1VQNF

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqnF00
3ON1A 3NK7A 1YJWF 1QVGF 1YJ9F 3NVKE 3CPWF 3V7QA 3CCMF 2KTUA 2WALA 3N4ZA 3OBYA 3G6EF 3IR9A 4LCKA 2VGMA 3CCLF 1S72F 5GINC 1VQ8F 1VQMF 1KC8H 1GZ0A 3AGKA 4TZZA 1KQSF 1K8AH 4BW0B 3JCMM 1YITF 1GO1A 3WXMB 1NJIH 3NK6A 2QA4F 1DT9A 2BO1A 1M90H 3CC4F 5FLXM 5DCVA 3HJWC 1VQNF 2AIFA 3CCJF 1VQ6F 2OTJF 3PAFA 2FC3A 3MCAB 1K9MH 5G4UC 1W42A 1QVFF 3LWOC 5GIPC 2KTVA 1Q86H 1K73H 3V7EA 1YIJF 3LWPC 2QEXF 1VQ4F 4X3MA 3CCVF 5FJ4C 3CCUF 3PLAC 3J81M 1VQOF 3JAMM 2OHWA 3OBWA 5GAPK 3G4SF 1YJNF 3NVIB 2I6DA 3CMEF 1CN7A 1IPAA 3VMFB 3LWQC 3CPQA 3FFMA 1X52A 1N8RH 3N4YA 3HAXD 3RA6A 2QI2A 1Q82H 3J80M 1E7KA 1PXWA 2LBXA 1JJ2F 5A2QM 2ALEA 3CCRF 3CC2F 1Q81H 3I55F 3CCEF 1M1KH 1NMUB 1W41A 1VQKF 5G4VC 1VQLF 1VQ7F 3CG6A 3NMUC 1W3EX 3SIVA 2JNBA 3O85A 3J7AR 1VQ5F 1SDSA 1ZWZA 3LWRC 3G71F 3E20B 3CCQF 3CC7F 1Q7YH 3RA5A 1VQPF 1W2BF 1X7OA 1KD1H 2KG4A 1RLGA 2CZWA 2LBWA 3LFOA 3I56F 1XBIA 3CXCF 3CMAF 1CK2A 2OZBA 3CCSF 3LWVC 3SIUA 5IT9M 5EWRA 1YI2F 5EO3A 5GIOC 5GANK 4C4WC 4X3LA 1X7PA 3OW2F 2VGNA 1W40A 4NUTA 3VI6A 1RA4A 1H7MA 3CD6F 1GO0A 3E1YA 2HVYD 1YHQF 2OTLF 4BY9D 3GYQA 1T0KB 1VQ9F
chains in the Genus database with same CATH superfamily
1QVGF 4FFBB 1YJ9F 1W5EA 2I6RA 3RYCA 3JAWB 3ERNA 5J2TA 3CCMF 1U43A 3OONA 2WALA 3OBYA 3T80A 1JD1A 5MN5A 3CCLF 1SZQA 4TUYB 2R751 2ZVZA 3FD6A 1VQMF 3RYHB 4EI7A 1PF5A 4TV8A 1FFXA 5EYPA 3HKEA 4BW0B 1YITF 3NK6A 3JARA 2QA4F 1DT9A 1M90H 4ZHWA 3FBAA 3HKDA 3WPXA 1SA0B 4X1YA 3PAFA 4O4HB 3CYPB 2IAFA 5IJ0A 1W42A 2OTMA 1QVFF 4B5CA 3F0DA 5GIPC 3WJRA 2CWJA 2W8BC 1KNJA 5IYZA 3V7EA 4C82A 1W55A 2LBTA 2K1SA 3PLAC 2G9IA 2H8EA 1W5BA 3G4SF 1COMA 4EI8A 3DDNA 2MQEA 3KHNA 2Z1TA 4O4LB 4HNAA 3N2KA 3LWQC 3FFMA 2NMUA 1H48A 2ZODA 2AIZP 1X52A 1N8RH 3N4YA 3HAXD 5J2UA 1PXWA 1JJ2F 5A2QM 3CCRF 1Z5WA 2HS0A 4LNUA 5HY0A 4WBNA 3BYQA 1M1KH 2CW4A 3RYFA 2BTUA 5G4VC 3C8LA 3JALB 1VQLF 1W3EX 5LXTA 3SIVA 2VAMA 1VQ5F 4O2BB 4O2AA 3LWRC 3G71F 3HKEB 4X1IA 5LP6A 3WGKA 3RA5A 1Q7YH 4ZOLB 4TV9B 1W2BF 1KD1H 3P4EA 3ELCA 4IIJB 3MQWA 3K14A 4BT2A 4O4LA 5EB1B 4O4JA 3WJQA 4LNUB 4ZI7A 5IT9M 5CB4B 4ZHQB 2EWCA 1X25A 4U3JA 5GANK 1QD9A 3DC2A 2Z1EA 1ONIA 1X7PA 3UT5A 3OW2F 1JFFB 3V3TA 3K0TA 3WGMA 5C8YB 3VO8A 4G4XA 5CA0B 1RA4A 4G88A 4O4HA 4I4TA 3JATA 4ZOLA 2L26A 4BY9D 2RHJA 3ON1A 3IEWA 4BVSA 1GX1A 2Q1XA 3D01A 1NQ3A 2CVLA 3CPWF 3LYBA 4NWOB 2KTUA 4X20A 3G6EF 3JALA 3IR9A 4BT7A 5GINC 1VQ8F 2BTQB 4ZHQA 1TVKB 1K8AH 5ITZB 3JCMM 3JVHA 4ZHVA 3JAWA 5EAZA 3VYUC 2RHLA 3Q8HA 3D00A 4RHAA 5CA0A 1W59A 3WGNA 4EB6A 5C8YA 3S02A 5DCVA 3HJWC 1VQNF 5EB0A 1VQ6F 2HRYA 3HKBA 5G4UC 5GONB 4BT3A 1K73H 2HP0A 3LWPC 2QEXF 4X3MA 5CA1B 4BT4A 1TUBA 2V9YA 3RYIB 4X1KA 3CYQA 1YJNF 3NVIB 3JAKA 4X1KB 2YYEA 4I4TB 3VTIC 3E22B 3LMEA 3J80M 1E7KA 4G4ZA 1OAPA 3ZP4A 4BVQA 1Q81H 1CLIA 4G4YA 3I55F 2UYNB 3KJJA 2VAWA 2RHHA 2CHSA 5LYJB 3F6MA 2HS3A 1YQNA 1T0AA 5B8FA 3P10A 5IJ9B 4FFBA 4C8IA 3F0FA 2VAPA 3F0EA 1IV1A 1VH8A 2F9ZC 2ZVYA 1SA0A 3S0HA 3UT5B 5LYJA 1Q8RA 1RLGA 2LBWA 2DYYA 3B6NA 1XBIA 4ERHA 4O4IA 4YJ2A 3KIZA 1XRGA 1CK2A 2OZBA 3CCSF 3L7QA 3LWVC 5JVDA 4RQOA 5EWRA 3RYFB 2HP0B 4WBNB 5HY1A 4DXDA 2LCAA 1XV2A 4NUTA 5FNVA 2P6YA 5HP8A 2HRUA 4O4JB 4F6RA 1VK3A 3JARB 3M1XA 2HVYD 3MDOA 3D54A 1DBFA 4BVRA 4DRXA 2OTLF 4PWTA 3GYQA 1VQ9F 4IHJA 3NK7A 1VHAA 1YJWF 1J7HA 3IEQA 5BMVB 3R0PA 3V7QA 3HKCB 2AMTA 3N4ZA 2RHOA 3RYCB 2VGMA 3U0OA 1S72F 3M4SA 1XHOA 3S03A 3VYTC 4I50A 1GZ0A 3AGKA 4TZZA 4EB6B 1KQSF 3MCQA 1QU9A 3GHZA 1GO1A 1NJIH 3IKFA 3JAKB 2RB9A 5FNVB 1UFYA 5MN6A 2AIFA 2OTJF 5EIBC 3FPIA 1U3LA 1W5FA 1W581 1K9MH 1FFXB 3CB2A 2VXYA 3ZO8A 4E6EA 3IMPA 4KWEA 5JH7B 3MBMA 1W5AA 1YIJF 1VQVA 3N2GB 1VQ4F 2Z1FA 3KE1A 5FJ4C 1U3PA 5J2TB 3HKCA 5HXUA 3OBWA 5GAPK 3CMEF 1TVKA 1RLUA 4M8IA 3RYHA 3VMFB 5HP7A 2IQQA 2ZOVA 3CPQA 4ZHYB 3VOBA 3N2GA 5KX5B 3LDTA 5HWEA 1IV2A 2UYNA 2B33A 4O2AB 2QI2A 5CB4A 3RYIA 3JASA 3CC2F 3CCEF 1NMUB 1OFUA 3HTNA 4IIJA 2JNBA 2YXZA 5GONA 3S0YA 3QHDA 3JATB 3VIUA 1SDSA 1R1MA 4EI9A 2Z1UA 3EORA 3ZP7A 3CCQF 1TUBB 1VQPF 3K2XA 3C9SA 4ZK7A 2KG4A 1FSZA 1FNJA 3I56F 5EIBD 3IKEA 3CMAF 5KMGB 3HKBB 1YI2F 1RQ7A 5JCOA 5EO3A 3S06A 4C4WC 2DT4A 4IHJB 3TD4A 3WJPA 4U39A 2H6LA 2R6R1 3C9TA 3VI6A 3C9RA 2UYKA 1H47A 2BTOA 4X1IB 4O2BA 3RE3A 1QAHA 3I3FA 5IYZB 3I7TA 4X20B 1FNKA 2ZAUA 4G4VA 5JH7A 3WPWA 3NVKE 3V4DA 1Z5VA 4O4IB 4YJ2B 5HY4A 3S0WA 5CA1A 4LCKA 1IV3A 4U3JB 2GLZA 4X1YB 5LOVB 5MN4A 1KNKA 4BT6A 4C81A 4ZI7B 1KC8H 4HNAB 5EZYB 5JQGB 2UYPA 5IJ9A 3WXMB 2BO1A 3CC4F 5KX5A 5FLXM 4TV9A 4C8EA 3TD5A 2KGWA 3CCJF 4TUYA 2Z01A 4I55B 1RQ2A 2ZF8A 2FC3A 3VOAA 2HP3A 3MCAB 3F0GA 5JQGA 3LWOC 5LXTB 2KTVA 5LP6C 1Q86H 3FD5A 5BMVA 1IV4A 2Q1YA 5IJ0B 3E22A 2QTPA 3CCVF 1YGYA 2PHNA 1W57A 3CCUF 3TD3A 3M84A 5LP6B 5J2UB 3J81M 3HWUA 2OHWA 3JAMM 1VQOF 3JASB 3C9UA 4F6RB 2HX0A 5EZYA 2I6DA 1CN7A 1IPAA 2UZHA 4TV8B 5EYPB 1U40A 2PMPA 1JY8A 5AVMA 3RA6A 1Q82H 2LBXA 5HY2A 2ALEA 5JVDB 5LA6B 2GVIA 1JN1A 5JCOC 1VQKF 1W41A 3KJKA 4G4WA 5LOVA 1VQ7F 3CG6A 3NMUC 3K12A 3O85A 3GTZA 5LA6A 3J7AR 2GZLA 4B46A 5KMGA 2HS4A 2N48A 1ZWZA 4C8GA 5ITZA 4R40B 2CHTA 3E20B 3CC7F 4DRXB 3HKDB 1X7OA 2UYJA 1ODEA 2CZWA 3QUWA 4YJ3A 3LFOA 4B45A 3CXCF 4XCQA 3ESJA 3SIUA 5HXZA 4I50B 3ZOPA 2HQSC 3WGLA 5GIOC 4BVTA 4X3LA 4YJ3B 4BT5A 2IG8A 2VGNA 1W40A 1UI9A 4NQ3A 2FGYA 3QTYA 2H8CA 1H7MA 3VYSC 3CD6F 3P0ZA 1GO0A 3E1YA 4I55A 1YHQF 1JFFA 3VCZA 2CSLA 3WGJA 1T0KB 4B62A 3N2KB
chains in the Genus database with same CATH topology
3ON1A 3NK7A 4BVSA 1YJWF 1QVGF 1YJ9F 3NVKE 3CPWF 3V7QA 3CCMF 5HY4A 2KTUA 2WALA 3N4ZA 3OBYA 3G6EF 3IR9A 4LCKA 2VGMA 3CCLF 1S72F 2GLZA 5GINC 1VQ8F 1VQMF 1KC8H 1GZ0A 3AGKA 4TZZA 4EI7A 1KQSF 1K8AH 4BW0B 3JCMM 1YITF 1GO1A 3WXMB 1NJIH 3NK6A 2QA4F 1DT9A 2BO1A 1M90H 3CC4F 3D00A 5FLXM 5DCVA 3HJWC 1VQNF 2AIFA 3CCJF 1VQ6F 2OTJF 3PAFA 2FC3A 3MCAB 1K9MH 5G4UC 1W42A 1QVFF 3LWOC 5GIPC 2KTVA 1Q86H 1K73H 3V7EA 1YIJF 3LWPC 2QEXF 1VQ4F 4X3MA 3CCVF 5FJ4C 3CCUF 3PLAC 3J81M 1VQOF 3JAMM 2OHWA 5HXUA 3OBWA 5GAPK 3G4SF 1YJNF 4EI8A 3NVIB 2I6DA 3CMEF 1CN7A 1IPAA 3VMFB 3LWQC 3CPQA 3FFMA 5HWEA 1X52A 1N8RH 3N4YA 3HAXD 3RA6A 2QI2A 1Q82H 3J80M 1E7KA 1PXWA 2LBXA 1JJ2F 5A2QM 2ALEA 5HY2A 3CCRF 3CC2F 4BVQA 1Q81H 5HY0A 3I55F 3CCEF 1M1KH 1NMUB 1W41A 1VQKF 5G4VC 1VQLF 1VQ7F 3CG6A 3NMUC 1W3EX 3SIVA 2JNBA 3O85A 3J7AR 1VQ5F 1SDSA 1ZWZA 4EI9A 3LWRC 3G71F 3E20B 3CCQF 3CC7F 1Q7YH 2F9ZC 3RA5A 1VQPF 1W2BF 1X7OA 1KD1H 2KG4A 1RLGA 2CZWA 2LBWA 3LFOA 3I56F 1XBIA 3CXCF 3CMAF 1CK2A 4XCQA 2OZBA 3CCSF 3LWVC 3SIUA 5IT9M 5HXZA 5EWRA 1YI2F 5EO3A 5GIOC 5GANK 4BVTA 4C4WC 4X3LA 1X7PA 3OW2F 5HY1A 2VGNA 1W40A 2FGYA 4NQ3A 4NUTA 3V3TA 3VI6A 1RA4A 1H7MA 3CD6F 1GO0A 3E1YA 2HVYD 1YHQF 4BVRA 2OTLF 4BY9D 3GYQA 1T0KB 1VQ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ON1 A;  3NK7 A;  1YJW F;  1QVG F;  1YJ9 F;  3NVK E;  3CPW F;  3V7Q A;  3CCM F;  2KTU A;  2WAL A;  3N4Z A;  3OBY A;  3G6E F;  3IR9 A;  4LCK A;  2VGM A;  3CCL F;  1S72 F;  5GIN C;  1VQ8 F;  1VQM F;  1KC8 H;  1GZ0 A;  3AGK A;  4TZZ A;  1KQS F;  1K8A H;  4BW0 B;  3JCM M;  1YIT F;  1GO1 A;  3WXM B;  1NJI H;  3NK6 A;  2QA4 F;  1DT9 A;  2BO1 A;  1M90 H;  3CC4 F;  5FLX M;  5DCV A;  3HJW C;  1VQN F;  2AIF A;  3CCJ F;  1VQ6 F;  2OTJ F;  3PAF A;  2FC3 A;  3MCA B;  1K9M H;  5G4U C;  1W42 A;  1QVF F;  3LWO C;  5GIP C;  2KTV A;  1Q86 H;  1K73 H;  3V7E A;  1YIJ F;  3LWP C;  2QEX F;  1VQ4 F;  4X3M A;  3CCV F;  5FJ4 C;  3CCU F;  3PLA C;  3J81 M;  1VQO F;  3JAM M;  2OHW A;  3OBW A;  5GAP K;  3G4S F;  1YJN F;  3NVI B;  2I6D A;  3CME F;  1CN7 A;  1IPA A;  3VMF B;  3LWQ C;  3CPQ A;  3FFM A;  1X52 A;  1N8R H;  3N4Y A;  3HAX D;  3RA6 A;  2QI2 A;  1Q82 H;  3J80 M;  1E7K A;  1PXW A;  2LBX A;  1JJ2 F;  5A2Q M;  2ALE A;  3CCR F;  3CC2 F;  1Q81 H;  3I55 F;  3CCE F;  1M1K H;  1NMU B;  1W41 A;  1VQK F;  5G4V C;  1VQL F;  1VQ7 F;  3CG6 A;  3NMU C;  1W3E X;  3SIV A;  2JNB A;  3O85 A;  3J7A R;  1VQ5 F;  1SDS A;  1ZWZ A;  3LWR C;  3G71 F;  3E20 B;  3CCQ F;  3CC7 F;  1Q7Y H;  3RA5 A;  1VQP F;  1W2B F;  1X7O A;  1KD1 H;  2KG4 A;  1RLG A;  2CZW A;  2LBW A;  3LFO A;  3I56 F;  1XBI A;  3CXC F;  3CMA F;  1CK2 A;  2OZB A;  3CCS F;  3LWV C;  3SIU A;  5IT9 M;  5EWR A;  1YI2 F;  5EO3 A;  5GIO C;  5GAN K;  4C4W C;  4X3L A;  1X7P A;  3OW2 F;  2VGN A;  1W40 A;  4NUT A;  3VI6 A;  1RA4 A;  1H7M A;  3CD6 F;  1GO0 A;  3E1Y A;  2HVY D;  1YHQ F;  2OTL F;  4BY9 D;  3GYQ A;  1T0K B;  1VQ9 F; 
#chains in the Genus database with same CATH topology
 1QVG F;  4FFB B;  1YJ9 F;  1W5E A;  2I6R A;  3RYC A;  3JAW B;  3ERN A;  5J2T A;  3CCM F;  1U43 A;  3OON A;  2WAL A;  3OBY A;  3T80 A;  1JD1 A;  5MN5 A;  3CCL F;  1SZQ A;  4TUY B;  2R75 1;  2ZVZ A;  3FD6 A;  1VQM F;  3RYH B;  4EI7 A;  1PF5 A;  4TV8 A;  1FFX A;  5EYP A;  3HKE A;  4BW0 B;  1YIT F;  3NK6 A;  3JAR A;  2QA4 F;  1DT9 A;  1M90 H;  4ZHW A;  3FBA A;  3HKD A;  3WPX A;  1SA0 B;  4X1Y A;  3PAF A;  4O4H B;  3CYP B;  2IAF A;  5IJ0 A;  1W42 A;  2OTM A;  1QVF F;  4B5C A;  3F0D A;  5GIP C;  3WJR A;  2CWJ A;  2W8B C;  1KNJ A;  5IYZ A;  3V7E A;  4C82 A;  1W55 A;  2LBT A;  2K1S A;  3PLA C;  2G9I A;  2H8E A;  1W5B A;  3G4S F;  1COM A;  4EI8 A;  3DDN A;  2MQE A;  3KHN A;  2Z1T A;  4O4L B;  4HNA A;  3N2K A;  3LWQ C;  3FFM A;  2NMU A;  1H48 A;  2ZOD A;  2AIZ P;  1X52 A;  1N8R H;  3N4Y A;  3HAX D;  5J2U A;  1PXW A;  1JJ2 F;  5A2Q M;  3CCR F;  1Z5W A;  2HS0 A;  4LNU A;  5HY0 A;  4WBN A;  3BYQ A;  1M1K H;  2CW4 A;  3RYF A;  2BTU A;  5G4V C;  3C8L A;  3JAL B;  1VQL F;  1W3E X;  5LXT A;  3SIV A;  2VAM A;  1VQ5 F;  4O2B B;  4O2A A;  3LWR C;  3G71 F;  3HKE B;  4X1I A;  5LP6 A;  3WGK A;  3RA5 A;  1Q7Y H;  4ZOL B;  4TV9 B;  1W2B F;  1KD1 H;  3P4E A;  3ELC A;  4IIJ B;  3MQW A;  3K14 A;  4BT2 A;  4O4L A;  5EB1 B;  4O4J A;  3WJQ A;  4LNU B;  4ZI7 A;  5IT9 M;  5CB4 B;  4ZHQ B;  2EWC A;  1X25 A;  4U3J A;  5GAN K;  1QD9 A;  3DC2 A;  2Z1E A;  1ONI A;  1X7P A;  3UT5 A;  3OW2 F;  1JFF B;  3V3T A;  3K0T A;  3WGM A;  5C8Y B;  3VO8 A;  4G4X A;  5CA0 B;  1RA4 A;  4G88 A;  4O4H A;  4I4T A;  3JAT A;  4ZOL A;  2L26 A;  4BY9 D;  2RHJ A;  3ON1 A;  3IEW A;  4BVS A;  1GX1 A;  2Q1X A;  3D01 A;  1NQ3 A;  2CVL A;  3CPW F;  3LYB A;  4NWO B;  2KTU A;  4X20 A;  3G6E F;  3JAL A;  3IR9 A;  4BT7 A;  5GIN C;  1VQ8 F;  2BTQ B;  4ZHQ A;  1TVK B;  1K8A H;  5ITZ B;  3JCM M;  3JVH A;  4ZHV A;  3JAW A;  5EAZ A;  3VYU C;  2RHL A;  3Q8H A;  3D00 A;  4RHA A;  5CA0 A;  1W59 A;  3WGN A;  4EB6 A;  5C8Y A;  3S02 A;  5DCV A;  3HJW C;  1VQN F;  5EB0 A;  1VQ6 F;  2HRY A;  3HKB A;  5G4U C;  5GON B;  4BT3 A;  1K73 H;  2HP0 A;  3LWP C;  2QEX F;  4X3M A;  5CA1 B;  4BT4 A;  1TUB A;  2V9Y A;  3RYI B;  4X1K A;  3CYQ A;  1YJN F;  3NVI B;  3JAK A;  4X1K B;  2YYE A;  4I4T B;  3VTI C;  3E22 B;  3LME A;  3J80 M;  1E7K A;  4G4Z A;  1OAP A;  3ZP4 A;  4BVQ A;  1Q81 H;  1CLI A;  4G4Y A;  3I55 F;  2UYN B;  3KJJ A;  2VAW A;  2RHH A;  2CHS A;  5LYJ B;  3F6M A;  2HS3 A;  1YQN A;  1T0A A;  5B8F A;  3P10 A;  5IJ9 B;  4FFB A;  4C8I A;  3F0F A;  2VAP A;  3F0E A;  1IV1 A;  1VH8 A;  2F9Z C;  2ZVY A;  1SA0 A;  3S0H A;  3UT5 B;  5LYJ A;  1Q8R A;  1RLG A;  2LBW A;  2DYY A;  3B6N A;  1XBI A;  4ERH A;  4O4I A;  4YJ2 A;  3KIZ A;  1XRG A;  1CK2 A;  2OZB A;  3CCS F;  3L7Q A;  3LWV C;  5JVD A;  4RQO A;  5EWR A;  3RYF B;  2HP0 B;  4WBN B;  5HY1 A;  4DXD A;  2LCA A;  1XV2 A;  4NUT A;  5FNV A;  2P6Y A;  5HP8 A;  2HRU A;  4O4J B;  4F6R A;  1VK3 A;  3JAR B;  3M1X A;  2HVY D;  3MDO A;  3D54 A;  1DBF A;  4BVR A;  4DRX A;  2OTL F;  4PWT A;  3GYQ A;  1VQ9 F;  4IHJ A;  3NK7 A;  1VHA A;  1YJW F;  1J7H A;  3IEQ A;  5BMV B;  3R0P A;  3V7Q A;  3HKC B;  2AMT A;  3N4Z A;  2RHO A;  3RYC B;  2VGM A;  3U0O A;  1S72 F;  3M4S A;  1XHO A;  3S03 A;  3VYT C;  4I50 A;  1GZ0 A;  3AGK A;  4TZZ A;  4EB6 B;  1KQS F;  3MCQ A;  1QU9 A;  3GHZ A;  1GO1 A;  1NJI H;  3IKF A;  3JAK B;  2RB9 A;  5FNV B;  1UFY A;  5MN6 A;  2AIF A;  2OTJ F;  5EIB C;  3FPI A;  1U3L A;  1W5F A;  1W58 1;  1K9M H;  1FFX B;  3CB2 A;  2VXY A;  3ZO8 A;  4E6E A;  3IMP A;  4KWE A;  5JH7 B;  3MBM A;  1W5A A;  1YIJ F;  1VQV A;  3N2G B;  1VQ4 F;  2Z1F A;  3KE1 A;  5FJ4 C;  1U3P A;  5J2T B;  3HKC A;  5HXU A;  3OBW A;  5GAP K;  3CME F;  1TVK A;  1RLU A;  4M8I A;  3RYH A;  3VMF B;  5HP7 A;  2IQQ A;  2ZOV A;  3CPQ A;  4ZHY B;  3VOB A;  3N2G A;  5KX5 B;  3LDT A;  5HWE A;  1IV2 A;  2UYN A;  2B33 A;  4O2A B;  2QI2 A;  5CB4 A;  3RYI A;  3JAS A;  3CC2 F;  3CCE F;  1NMU B;  1OFU A;  3HTN A;  4IIJ A;  2JNB A;  2YXZ A;  5GON A;  3S0Y A;  3QHD A;  3JAT B;  3VIU A;  1SDS A;  1R1M A;  4EI9 A;  2Z1U A;  3EOR A;  3ZP7 A;  3CCQ F;  1TUB B;  1VQP F;  3K2X A;  3C9S A;  4ZK7 A;  2KG4 A;  1FSZ A;  1FNJ A;  3I56 F;  5EIB D;  3IKE A;  3CMA F;  5KMG B;  3HKB B;  1YI2 F;  1RQ7 A;  5JCO A;  5EO3 A;  3S06 A;  4C4W C;  2DT4 A;  4IHJ B;  3TD4 A;  3WJP A;  4U39 A;  2H6L A;  2R6R 1;  3C9T A;  3VI6 A;  3C9R A;  2UYK A;  1H47 A;  2BTO A;  4X1I B;  4O2B A;  3RE3 A;  1QAH A;  3I3F A;  5IYZ B;  3I7T A;  4X20 B;  1FNK A;  2ZAU A;  4G4V A;  5JH7 A;  3WPW A;  3NVK E;  3V4D A;  1Z5V A;  4O4I B;  4YJ2 B;  5HY4 A;  3S0W A;  5CA1 A;  4LCK A;  1IV3 A;  4U3J B;  2GLZ A;  4X1Y B;  5LOV B;  5MN4 A;  1KNK A;  4BT6 A;  4C81 A;  4ZI7 B;  1KC8 H;  4HNA B;  5EZY B;  5JQG B;  2UYP A;  5IJ9 A;  3WXM B;  2BO1 A;  3CC4 F;  5KX5 A;  5FLX M;  4TV9 A;  4C8E A;  3TD5 A;  2KGW A;  3CCJ F;  4TUY A;  2Z01 A;  4I55 B;  1RQ2 A;  2ZF8 A;  2FC3 A;  3VOA A;  2HP3 A;  3MCA B;  3F0G A;  5JQG A;  3LWO C;  5LXT B;  2KTV A;  5LP6 C;  1Q86 H;  3FD5 A;  5BMV A;  1IV4 A;  2Q1Y A;  5IJ0 B;  3E22 A;  2QTP A;  3CCV F;  1YGY A;  2PHN A;  1W57 A;  3CCU F;  3TD3 A;  3M84 A;  5LP6 B;  5J2U B;  3J81 M;  3HWU A;  2OHW A;  3JAM M;  1VQO F;  3JAS B;  3C9U A;  4F6R B;  2HX0 A;  5EZY A;  2I6D A;  1CN7 A;  1IPA A;  2UZH A;  4TV8 B;  5EYP B;  1U40 A;  2PMP A;  1JY8 A;  5AVM A;  3RA6 A;  1Q82 H;  2LBX A;  5HY2 A;  2ALE A;  5JVD B;  5LA6 B;  2GVI A;  1JN1 A;  5JCO C;  1VQK F;  1W41 A;  3KJK A;  4G4W A;  5LOV A;  1VQ7 F;  3CG6 A;  3NMU C;  3K12 A;  3O85 A;  3GTZ A;  5LA6 A;  3J7A R;  2GZL A;  4B46 A;  5KMG A;  2HS4 A;  2N48 A;  1ZWZ A;  4C8G A;  5ITZ A;  4R40 B;  2CHT A;  3E20 B;  3CC7 F;  4DRX B;  3HKD B;  1X7O A;  2UYJ A;  1ODE A;  2CZW A;  3QUW A;  4YJ3 A;  3LFO A;  4B45 A;  3CXC F;  4XCQ A;  3ESJ A;  3SIU A;  5HXZ A;  4I50 B;  3ZOP A;  2HQS C;  3WGL A;  5GIO C;  4BVT A;  4X3L A;  4YJ3 B;  4BT5 A;  2IG8 A;  2VGN A;  1W40 A;  1UI9 A;  4NQ3 A;  2FGY A;  3QTY A;  2H8C A;  1H7M A;  3VYS C;  3CD6 F;  3P0Z A;  1GO0 A;  3E1Y A;  4I55 A;  1YHQ F;  1JFF A;  3VCZ A;  2CSL A;  3WGJ A;  1T0K B;  4B62 A;  3N2K B; 
#chains in the Genus database with same CATH homology
 3ON1 A;  3NK7 A;  4BVS A;  1YJW F;  1QVG F;  1YJ9 F;  3NVK E;  3CPW F;  3V7Q A;  3CCM F;  5HY4 A;  2KTU A;  2WAL A;  3N4Z A;  3OBY A;  3G6E F;  3IR9 A;  4LCK A;  2VGM A;  3CCL F;  1S72 F;  2GLZ A;  5GIN C;  1VQ8 F;  1VQM F;  1KC8 H;  1GZ0 A;  3AGK A;  4TZZ A;  4EI7 A;  1KQS F;  1K8A H;  4BW0 B;  3JCM M;  1YIT F;  1GO1 A;  3WXM B;  1NJI H;  3NK6 A;  2QA4 F;  1DT9 A;  2BO1 A;  1M90 H;  3CC4 F;  3D00 A;  5FLX M;  5DCV A;  3HJW C;  1VQN F;  2AIF A;  3CCJ F;  1VQ6 F;  2OTJ F;  3PAF A;  2FC3 A;  3MCA B;  1K9M H;  5G4U C;  1W42 A;  1QVF F;  3LWO C;  5GIP C;  2KTV A;  1Q86 H;  1K73 H;  3V7E A;  1YIJ F;  3LWP C;  2QEX F;  1VQ4 F;  4X3M A;  3CCV F;  5FJ4 C;  3CCU F;  3PLA C;  3J81 M;  1VQO F;  3JAM M;  2OHW A;  5HXU A;  3OBW A;  5GAP K;  3G4S F;  1YJN F;  4EI8 A;  3NVI B;  2I6D A;  3CME F;  1CN7 A;  1IPA A;  3VMF B;  3LWQ C;  3CPQ A;  3FFM A;  5HWE A;  1X52 A;  1N8R H;  3N4Y A;  3HAX D;  3RA6 A;  2QI2 A;  1Q82 H;  3J80 M;  1E7K A;  1PXW A;  2LBX A;  1JJ2 F;  5A2Q M;  2ALE A;  5HY2 A;  3CCR F;  3CC2 F;  4BVQ A;  1Q81 H;  5HY0 A;  3I55 F;  3CCE F;  1M1K H;  1NMU B;  1W41 A;  1VQK F;  5G4V C;  1VQL F;  1VQ7 F;  3CG6 A;  3NMU C;  1W3E X;  3SIV A;  2JNB A;  3O85 A;  3J7A R;  1VQ5 F;  1SDS A;  1ZWZ A;  4EI9 A;  3LWR C;  3G71 F;  3E20 B;  3CCQ F;  3CC7 F;  1Q7Y H;  2F9Z C;  3RA5 A;  1VQP F;  1W2B F;  1X7O A;  1KD1 H;  2KG4 A;  1RLG A;  2CZW A;  2LBW A;  3LFO A;  3I56 F;  1XBI A;  3CXC F;  3CMA F;  1CK2 A;  4XCQ A;  2OZB A;  3CCS F;  3LWV C;  3SIU A;  5IT9 M;  5HXZ A;  5EWR A;  1YI2 F;  5EO3 A;  5GIO C;  5GAN K;  4BVT A;  4C4W C;  4X3L A;  1X7P A;  3OW2 F;  5HY1 A;  2VGN A;  1W40 A;  2FGY A;  4NQ3 A;  4NUT A;  3V3T A;  3VI6 A;  1RA4 A;  1H7M A;  3CD6 F;  1GO0 A;  3E1Y A;  2HVY D;  1YHQ F;  4BVR A;  2OTL F;  4BY9 D;  3GYQ A;  1T0K B;  1VQ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...