HNA B;  5IJ9 A;  2HS3 A;  4BT6 A;  2RHJ A;  3D54 A;  3S02 A;  1W5E A;  3ERN A;  4X1Y B;  4BW0 B;  3JAT A;  1ONI A;  1JY8 A;  1R1M A;  4O4I B;  1FFX B;  3WJP A;  3KJJ A;  4YJ2 B;  3JAL B;  3Q8H A;  1W5F A;  3CC7 F;  1YJN F;  2IG8 A;  2ZF8 A;  4C8I A;  5BMV B;  1UFY A;  1IV2 A;  4LCK A;  2H8C A;  5GIO C;  3JCM M;  5J2U A;  3LWO C;  1W40 A;  1JD1 A;  1XBI A;  3MQW A;  5CA0 A;  4G4W A;  3B6N A;  2Z1U A;  2R6R 1;  3WXM B;  2RB9 A;  3NVK E;  1GO0 A;  1SA0 B;  3CPW F;  4EI8 A;  1COM A;  1U3P A;  4C4W C;  1KNJ A;  3MCA B;  5LA6 B;  2LCA A;  3S06 A;  5JH7 A;  5HXZ A;  3JAR B;  5J2U B;  2YXZ A;  5EB0 A;  1TVK A;  5GIP C;  2I6R A;  5LOV A;  4X20 A;  3RA6 A;  3O85 A;  5LXT B;  5FJ4 C;  4NWO B;  4E6E A;  4X3M A;  1Z5V A;  2UYP A;  4O4H A;  4RHA A;  5LP6 A;  5HP7 A;  3N2K A;  4BVR A;  3CCR F;  1QD9 A;  1K73 H;  2CW4 A;  3VO8 A;  2CSL A;  3G71 F;  1CN7 A;  4X1Y A;  1Z5W A;  4EI7 A;  4BVQ A;  5EO3 A;  1VQN F;  2H8E A;  3VOA A;  5CA1 A;  3WGK A;  3JAS A;  3KE1 A;  1JFF A;  3BYQ A;  5IJ0 A;  4IHJ B;  3CCS F;  5HY1 A;  2VGM A;  1QAH A;  4BT4 A;  4FFB B;  5FNV A;  2Z01 A;  3IKE A;  2RHH A;  3WPX A;  3SIV A;  2AIF A;  1YIJ F;  3E1Y A;  1GO1 A;  3RYC B;  2HS0 A;  2I6D A;  4C8G A;  1VQK F;  3HKD A;  3DDN A;  3CG6 A;  1XHO A;  3QUW A;  2IQQ A;  3CD6 F;  4B46 A;  3D01 A;  4EB6 A;  4TUY B;  5HY0 A;  1KC8 H;  3RE3 A;  2CZW A;  5MN6 A;  4FFB A;  4NQ3 A;  5FNV B;  5HWE A;  5EZY B;  5MN4 A;  2GZL A;  2HRY A;  5G4U C;  3F0D A;  1CLI A;  4O4J B;  5AVM A;  4O4H B;  1X25 A;  3VI6 A;  1OFU A;  1VK3 A;  2VAW A;  3JAW A;  3CCJ F;  3OON A;  2FC3 A;  4WBN A;  3IEQ A;  3L7Q A;  4ZI7 B;  1FNK A;  1RLU A;  3KIZ A;  3N2G B;  5KX5 B;  5LP6 C;  3OBY A;  5KMG A;  4EI9 A;  2P6Y A;  3RYH A;  3K12 A;  2Z1F A;  2F9Z C;  3RYI B;  1M1K H;  1T0A A;  2HP0 B;  4BT5 A;  3IEW A;  3QHD A;  4DXD A;  1IV1 A;  1JFF B;  3JAW B;  3IMP A;  4ZK7 A;  3JAM M;  2UYJ A;  4YJ3 A;  4IIJ B;  3ESJ A;  3JAL A;  1XV2 A;  2KG4 A;  1VQM F;  1VQO F;  3EOR A;  2VAP A;  3GHZ A;  5IYZ B;  5JCO C;  3CPQ A;  3HJW C;  3J80 M;  2R75 1;  4F6R A;  1YI2 F;  4G4Y A;  4O4L B;  1U43 A;  5MN5 A;  5GAP K;  4U3J A;  2OHW A;  4M8I A;  5ITZ B;  1J7H A;  1RA4 A;  2LBT A;  4O4I A;  3I7T A;  3FFM A;  3NK6 A;  2QTP A;  1X7P A;  2HP3 A;  3FPI A;  1RQ2 A;  1DBF A;  3M4S A;  5GON B;  1CK2 A;  2VAM A;  2K1S A;  4TV8 A;  1YJ9 F;  5G4V C;  1YQN A;  5CB4 B;  1RLG A;  5DCV A;  4B62 A;  5JH7 B;  2QEX F;  4NUT A;  4BT2 A;  3N2G A;  4KWE A;  5KX5 A;  4ZHW A;  1JN1 A;  5ITZ A;  3IR9 A;  2DT4 A;  2W8B C;  1FNJ A;  3LWQ C;  1YIT F;  3F0G A;  3CC2 F;  3C8L A;  2ZVY A;  2AIZ P;  3HKC B;  3E22 B;  3LFO A;  5LA6 A;  2L26 A;  4TV9 A;  3LWV C;  3M84 A;  2DYY A;  2Q1X A;  4O4L A;  2Z1T A;  2ZAU A;  2NMU A;  5EWR A;  3VYU C;  3CB2 A;  2OZB A;  3PLA C;  5GAN K;  3F0F A;  3GYQ A;  3P10 A;  5HY4 A;  4LNU A;  3WGN A;  1VQ8 F;  1PF5 A;  1W5A A;  3HKE A;  2QI2 A;  3VMF B;  3E22 A;  3ON1 A;  2H6L A;  3ELC A;  3JAK A;  4X1I A;  3RYC A;  1W2B F;  5LYJ B;  1QVF F;  3JAS B;  2ZOD A;  3UT5 B;  4X3L A;  5CA1 B;  4TV8 B;  2EWC A;  3RYF A;  3KJK A;  5EAZ A;  5EYP A;  2QA4 F;  3OBW A;  3HAX D;  1VQ6 F;  2UYK A;  2BO1 A;  3WGJ A;  5IT9 M;  1FSZ A;  2KTU A;  4B45 A;  2CVL A;  3LWP C;  4ZHQ A;  1DT9 A;  1SDS A;  2N48 A;  5FLX M;  1GZ0 A;  4O4J A;  3ZOP A;  3CMA F;  1X52 A;  4I50 B;  4C81 A;  4G88 A;  1IV3 A;  4YJ2 A;  3RA5 A;  3CYP B;  5B8F A;  3F6M A;  3N4Y A;  2Z1E A;  2HRU A;  3HKC A;  2KTV A;  4TV9 B;  2UYN B;  1Q86 H;  2CHS A; 
#chains in the Genus database with same CATH homology
 1VQO F;  1QVG F;  3WXM B;  2JNB A;  1M90 H;  3HJW C;  1VQ4 F;  3CPQ A;  3NVK E;  1GO0 A;  3J80 M;  3CPW F;  4EI8 A;  1YI2 F;  3CC4 F;  5GAP K;  1W3E X;  4BY9 D;  4C4W C;  3MCA B;  2OHW A;  1VQ5 F;  1RA4 A;  3NK6 A;  3D00 A;  3FFM A;  5HXZ A;  1X7P A;  5GIP C;  3CCU F;  3RA6 A;  1CK2 A;  3O85 A;  1K8A H;  5FJ4 C;  3NK7 A;  4X3M A;  1YJ9 F;  5G4V C;  3N4Z A;  5HY2 A;  3G6E F;  1RLG A;  5DCV A;  1KD1 H;  2QEX F;  2HVY D;  4NUT A;  1Q7Y H;  4BVR A;  3CCR F;  1K73 H;  1ZWZ A;  2ALE A;  3IR9 A;  1X7O A;  3G71 F;  3I55 F;  3CCL F;  3E20 B;  1CN7 A;  1NJI H;  3LWQ C;  4EI7 A;  1YIT F;  4BVQ A;  5EO3 A;  1NMU B;  3NVI B;  1VQN F;  3G4S F;  3CC2 F;  3I56 F;  1VQP F;  5HXU A;  5GIN C;  3LFO A;  2WAL A;  1YJW F;  3CCS F;  5HY1 A;  3LWV C;  2VGM A;  3PAF A;  3CCM F;  3V7E A;  1PXW A;  3CXC F;  3NMU C;  1W41 A;  5EWR A;  2OZB A;  3SIV A;  1IPA A;  1YHQ F;  2AIF A;  1YIJ F;  1VQ9 F;  3E1Y A;  3PLA C;  2OTJ F;  1GO1 A;  2LBW A;  2I6D A;  1VQK F;  5GAN K;  3V7Q A;  3GYQ A;  5HY4 A;  3CG6 A;  1VQ8 F;  3OW2 F;  4TZZ A;  1W42 A;  1H7M A;  1S72 F;  2QI2 A;  1Q86 H;  3CD6 F;  3CCV F;  2VGN A;  1K9M H;  3VMF B;  1T0K B;  1KQS F;  3ON1 A;  4BVS A;  5HY0 A;  3CCQ F;  3CME F;  1Q81 H;  1KC8 H;  1VQ7 F;  2CZW A;  4NQ3 A;  5HWE A;  2GLZ A;  4XCQ A;  1W2B F;  1JJ2 F;  1E7K A;  1QVF F;  3V3T A;  1VQL F;  1Q82 H;  3J81 M;  5G4U C;  4X3L A;  5A2Q M;  2LBX A;  3VI6 A;  3CCJ F;  2FC3 A;  4BW0 B;  2QA4 F;  3OBW A;  3HAX D;  1VQ6 F;  2BO1 A;  5IT9 M;  2KTU A;  3CC7 F;  3LWR C;  3LWP C;  1YJN F;  3AGK A;  3OBY A;  1DT9 A;  4EI9 A;  1SDS A;  3SIU A;  1N8R H;  5FLX M;  1GZ0 A;  2OTL F;  4BVT A;  4LCK A;  3CMA F;  1X52 A;  2F9Z C;  5GIO C;  3CCE F;  1M1K H;  3JCM M;  3RA5 A;  3LWO C;  1W40 A;  2FGY A;  1XBI A;  3N4Y A;  3J7A R;  3JAM M;  2KTV A;  2KG4 A;  1VQM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...