1VQNF

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqnF00
1K8AH 5A2QM 2LBXA 3PLAC 3JAMM 3LWOC 2OTLF 1VQ4F 1Q81H 3E1YA 4C4WC 3V7QA 1W40A 1VQNF 3LFOA 1YJ9F 1IPAA 3I55F 1SDSA 3NVKE 1W3EX 1XBIA 2OHWA 3NMUC 1YJWF 3G6EF 1YIJF 1M1KH 3LWVC 2WALA 3CCQF 1CN7A 1H7MA 5G4VC 4NUTA 2QI2A 3N4ZA 1DT9A 1NMUB 2QEXF 3E20B 3O85A 1CK2A 1VQ9F 1QVFF 3HJWC 1Q86H 1VQOF 3CCMF 1KQSF 2I6DA 5EWRA 1T0KB 1X7PA 1M90H 4X3MA 3N4YA 3NVIB 3OBYA 1VQ5F 2AIFA 2KTVA 1W2BF 3CMAF 1JJ2F 3MCAB 1VQ7F 3ON1A 3CC2F 3IR9A 1VQLF 5FJ4C 1K9MH 3J81M 4BY9D 3CPQA 2OZBA 2JNBA 2CZWA 1VQKF 1YI2F 2VGMA 5FLXM 1YITF 3V7EA 3VMFB 3SIVA 2ALEA 1VQ6F 5GAPK 1KC8H 1VQ8F 3G71F 3FFMA 2HVYD 3J80M 3PAFA 1K73H 3HAXD 5G4UC 1KD1H 2OTJF 4BW0B 2KTUA 1GO1A 1W42A 3CG6A 3CMEF 2KG4A 1Q82H 3CCJF 5GIOC 3LWRC 1ZWZA 1GO0A 5IT9M 1RLGA 3CC7F 3LWPC 3CCVF 3LWQC 3CCSF 3AGKA 1PXWA 3GYQA 5GIPC 3OW2F 1GZ0A 5GINC 3CPWF 3CC4F 3CCEF 1W41A 3CCLF 3SIUA 5GANK 1YHQF 1S72F 1RA4A 3I56F 5EO3A 3JCMM 3J7AR 1VQPF 1N8RH 4LCKA 2FC3A 3NK7A 1YJNF 3OBWA 2QA4F 2VGNA 1Q7YH 3WXMB 1QVGF 2BO1A 5DCVA 3CCUF 4TZZA 3VI6A 1NJIH 1E7KA 3CXCF 1X7OA 2LBWA 3G4SF 3RA6A 3CCRF 1VQMF 3RA5A 3CD6F 3NK6A 4X3LA 1X52A
chains in the Genus database with same CATH superfamily
1Q8RA 2CHTA 3S0HA 3PLAC 4IIJA 2RB9A 3HKEB 2IG8A 3N2GB 1VQ4F 3E1YA 4O4JA 4U3JA 1YJ9F 1IPAA 4G4VA 3NVKE 3C9TA 2GVIA 5MN4A 3G6EF 2UZHA 5HWEA 2UYPA 4B45A 3RE3A 4R40B 2HP0A 1VQ9F 3RYFB 5HP7A 1QVFF 2QTPA 2PHNA 3HKCB 5CB4A 2I6DA 1U3PA 5EAZA 4B5CA 4O4JB 1VQ5F 2H6LA 4F6RA 3F0FA 3MBMA 1VQ7F 5EZYB 3ON1A 2HP0B 3K0TA 1GX1A 3J81M 3FPIA 3S03A 4B62A 4BY9D 2HRYA 3TD3A 2CZWA 5CB4B 4RHAA 1YI2F 5LYJA 5FLXM 3SIVA 2ALEA 4G4ZA 1KC8H 2RHOA 4F6RB 4ZHQB 2HVYD 3J80M 3PAFA 5KX5A 1VK3A 3HAXD 3R0PA 3JATA 4BW0B 5BMVA 2AIZP 2Z1FA 5IJ9B 4EI9A 3BYQA 3ZOPA 2UYNA 1SA0B 1FNJA 1GO0A 4RQOA 3MDOA 1YQNA 1QD9A 3FD5A 5HP8A 3GYQA 3CC4F 3KJJA 3SIUA 5ITZB 5GANK 1YHQF 3CB2A 5JQGB 2Q1XA 5BMVB 3KHNA 1VH8A 1JN1A 4O2BB 2I6RA 5CA0A 5J2TA 1JFFA 3EORA 4LCKA 1YJNF 2H8CA 1VQVA 3OBWA 2YXZA 4WBNB 3F6MA 2GZLA 2BTQB 5JVDA 4DRXB 3OONA 3JALA 1QVGF 2BO1A 1IV4A 3VIUA 5DCVA 5MN5A 3IMPA 5C8YA 5CA0B 5HY0A 5J2TB 1JY8A 3WGMA 4EB6A 3NK6A 1RQ7A 4U39A 5A2QM 5HY4A 2L26A 4I4TA 1KNKA 3JAMM 1UFYA 1UI9A 5EYPB 2OTLF 3WGJA 1Q81H 3DC2A 5JVDB 3V7QA 3JALB 3I55F 1W3EX 3UT5A 4BT2A 1XBIA 4ERHA 3NMUC 4ZHYB 2MQEA 1YJWF 2OTMA 4X1IA 3B6NA 1YIJF 3N2KB 3Q8HA 1M1KH 1QU9A 3LWVC 2HS4A 3HJWC 1CK2A 1RQ2A 4I4TB 1RLUA 2G9IA 4TV9A 1VQOF 3S06A 1FFXB 4I50B 1TUBB 3VYSC 5JH7A 1X7PA 4ZI7B 3DDNA 3NVIB 3OBYA 3HKDA 1H47A 3M1XA 1W2BF 1T0AA 2ZAUA 4X1IB 4X1YB 3ZP4A 1JJ2F 3MCAB 2K1SA 3LMEA 3CC2F 3IR9A 1PF5A 4DXDA 2ZODA 1NQ3A 3KIZA 2JNBA 1VQKF 1QAHA 5KMGA 2VGMA 3RYIA 3V7EA 3ESJA 3HKDB 1W5BA 1ONIA 4IIJB 1X25A 3RYHA 3F0GA 4I55A 1H48A 3G71F 4U3JB 2BTUA 4B46A 3FBAA 1KD1H 3P10A 2HS3A 2CHSA 1W42A 4O2AA 3CCJF 3VYUC 3LWRC 4TV8A 3S0YA 2Z1TA 3LWPC 2NMUA 5EB1B 3CCVF 3LWQC 4YJ2A 3RYHB 1FNKA 3AGKA 1IV3A 4I55B 5GIPC 5AVMA 2IQQA 4O4IA 3C9RA 5J2UA 4BT3A 3RYCA 2Z1EA 4BVSA 2V9YA 3S02A 2FC3A 4G4WA 3LYBA 2QA4F 2VGNA 1YGYA 3L7QA 2Z01A 5IYZA 2KGWA 1Q7YH 3HKBA 5LYJB 1OAPA 3E22A 1KNJA 3CCUF 5GONA 3RYCB 3VYTC 3GTZA 1E7KA 3K12A 5MN6A 5KX5B 3G4SF 3KJKA 5EIBC 3CD6F 5HXUA 4X3LA 2R751 3JATB 3WGKA 3KE1A 4IHJA 2LBXA 1W5AA 3LWOC 3JAKA 2UYNB 1W40A 1SDSA 4HNAA 3QUWA 4C81A 2RHHA 5GONB 1J7HA 1ODEA 4X1KA 3FD6A 3CCQF 3CYQA 5G4VC 2QEXF 2CWJA 2QI2A 1NMUB 3E20B 3O85A 5LP6C 4IHJB 1Q86H 5B8FA 3WJQA 2HS0A 1KQSF 1JFFB 5LXTA 3U0OA 2DT4A 4X3MA 1M90H 4E6EA 1XHOA 4HNAB 2KTVA 5EIBD 3CMAF 4X1KB 3V3TA 2GLZA 5FNVA 5IJ0A 2N48A 1VQLF 5FJ4C 4G4XA 1W581 3QTYA 3P0ZA 3ZO8A 1K9MH 2ZOVA 3JASA 5C8YB 3CPQA 4YJ3A 3WJRA 4PWTA 4EB6B 3IKFA 3LDTA 5LA6A 4C8GA 1YITF 3VMFB 2EWCA 5HY1A 1VQ8F 1U3LA 1XV2A 3FFMA 3IEWA 5JCOC 5FNVB 4XCQA 3UT5B 3GHZA 2HQSC 2OTJF 3JASB 2KTUA 1U40A 2ZF8A 1GO1A 4O4LA 1XRGA 3CG6A 3CMEF 2KG4A 4ZHVA 3HKEA 4LNUA 3WJPA 3HWUA 1ZWZA 5LA6B 5IT9M 4TV9B 4BT5A 3CCSF 3VOBA 3V4DA 5JH7B 3IKEA 5GINC 3VOAA 3CCEF 1W41A 3MQWA 3ERNA 4M8IA 4O4HA 3RYFA 2Q1YA 1RA4A 4O4LB 2R6R1 3J7AR 2RHLA 3D00A 3HKCA 3K2XA 4LNUB 2CW4A 4BVQA 1FSZA 5LOVA 2PMPA 3M4SA 3I7TA 3NK7A 3ZP7A 4EI7A 2P6YA 4EI8A 3P4EA 2HP3A 3WXMB 5KMGB 4ZK7A 3RYIB 5EZYA 4O4HB 3WPXA 2UYJA 4C8IA 4C8EA 3VTIC 1TVKA 3C8LA 4BT7A 3CXCF 3D54A 5EB0A 3RA6A 1VQMF 5LOVB 1W5EA 2CSLA 3JAWA 1K8AH 1R1MA 4BVTA 4O2AB 4ZHQA 4TV8B 4C4WC 1VQNF 3LFOA 2Z1UA 2OHWA 1W5FA 2IAFA 3F0EA 4YJ2B 1TVKB 1OFUA 2VAPA 5IJ9A 4O4IB 1COMA 2WALA 1CN7A 1H7MA 3N4ZA 1DT9A 3JAWB 5J2UB 1SA0A 2W8BC 3TD4A 3IEQA 3I3FA 3CCMF 2BTOA 4BVRA 5LP6A 3WGLA 5EWRA 1T0KB 1W57A 3N4YA 5ITZA 2LBTA 2HX0A 3VO8A 5JQGA 2AIFA 5IYZB 3HKBB 4O2BA 2LCAA 3D01A 3C9SA 3E22B 3ELCA 3JARA 2H8EA 4NWOB 4FFBA 4WBNA 2OZBA 4BT4A 2VAMA 3WGNA 1IV1A 1W59A 1CLIA 4ZOLA 5LP6B 4X20A 4DRXA 5HY2A 5CA1A 1VQ6F 5GAPK 1SZQA 3C9UA 1JD1A 4TUYA 3S0WA 4BT6A 2UYKA 3JAKB 2ZVZA 1U43A 4NQ3A 2AMTA 3JARB 1K73H 4FFBB 5G4UC 1IV2A 1Z5VA 3JVHA 4G88A 5JCOA 5EYPA 3VCZA 4ZOLB 1Q82H 5GIOC 4X20B 5CA1B 2B33A 1VHAA 3MCQA 1RLGA 3CC7F 4TUYB 3RA5A 1PXWA 5LXTB 2ZVYA 3QHDA 1GZ0A 3OW2F 2RHJA 3CYPB 3N2KA 3CPWF 3WPWA 3CCLF 4C82A 2F9ZC 3HTNA 1S72F 3I56F 5EO3A 3JCMM 2DYYA 1VQPF 5HXZA 1FFXA 3T80A 1W55A 1TUBA 4I50A 5IJ0B 1N8RH 1Z5WA 2YYEA 4ZI7A 3K14A 4YJ3B 3TD5A 3M84A 2VXYA 4X1YA 4G4YA 3N2GA 2CVLA 2VAWA 1DBFA 4ZHWA 4TZZA 3F0DA 3VI6A 2FGYA 1NJIH 4KWEA 1X7OA 2LBWA 3CCRF 4NUTA 2HRUA 1X52A
chains in the Genus database with same CATH topology
1K8AH 5A2QM 5HY4A 2LBXA 3PLAC 3JAMM 4BVTA 3LWOC 2OTLF 1VQ4F 1Q81H 3E1YA 4C4WC 3V7QA 1W40A 1VQNF 3LFOA 1YJ9F 1IPAA 3I55F 1SDSA 3NVKE 1W3EX 1XBIA 2OHWA 3NMUC 1YJWF 3G6EF 1YIJF 1M1KH 5HWEA 3LWVC 2WALA 3CCQF 1CN7A 1H7MA 4NUTA 5G4VC 2QI2A 3N4ZA 1DT9A 1NMUB 2QEXF 3E20B 3O85A 1CK2A 1VQ9F 1QVFF 3HJWC 1Q86H 1VQOF 3CCMF 4BVRA 1KQSF 2I6DA 5EWRA 1T0KB 1X7PA 1M90H 4X3MA 3N4YA 3NVIB 3OBYA 1VQ5F 2AIFA 2KTVA 1W2BF 3CMAF 1JJ2F 3MCAB 3V3TA 1VQ7F 2GLZA 3ON1A 3CC2F 3IR9A 1VQLF 5FJ4C 1K9MH 3J81M 4BY9D 3CPQA 2OZBA 2JNBA 2CZWA 1VQKF 1YI2F 2VGMA 5FLXM 5HY2A 1YITF 3VMFB 3V7EA 3SIVA 5HY1A 2ALEA 1VQ6F 5GAPK 1KC8H 1VQ8F 3G71F 3FFMA 2HVYD 4NQ3A 3J80M 3PAFA 1K73H 4XCQA 3HAXD 5G4UC 1KD1H 2OTJF 4BW0B 2KTUA 1GO1A 1W42A 3CG6A 3CMEF 2KG4A 1Q82H 4EI9A 3CCJF 5GIOC 3LWRC 1ZWZA 1GO0A 5IT9M 1RLGA 3CC7F 3LWPC 3CCVF 3LWQC 3CCSF 3AGKA 1PXWA 3GYQA 5GIPC 3OW2F 1GZ0A 5GINC 3CPWF 3CC4F 3CCEF 1W41A 3CCLF 3SIUA 2F9ZC 5GANK 1YHQF 1S72F 1RA4A 3I56F 5EO3A 3JCMM 3J7AR 4BVSA 3D00A 5HXZA 1VQPF 4BVQA 1N8RH 4LCKA 2FC3A 3NK7A 1YJNF 4EI7A 3OBWA 2QA4F 2VGNA 1Q7YH 4EI8A 3WXMB 1QVGF 2BO1A 5DCVA 3CCUF 4TZZA 5HY0A 3VI6A 2FGYA 1NJIH 1E7KA 3CXCF 1X7OA 2LBWA 3G4SF 3RA6A 3CCRF 5HXUA 3RA5A 1VQMF 3NK6A 4X3LA 3CD6F 1X52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  5A2Q M;  2LBX A;  3PLA C;  3JAM M;  3LWO C;  2OTL F;  1VQ4 F;  1Q81 H;  3E1Y A;  4C4W C;  3V7Q A;  1W40 A;  1VQN F;  3LFO A;  1YJ9 F;  1IPA A;  3I55 F;  1SDS A;  3NVK E;  1W3E X;  1XBI A;  2OHW A;  3NMU C;  1YJW F;  3G6E F;  1YIJ F;  1M1K H;  3LWV C;  2WAL A;  3CCQ F;  1CN7 A;  1H7M A;  5G4V C;  4NUT A;  2QI2 A;  3N4Z A;  1DT9 A;  1NMU B;  2QEX F;  3E20 B;  3O85 A;  1CK2 A;  1VQ9 F;  1QVF F;  3HJW C;  1Q86 H;  1VQO F;  3CCM F;  1KQS F;  2I6D A;  5EWR A;  1T0K B;  1X7P A;  1M90 H;  4X3M A;  3N4Y A;  3NVI B;  3OBY A;  1VQ5 F;  2AIF A;  2KTV A;  1W2B F;  3CMA F;  1JJ2 F;  3MCA B;  1VQ7 F;  3ON1 A;  3CC2 F;  3IR9 A;  1VQL F;  5FJ4 C;  1K9M H;  3J81 M;  4BY9 D;  3CPQ A;  2OZB A;  2JNB A;  2CZW A;  1VQK F;  1YI2 F;  2VGM A;  5FLX M;  1YIT F;  3V7E A;  3VMF B;  3SIV A;  2ALE A;  1VQ6 F;  5GAP K;  1KC8 H;  1VQ8 F;  3G71 F;  3FFM A;  2HVY D;  3J80 M;  3PAF A;  1K73 H;  3HAX D;  5G4U C;  1KD1 H;  2OTJ F;  4BW0 B;  2KTU A;  1GO1 A;  1W42 A;  3CG6 A;  3CME F;  2KG4 A;  1Q82 H;  3CCJ F;  5GIO C;  3LWR C;  1ZWZ A;  1GO0 A;  5IT9 M;  1RLG A;  3CC7 F;  3LWP C;  3CCV F;  3LWQ C;  3CCS F;  3AGK A;  1PXW A;  3GYQ A;  5GIP C;  3OW2 F;  1GZ0 A;  5GIN C;  3CPW F;  3CC4 F;  3CCE F;  1W41 A;  3CCL F;  3SIU A;  5GAN K;  1YHQ F;  1S72 F;  1RA4 A;  3I56 F;  5EO3 A;  3JCM M;  3J7A R;  1VQP F;  1N8R H;  4LCK A;  2FC3 A;  3NK7 A;  1YJN F;  3OBW A;  2QA4 F;  2VGN A;  1Q7Y H;  3WXM B;  1QVG F;  2BO1 A;  5DCV A;  3CCU F;  4TZZ A;  3VI6 A;  1NJI H;  1E7K A;  3CXC F;  1X7O A;  2LBW A;  3G4S F;  3RA6 A;  3CCR F;  1VQM F;  3RA5 A;  3CD6 F;  3NK6 A;  4X3L A;  1X52 A; 
#chains in the Genus database with same CATH topology
 1Q8R A;  2CHT A;  3S0H A;  3PLA C;  4IIJ A;  2RB9 A;  3HKE B;  2IG8 A;  3N2G B;  1VQ4 F;  3E1Y A;  4O4J A;  4U3J A;  1YJ9 F;  1IPA A;  4G4V A;  3NVK E;  3C9T A;  2GVI A;  5MN4 A;  3G6E F;  2UZH A;  5HWE A;  2UYP A;  4B45 A;  3RE3 A;  4R40 B;  2HP0 A;  1VQ9 F;  3RYF B;  5HP7 A;  1QVF F;  2QTP A;  2PHN A;  3HKC B;  5CB4 A;  2I6D A;  1U3P A;  5EAZ A;  4B5C A;  4O4J B;  1VQ5 F;  2H6L A;  4F6R A;  3F0F A;  3MBM A;  1VQ7 F;  5EZY B;  3ON1 A;  2HP0 B;  3K0T A;  1GX1 A;  3J81 M;  3FPI A;  3S03 A;  4B62 A;  4BY9 D;  2HRY A;  3TD3 A;  2CZW A;  5CB4 B;  4RHA A;  1YI2 F;  5LYJ A;  5FLX M;  3SIV A;  2ALE A;  4G4Z A;  1KC8 H;  2RHO A;  4F6R B;  4ZHQ B;  2HVY D;  3J80 M;  3PAF A;  5KX5 A;  1VK3 A;  3HAX D;  3R0P A;  3JAT A;  4BW0 B;  5BMV A;  2AIZ P;  2Z1F A;  5IJ9 B;  4EI9 A;  3BYQ A;  3ZOP A;  2UYN A;  1SA0 B;  1FNJ A;  1GO0 A;  4RQO A;  3MDO A;  1YQN A;  1QD9 A;  3FD5 A;  5HP8 A;  3GYQ A;  3CC4 F;  3KJJ A;  3SIU A;  5ITZ B;  5GAN K;  1YHQ F;  3CB2 A;  5JQG B;  2Q1X A;  5BMV B;  3KHN A;  1VH8 A;  1JN1 A;  4O2B B;  2I6R A;  5CA0 A;  5J2T A;  1JFF A;  3EOR A;  4LCK A;  1YJN F;  2H8C A;  1VQV A;  3OBW A;  2YXZ A;  4WBN B;  3F6M A;  2GZL A;  2BTQ B;  5JVD A;  4DRX B;  3OON A;  3JAL A;  1QVG F;  2BO1 A;  1IV4 A;  3VIU A;  5DCV A;  5MN5 A;  3IMP A;  5C8Y A;  5CA0 B;  5HY0 A;  5J2T B;  1JY8 A;  3WGM A;  4EB6 A;  3NK6 A;  1RQ7 A;  4U39 A;  5A2Q M;  5HY4 A;  2L26 A;  4I4T A;  1KNK A;  3JAM M;  1UFY A;  1UI9 A;  5EYP B;  2OTL F;  3WGJ A;  1Q81 H;  3DC2 A;  5JVD B;  3V7Q A;  3JAL B;  3I55 F;  1W3E X;  3UT5 A;  4BT2 A;  1XBI A;  4ERH A;  3NMU C;  4ZHY B;  2MQE A;  1YJW F;  2OTM A;  4X1I A;  3B6N A;  1YIJ F;  3N2K B;  3Q8H A;  1M1K H;  1QU9 A;  3LWV C;  2HS4 A;  3HJW C;  1CK2 A;  1RQ2 A;  4I4T B;  1RLU A;  2G9I A;  4TV9 A;  1VQO F;  3S06 A;  1FFX B;  4I50 B;  1TUB B;  3VYS C;  5JH7 A;  1X7P A;  4ZI7 B;  3DDN A;  3NVI B;  3OBY A;  3HKD A;  1H47 A;  3M1X A;  1W2B F;  1T0A A;  2ZAU A;  4X1I B;  4X1Y B;  3ZP4 A;  1JJ2 F;  3MCA B;  2K1S A;  3LME A;  3CC2 F;  3IR9 A;  1PF5 A;  4DXD A;  2ZOD A;  1NQ3 A;  3KIZ A;  2JNB A;  1VQK F;  1QAH A;  5KMG A;  2VGM A;  3RYI A;  3V7E A;  3ESJ A;  3HKD B;  1W5B A;  1ONI A;  4IIJ B;  1X25 A;  3RYH A;  3F0G A;  4I55 A;  1H48 A;  3G71 F;  4U3J B;  2BTU A;  4B46 A;  3FBA A;  1KD1 H;  3P10 A;  2HS3 A;  2CHS A;  1W42 A;  4O2A A;  3CCJ F;  3VYU C;  3LWR C;  4TV8 A;  3S0Y A;  2Z1T A;  3LWP C;  2NMU A;  5EB1 B;  3CCV F;  3LWQ C;  4YJ2 A;  3RYH B;  1FNK A;  3AGK A;  1IV3 A;  4I55 B;  5GIP C;  5AVM A;  2IQQ A;  4O4I A;  3C9R A;  5J2U A;  4BT3 A;  3RYC A;  2Z1E A;  4BVS A;  2V9Y A;  3S02 A;  2FC3 A;  4G4W A;  3LYB A;  2QA4 F;  2VGN A;  1YGY A;  3L7Q A;  2Z01 A;  5IYZ A;  2KGW A;  1Q7Y H;  3HKB A;  5LYJ B;  1OAP A;  3E22 A;  1KNJ A;  3CCU F;  5GON A;  3RYC B;  3VYT C;  3GTZ A;  1E7K A;  3K12 A;  5MN6 A;  5KX5 B;  3G4S F;  3KJK A;  5EIB C;  3CD6 F;  5HXU A;  4X3L A;  2R75 1;  3JAT B;  3WGK A;  3KE1 A;  4IHJ A;  2LBX A;  1W5A A;  3LWO C;  3JAK A;  2UYN B;  1W40 A;  1SDS A;  4HNA A;  3QUW A;  4C81 A;  2RHH A;  5GON B;  1J7H A;  1ODE A;  4X1K A;  3FD6 A;  3CCQ F;  3CYQ A;  5G4V C;  2QEX F;  2CWJ A;  2QI2 A;  1NMU B;  3E20 B;  3O85 A;  5LP6 C;  4IHJ B;  1Q86 H;  5B8F A;  3WJQ A;  2HS0 A;  1KQS F;  1JFF B;  5LXT A;  3U0O A;  2DT4 A;  4X3M A;  1M90 H;  4E6E A;  1XHO A;  4HNA B;  2KTV A;  5EIB D;  3CMA F;  4X1K B;  3V3T A;  2GLZ A;  5FNV A;  5IJ0 A;  2N48 A;  1VQL F;  5FJ4 C;  4G4X A;  1W58 1;  3QTY A;  3P0Z A;  3ZO8 A;  1K9M H;  2ZOV A;  3JAS A;  5C8Y B;  3CPQ A;  4YJ3 A;  3WJR A;  4PWT A;  4EB6 B;  3IKF A;  3LDT A;  5LA6 A;  4C8G A;  1YIT F;  3VMF B;  2EWC A;  5HY1 A;  1VQ8 F;  1U3L A;  1XV2 A;  3FFM A;  3IEW A;  5JCO C;  5FNV B;  4XCQ A;  3UT5 B;  3GHZ A;  2HQS C;  2OTJ F;  3JAS B;  2KTU A;  1U40 A;  2ZF8 A;  1GO1 A;  4O4L A;  1XRG A;  3CG6 A;  3CME F;  2KG4 A;  4ZHV A;  3HKE A;  4LNU A;  3WJP A;  3HWU A;  1ZWZ A;  5LA6 B;  5IT9 M;  4TV9 B;  4BT5 A;  3CCS F;  3VOB A;  3V4D A;  5JH7 B;  3IKE A;  5GIN C;  3VOA A;  3CCE F;  1W41 A;  3MQW A;  3ERN A;  4M8I A;  4O4H A;  3RYF A;  2Q1Y A;  1RA4 A;  4O4L B;  2R6R 1;  3J7A R;  2RHL A;  3D00 A;  3HKC A;  3K2X A;  4LNU B;  2CW4 A;  4BVQ A;  1FSZ A;  5LOV A;  2PMP A;  3M4S A;  3I7T A;  3NK7 A;  3ZP7 A;  4EI7 A;  2P6Y A;  4EI8 A;  3P4E A;  2HP3 A;  3WXM B;  5KMG B;  4ZK7 A;  3RYI B;  5EZY A;  4O4H B;  3WPX A;  2UYJ A;  4C8I A;  4C8E A;  3VTI C;  1TVK A;  3C8L A;  4BT7 A;  3CXC F;  3D54 A;  5EB0 A;  3RA6 A;  1VQM F;  5LOV B;  1W5E A;  2CSL A;  3JAW A;  1K8A H;  1R1M A;  4BVT A;  4O2A B;  4ZHQ A;  4TV8 B;  4C4W C;  1VQN F;  3LFO A;  2Z1U A;  2OHW A;  1W5F A;  2IAF A;  3F0E A;  4YJ2 B;  1TVK B;  1OFU A;  2VAP A;  5IJ9 A;  4O4I B;  1COM A;  2WAL A;  1CN7 A;  1H7M A;  3N4Z A;  1DT9 A;  3JAW B;  5J2U B;  1SA0 A;  2W8B C;  3TD4 A;  3IEQ A;  3I3F A;  3CCM F;  2BTO A;  4BVR A;  5LP6 A;  3WGL A;  5EWR A;  1T0K B;  1W57 A;  3N4Y A;  5ITZ A;  2LBT A;  2HX0 A;  3VO8 A;  5JQG A;  2AIF A;  5IYZ B;  3HKB B;  4O2B A;  2LCA A;  3D01 A;  3C9S A;  3E22 B;  3ELC A;  3JAR A;  2H8E A;  4NWO B;  4FFB A;  4WBN A;  2OZB A;  4BT4 A;  2VAM A;  3WGN A;  1IV1 A;  1W59 A;  1CLI A;  4ZOL A;  5LP6 B;  4X20 A;  4DRX A;  5HY2 A;  5CA1 A;  1VQ6 F;  5GAP K;  1SZQ A;  3C9U A;  1JD1 A;  4TUY A;  3S0W A;  4BT6 A;  2UYK A;  3JAK B;  2ZVZ A;  1U43 A;  4NQ3 A;  2AMT A;  3JAR B;  1K73 H;  4FFB B;  5G4U C;  1IV2 A;  1Z5V A;  3JVH A;  4G88 A;  5JCO A;  5EYP A;  3VCZ A;  4ZOL B;  1Q82 H;  5GIO C;  4X20 B;  5CA1 B;  2B33 A;  1VHA A;  3MCQ A;  1RLG A;  3CC7 F;  4TUY B;  3RA5 A;  1PXW A;  5LXT B;  2ZVY A;  3QHD A;  1GZ0 A;  3OW2 F;  2RHJ A;  3CYP B;  3N2K A;  3CPW F;  3WPW A;  3CCL F;  4C82 A;  2F9Z C;  3HTN A;  1S72 F;  3I56 F;  5EO3 A;  3JCM M;  2DYY A;  1VQP F;  5HXZ A;  1FFX A;  3T80 A;  1W55 A;  1TUB A;  4I50 A;  5IJ0 B;  1N8R H;  1Z5W A;  2YYE A;  4ZI7 A;  3K14 A;  4YJ3 B;  3TD5 A;  3M84 A;  2VXY A;  4X1Y A;  4G4Y A;  3N2G A;  2CVL A;  2VAW A;  1DBF A;  4ZHW A;  4TZZ A;  3F0D A;  3VI6 A;  2FGY A;  1NJI H;  4KWE A;  1X7O A;  2LBW A;  3CCR F;  4NUT A;  2HRU A;  1X52 A; 
#chains in the Genus database with same CATH homology
 1K8A H;  5A2Q M;  5HY4 A;  2LBX A;  3PLA C;  3JAM M;  4BVT A;  3LWO C;  2OTL F;  1VQ4 F;  1Q81 H;  3E1Y A;  4C4W C;  3V7Q A;  1W40 A;  1VQN F;  3LFO A;  1YJ9 F;  1IPA A;  3I55 F;  1SDS A;  3NVK E;  1W3E X;  1XBI A;  2OHW A;  3NMU C;  1YJW F;  3G6E F;  1YIJ F;  1M1K H;  5HWE A;  3LWV C;  2WAL A;  3CCQ F;  1CN7 A;  1H7M A;  4NUT A;  5G4V C;  2QI2 A;  3N4Z A;  1DT9 A;  1NMU B;  2QEX F;  3E20 B;  3O85 A;  1CK2 A;  1VQ9 F;  1QVF F;  3HJW C;  1Q86 H;  1VQO F;  3CCM F;  4BVR A;  1KQS F;  2I6D A;  5EWR A;  1T0K B;  1X7P A;  1M90 H;  4X3M A;  3N4Y A;  3NVI B;  3OBY A;  1VQ5 F;  2AIF A;  2KTV A;  1W2B F;  3CMA F;  1JJ2 F;  3MCA B;  3V3T A;  1VQ7 F;  2GLZ A;  3ON1 A;  3CC2 F;  3IR9 A;  1VQL F;  5FJ4 C;  1K9M H;  3J81 M;  4BY9 D;  3CPQ A;  2OZB A;  2JNB A;  2CZW A;  1VQK F;  1YI2 F;  2VGM A;  5FLX M;  5HY2 A;  1YIT F;  3VMF B;  3V7E A;  3SIV A;  5HY1 A;  2ALE A;  1VQ6 F;  5GAP K;  1KC8 H;  1VQ8 F;  3G71 F;  3FFM A;  2HVY D;  4NQ3 A;  3J80 M;  3PAF A;  1K73 H;  4XCQ A;  3HAX D;  5G4U C;  1KD1 H;  2OTJ F;  4BW0 B;  2KTU A;  1GO1 A;  1W42 A;  3CG6 A;  3CME F;  2KG4 A;  1Q82 H;  4EI9 A;  3CCJ F;  5GIO C;  3LWR C;  1ZWZ A;  1GO0 A;  5IT9 M;  1RLG A;  3CC7 F;  3LWP C;  3CCV F;  3LWQ C;  3CCS F;  3AGK A;  1PXW A;  3GYQ A;  5GIP C;  3OW2 F;  1GZ0 A;  5GIN C;  3CPW F;  3CC4 F;  3CCE F;  1W41 A;  3CCL F;  3SIU A;  2F9Z C;  5GAN K;  1YHQ F;  1S72 F;  1RA4 A;  3I56 F;  5EO3 A;  3JCM M;  3J7A R;  4BVS A;  3D00 A;  5HXZ A;  1VQP F;  4BVQ A;  1N8R H;  4LCK A;  2FC3 A;  3NK7 A;  1YJN F;  4EI7 A;  3OBW A;  2QA4 F;  2VGN A;  1Q7Y H;  4EI8 A;  3WXM B;  1QVG F;  2BO1 A;  5DCV A;  3CCU F;  4TZZ A;  5HY0 A;  3VI6 A;  2FGY A;  1NJI H;  1E7K A;  3CXC F;  1X7O A;  2LBW A;  3G4S F;  3RA6 A;  3CCR F;  5HXU A;  3RA5 A;  1VQM F;  3NK6 A;  4X3L A;  3CD6 F;  1X52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...