1VQLF

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqlF00
1NJIH 1X52A 5A2QM 3LFOA 3ON1A 1VQ7F 2AIFA 4X3LA 2WALA 3RA5A 3I56F 2VGNA 5GIOC 2OZBA 3CD6F 3LWVC 3N4ZA 3GYQA 1YIJF 3V7EA 3NVKE 1RA4A 3CC4F 3E20B 3AGKA 3PAFA 3G71F 2QI2A 2HVYD 4NUTA 1QVFF 3O85A 1YJWF 2BO1A 5G4UC 2KTUA 1YI2F 1KC8H 3CCLF 1KQSF 1X7OA 3WXMB 1M1KH 1W41A 1M90H 4C4WC 3G6EF 1CN7A 3I55F 1IPAA 3JAMM 1VQOF 1SDSA 3NVIB 1CK2A 1VQ8F 1VQ6F 1KD1H 1PXWA 1GZ0A 1XBIA 1K8AH 2OHWA 3CCVF 1RLGA 5EO3A 2LBWA 1E7KA 3OBYA 1N8RH 3NK6A 3J7AR 3G4SF 4BY9D 3LWPC 1VQLF 4TZZA 1Q82H 3CCEF 3FFMA 2FC3A 3J81M 5GANK 2VGMA 2QEXF 1Q86H 3SIVA 3J80M 1JJ2F 3SIUA 2ALEA 1VQNF 1VQ5F 3CCUF 4X3MA 2QA4F 1VQ4F 2OTLF 1W42A 1NMUB 3JCMM 1YJ9F 5GIPC 3CMAF 3CCSF 1VQ9F 5DCVA 3HAXD 3LWQC 5FLXM 3PLAC 1VQKF 3VMFB 3V7QA 1T0KB 3N4YA 3OBWA 5IT9M 3CCJF 2CZWA 3VI6A 3CMEF 1W40A 1GO1A 3CXCF 1S72F 2KTVA 2I6DA 2LBXA 1YITF 1ZWZA 3E1YA 3CCRF 1VQMF 3MCAB 1Q7YH 3CPWF 1GO0A 1QVGF 3CG6A 3LWRC 3OW2F 1DT9A 1VQPF 1K73H 1W3EX 2JNBA 4LCKA 3NMUC 1X7PA 3CCQF 3HJWC 3LWOC 2OTJF 4BW0B 5GAPK 3IR9A 5GINC 3CC7F 3NK7A 1W2BF 1Q81H 1H7MA 3CPQA 3CC2F 2KG4A 3RA6A 5FJ4C 5EWRA 1YHQF 1K9MH 1YJNF 3CCMF 5G4VC
chains in the Genus database with same CATH superfamily
3T80A 5EB1B 3WJQA 1FSZA 3I56F 1JD1A 5HY1A 1NQ3A 5GIOC 3VYSC 2OZBA 1FFXB 4I50B 4ZOLB 3V7EA 1RA4A 1W5AA 3MCQA 1KNKA 1QVFF 3O85A 2BO1A 5G4UC 2HP0A 1YI2F 4U3JB 5CA0B 5KMGA 3VIUA 1X7OA 2CHSA 3WXMB 3JALA 3BYQA 3RE3A 1IPAA 1IV4A 3JASA 2Q1XA 3NVIB 4LNUB 1CK2A 5HP7A 1K8AH 1X25A 5C8YA 2L26A 1RQ7A 1U3PA 2AIZP 3OONA 4C81A 4IIJB 5HP8A 3CCVF 1DBFA 3VOAA 4EI7A 4BVRA 5EO3A 5J2UB 4WBNB 3RYHB 1U3LA 4ERHA 3F0EA 2CSLA 4O4IA 1FNKA 3K12A 5JQGA 3WJPA 5J2TB 4U39A 4G4XA 4TZZA 4G4VA 2FC3A 5CA1A 3SIVA 3N2GB 5ITZB 4FFBA 4F6RA 3D54A 1JJ2F 5CB4B 5LA6B 4BVSA 4EI8A 1VQNF 2AMTA 3HKCB 3HKEA 3I7TA 3JAKB 1W42A 1IV2A 5JVDB 3JCMM 4X1YA 3FD5A 3K0TA 2ZOVA 4X20A 2GLZA 3FPIA 2GVIA 2N48A 5DCVA 5EB0A 5FLXM 1XHOA 3V7QA 2KGWA 3HKDB 3CCJF 2RHHA 4ZHWA 1FNJA 1GO1A 3CXCF 4O4JB 3KJJA 2I6DA 2LBXA 1YITF 2Z01A 4C8IA 2UYNB 1GO0A 3CG6A 3UT5A 3OW2F 1VQPF 4ZI7B 1W59A 3JAWA 3B6NA 4NQ3A 3HJWC 4O2AA 1ODEA 1UFYA 3IR9A 2GZLA 3IEQA 1W2BF 1H7MA 3M4SA 5IJ9B 5EWRA 3QTYA 4O4LB 1JFFA 5LP6A 4BT7A 5KX5A 3IEWA 5HY4A 5FNVA 1VHAA 1W55A 3P0ZA 3LFOA 2AIFA 3U0OA 5IJ0B 4G4YA 4BVTA 3KIZA 4B46A 4BT2A 2CHTA 3E20B 5IYZA 1ONIA 1TUBB 2HVYD 3E22B 4NUTA 2VAWA 1YJWF 2R751 3V3TA 5IYZB 4PWTA 2KTUA 4TUYB 1KC8H 5IJ0A 2IG8A 3WPXA 1M90H 2B33A 2V9YA 2HP3A 1Z5WA 5LXTB 1KD1H 5LP6B 1JFFB 1XBIA 4O4LA 1TVKB 2RHOA 3LYBA 3S0HA 2OHWA 4TV9A 2H8CA 1SZQA 1N8RH 3NK6A 3J7AR 3RYCB 4RHAA 5LYJB 3JAWB 2ZF8A 1U43A 1W57A 3J81M 2QEXF 2G9IA 2HS0A 2BTOA 3UT5B 3J80M 3SIUA 1UI9A 4I55B 4TV8A 3WJRA 2ALEA 3CCUF 4X3MA 1VQ4F 1NMUB 1YJ9F 2HRYA 3ESJA 3CMAF 3CCSF 3DDNA 3HAXD 3LWQC 3F0GA 3MQWA 1VQKF 3EORA 3TD3A 2HRUA 3N4YA 3M1XA 4I55A 4TV8B 4X20B 2CWJA 1S72F 2Z1EA 2H8EA 3JAKA 1T0AA 3HKEB 3E1YA 3HKCA 2EWCA 5LYJA 1VQMF 1KNJA 5LA6A 3ERNA 5CB4A 3K14A 3RYCA 2HX0A 3GTZA 5ITZA 3N2GA 1H47A 1K73H 5CA1B 2JNBA 3CYQA 3HWUA 3FD6A 3NMUC 4TV9B 3ZP7A 4B62A 2DT4A 5JQGB 1IV1A 1TVKA 2NMUA 4O4IB 3S03A 2ZAUA 3GHZA 3R0PA 3KHNA 5LXTA 1Q81H 3RYHA 4WBNA 5J2UA 3CPQA 2Z1FA 3RA6A 3VYTC 4IIJA 2OTMA 5C8YB 1YQNA 4TUYA 3JASB 3D00A 3E22A 3C9RA 3JALB 1TUBA 4X3LA 2WALA 3WPWA 5KMGB 1RQ2A 2VGNA 1W581 2F9ZC 4U3JA 5CA0A 3CD6F 2HP0B 1W5FA 2ZVZA 3V4DA 3CC4F 3AGKA 3PAFA 3G71F 2QI2A 3TD5A 4G4ZA 3LDTA 4E6EA 5FNVB 5KX5B 4ZOLA 4I50A 1QAHA 1FFXA 2YYEA 3MDOA 3CCLF 1KQSF 2P6YA 3D01A 1M1KH 4C4WC 3ELCA 1U40A 3G6EF 2Z1UA 3WGKA 5IJ9A 1CN7A 1VQOF 1GX1A 1R1MA 4NWOB 1H48A 3ZP4A 1SDSA 1VQ8F 1VQ6F 1XV2A 2UYJA 3WGJA 1RLGA 4O2AB 2LBWA 3VCZA 5MN6A 3C8LA 4ZI7A 4R40B 4EB6A 2H6LA 2UYNA 1VH8A 1W5EA 4I4TA 2UYPA 5EAZA 4BY9D 4B45A 5HXZA 1VQLF 3WGLA 3CCEF 2I6RA 3FFMA 5JCOC 2HQSC 3WGMA 5GANK 1Q86H 4O4JA 2ZODA 3HKDA 2LBTA 2UYKA 1VQ5F 2OTLF 2QA4F 3CB2A 1SA0A 3L7QA 3VYUC 5GIPC 4RQOA 2PMPA 4X1YB 3KE1A 5JVDA 4O2BB 4C8EA 2Z1TA 1T0KB 2RB9A 5AVMA 5IT9M 2CZWA 3CMEF 1Z5VA 3F6MA 4FFBB 4F6RB 2HS4A 2MQEA 5MN4A 1CLIA 4HNAA 1ZWZA 3P4EA 5MN5A 3MCAB 5LOVA 1VQVA 2CW4A 5J2TA 5JCOA 1QU9A 4M8IA 3IKFA 1DT9A 4X1KB 2ZVYA 4LCKA 2YXZA 5GONA 1JY8A 1X7PA 2HS3A 3CCQF 2BTUA 3MBMA 2R6R1 3JVHA 4DXDA 2OTJF 1QD9A 4BW0B 3VO8A 5GAPK 5HY2A 3CC7F 2W8BC 4ZHYB 4LNUA 4O4HB 4YJ2B 3CC2F 2KG4A 4G4WA 5HXUA 5FJ4C 2PHNA 2IQQA 4X1IA 1J7HA 2CVLA 3N2KB 3C9UA 4ZHQB 5G4VC 5EYPA 4DRXB 4BT4A 1NJIH 1X52A 5A2QM 3ON1A 2Q1YA 4B5CA 3QHDA 1VQ7F 3ZO8A 3RA5A 3LWVC 3N4ZA 3GYQA 1YIJF 3NVKE 2K1SA 1IV3A 2RHLA 1Q8RA 2QTPA 3DC2A 3IMPA 4YJ3A 1W41A 2LCAA 5LP6C 3JARA 3JATB 3RYFB 4BT5A 3I55F 3JAMM 5EYPB 4DRXA 3WGNA 4ZHQA 3N2KA 3S0YA 1PXWA 3S06A 2IAFA 1GZ0A 2DYYA 4X1IB 2VAMA 3K2XA 3QUWA 4C82A 5EIBD 5B8FA 3S02A 3C9SA 3RYIA 4YJ2A 4O4HA 4BT3A 3P10A 2UZHA 3IKEA 1E7KA 3M84A 3OBYA 3HKBA 2VAPA 1XRGA 3G4SF 4IHJA 5EZYB 3LWPC 1Q82H 5GONB 5JH7B 2VGMA 4X1KA 4BVQA 3LMEA 3C9TA 1JN1A 5LOVB 3ZOPA 1PF5A 2BTQB 4HNAB 4EI9A 4G88A 2VXYA 5BMVB 3VOBA 3I3FA 5BMVA 5HY0A 1VQ9F 4ZK7A 1YGYA 3PLAC 3VMFB 4ZHVA 4O2BA 3HTNA 3OBWA 5EIBC 3VI6A 3F0DA 5HWEA 3F0FA 4BT6A 1W40A 1SA0B 2KTVA 5JH7A 1VK3A 4IHJB 5EZYA 3CCRF 1Q7YH 3CPWF 3HKBB 1QVGF 3LWRC 4KWEA 1W3EX 2FGYA 3RYIB 3KJKA 3LWOC 1OAPA 3S0WA 4I4TB 4C8GA 5GINC 4EB6B 3Q8HA 3NK7A 3TD4A 3FBAA 3RYFA 3JATA 3JARB 1OFUA 4XCQA 2RHJA 1W5BA 3CYPB 3VTIC 1YHQF 1K9MH 1YJNF 1COMA 1RLUA 4YJ3B 3CCMF
chains in the Genus database with same CATH topology
1NJIH 1X52A 3D00A 5A2QM 3LFOA 3ON1A 1VQ7F 2AIFA 4X3LA 2WALA 3RA5A 3I56F 5HY1A 2VGNA 4BVTA 2F9ZC 5GIOC 2OZBA 3CD6F 3LWVC 3N4ZA 3GYQA 1YIJF 3V7EA 3NVKE 1RA4A 3CC4F 3E20B 3AGKA 3PAFA 3G71F 2QI2A 2HVYD 4NUTA 1QVFF 3O85A 1YJWF 2BO1A 3V3TA 5G4UC 2KTUA 1YI2F 1KC8H 3CCLF 1KQSF 1X7OA 3WXMB 1M1KH 1W41A 1M90H 4C4WC 3G6EF 1CN7A 3I55F 1IPAA 3JAMM 1VQOF 1SDSA 3NVIB 1CK2A 1VQ8F 1VQ6F 1KD1H 1PXWA 1GZ0A 1XBIA 1K8AH 2OHWA 3CCVF 4EI7A 1RLGA 4BVRA 5EO3A 2LBWA 1E7KA 3OBYA 1N8RH 3NK6A 3J7AR 3G4SF 4BY9D 5HXZA 3LWPC 4TZZA 1Q82H 1VQLF 3CCEF 3FFMA 2FC3A 3J81M 5GANK 2VGMA 4BVQA 2QEXF 1Q86H 3SIVA 3J80M 1JJ2F 3SIUA 4BVSA 4EI8A 2ALEA 1VQNF 1VQ5F 3CCUF 4X3MA 2QA4F 1VQ4F 2OTLF 1W42A 1NMUB 4EI9A 3JCMM 1YJ9F 2GLZA 5GIPC 5HY0A 3CMAF 3CCSF 1VQ9F 5DCVA 3HAXD 3LWQC 5FLXM 3PLAC 1VQKF 3VMFB 3V7QA 1T0KB 3N4YA 3OBWA 5IT9M 3CCJF 2CZWA 3VI6A 3CMEF 5HWEA 1W40A 1GO1A 3CXCF 1S72F 2KTVA 2I6DA 2LBXA 1YITF 1ZWZA 3E1YA 3CCRF 1VQMF 3MCAB 1Q7YH 3CPWF 1GO0A 1QVGF 3CG6A 3LWRC 3OW2F 1DT9A 1VQPF 1K73H 1W3EX 2JNBA 4LCKA 2FGYA 3NMUC 1X7PA 4NQ3A 3CCQF 3HJWC 3LWOC 2OTJF 4BW0B 5GAPK 3IR9A 5HY2A 5GINC 3CC7F 3NK7A 1W2BF 1Q81H 1H7MA 3CPQA 3CC2F 2KG4A 5HXUA 3RA6A 5FJ4C 4XCQA 5EWRA 1YHQF 1K9MH 1YJNF 3CCMF 5HY4A 5G4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI H;  1X52 A;  5A2Q M;  3LFO A;  3ON1 A;  1VQ7 F;  2AIF A;  4X3L A;  2WAL A;  3RA5 A;  3I56 F;  2VGN A;  5GIO C;  2OZB A;  3CD6 F;  3LWV C;  3N4Z A;  3GYQ A;  1YIJ F;  3V7E A;  3NVK E;  1RA4 A;  3CC4 F;  3E20 B;  3AGK A;  3PAF A;  3G71 F;  2QI2 A;  2HVY D;  4NUT A;  1QVF F;  3O85 A;  1YJW F;  2BO1 A;  5G4U C;  2KTU A;  1YI2 F;  1KC8 H;  3CCL F;  1KQS F;  1X7O A;  3WXM B;  1M1K H;  1W41 A;  1M90 H;  4C4W C;  3G6E F;  1CN7 A;  3I55 F;  1IPA A;  3JAM M;  1VQO F;  1SDS A;  3NVI B;  1CK2 A;  1VQ8 F;  1VQ6 F;  1KD1 H;  1PXW A;  1GZ0 A;  1XBI A;  1K8A H;  2OHW A;  3CCV F;  1RLG A;  5EO3 A;  2LBW A;  1E7K A;  3OBY A;  1N8R H;  3NK6 A;  3J7A R;  3G4S F;  4BY9 D;  3LWP C;  1VQL F;  4TZZ A;  1Q82 H;  3CCE F;  3FFM A;  2FC3 A;  3J81 M;  5GAN K;  2VGM A;  2QEX F;  1Q86 H;  3SIV A;  3J80 M;  1JJ2 F;  3SIU A;  2ALE A;  1VQN F;  1VQ5 F;  3CCU F;  4X3M A;  2QA4 F;  1VQ4 F;  2OTL F;  1W42 A;  1NMU B;  3JCM M;  1YJ9 F;  5GIP C;  3CMA F;  3CCS F;  1VQ9 F;  5DCV A;  3HAX D;  3LWQ C;  5FLX M;  3PLA C;  1VQK F;  3VMF B;  3V7Q A;  1T0K B;  3N4Y A;  3OBW A;  5IT9 M;  3CCJ F;  2CZW A;  3VI6 A;  3CME F;  1W40 A;  1GO1 A;  3CXC F;  1S72 F;  2KTV A;  2I6D A;  2LBX A;  1YIT F;  1ZWZ A;  3E1Y A;  3CCR F;  1VQM F;  3MCA B;  1Q7Y H;  3CPW F;  1GO0 A;  1QVG F;  3CG6 A;  3LWR C;  3OW2 F;  1DT9 A;  1VQP F;  1K73 H;  1W3E X;  2JNB A;  4LCK A;  3NMU C;  1X7P A;  3CCQ F;  3HJW C;  3LWO C;  2OTJ F;  4BW0 B;  5GAP K;  3IR9 A;  5GIN C;  3CC7 F;  3NK7 A;  1W2B F;  1Q81 H;  1H7M A;  3CPQ A;  3CC2 F;  2KG4 A;  3RA6 A;  5FJ4 C;  5EWR A;  1YHQ F;  1K9M H;  1YJN F;  3CCM F;  5G4V C; 
#chains in the Genus database with same CATH topology
 3T80 A;  5EB1 B;  3WJQ A;  1FSZ A;  3I56 F;  1JD1 A;  5HY1 A;  1NQ3 A;  5GIO C;  3VYS C;  2OZB A;  1FFX B;  4I50 B;  4ZOL B;  3V7E A;  1RA4 A;  1W5A A;  3MCQ A;  1KNK A;  1QVF F;  3O85 A;  2BO1 A;  5G4U C;  2HP0 A;  1YI2 F;  4U3J B;  5CA0 B;  5KMG A;  3VIU A;  1X7O A;  2CHS A;  3WXM B;  3JAL A;  3BYQ A;  3RE3 A;  1IPA A;  1IV4 A;  3JAS A;  2Q1X A;  3NVI B;  4LNU B;  1CK2 A;  5HP7 A;  1K8A H;  1X25 A;  5C8Y A;  2L26 A;  1RQ7 A;  1U3P A;  2AIZ P;  3OON A;  4C81 A;  4IIJ B;  5HP8 A;  3CCV F;  1DBF A;  3VOA A;  4EI7 A;  4BVR A;  5EO3 A;  5J2U B;  4WBN B;  3RYH B;  1U3L A;  4ERH A;  3F0E A;  2CSL A;  4O4I A;  1FNK A;  3K12 A;  5JQG A;  3WJP A;  5J2T B;  4U39 A;  4G4X A;  4TZZ A;  4G4V A;  2FC3 A;  5CA1 A;  3SIV A;  3N2G B;  5ITZ B;  4FFB A;  4F6R A;  3D54 A;  1JJ2 F;  5CB4 B;  5LA6 B;  4BVS A;  4EI8 A;  1VQN F;  2AMT A;  3HKC B;  3HKE A;  3I7T A;  3JAK B;  1W42 A;  1IV2 A;  5JVD B;  3JCM M;  4X1Y A;  3FD5 A;  3K0T A;  2ZOV A;  4X20 A;  2GLZ A;  3FPI A;  2GVI A;  2N48 A;  5DCV A;  5EB0 A;  5FLX M;  1XHO A;  3V7Q A;  2KGW A;  3HKD B;  3CCJ F;  2RHH A;  4ZHW A;  1FNJ A;  1GO1 A;  3CXC F;  4O4J B;  3KJJ A;  2I6D A;  2LBX A;  1YIT F;  2Z01 A;  4C8I A;  2UYN B;  1GO0 A;  3CG6 A;  3UT5 A;  3OW2 F;  1VQP F;  4ZI7 B;  1W59 A;  3JAW A;  3B6N A;  4NQ3 A;  3HJW C;  4O2A A;  1ODE A;  1UFY A;  3IR9 A;  2GZL A;  3IEQ A;  1W2B F;  1H7M A;  3M4S A;  5IJ9 B;  5EWR A;  3QTY A;  4O4L B;  1JFF A;  5LP6 A;  4BT7 A;  5KX5 A;  3IEW A;  5HY4 A;  5FNV A;  1VHA A;  1W55 A;  3P0Z A;  3LFO A;  2AIF A;  3U0O A;  5IJ0 B;  4G4Y A;  4BVT A;  3KIZ A;  4B46 A;  4BT2 A;  2CHT A;  3E20 B;  5IYZ A;  1ONI A;  1TUB B;  2HVY D;  3E22 B;  4NUT A;  2VAW A;  1YJW F;  2R75 1;  3V3T A;  5IYZ B;  4PWT A;  2KTU A;  4TUY B;  1KC8 H;  5IJ0 A;  2IG8 A;  3WPX A;  1M90 H;  2B33 A;  2V9Y A;  2HP3 A;  1Z5W A;  5LXT B;  1KD1 H;  5LP6 B;  1JFF B;  1XBI A;  4O4L A;  1TVK B;  2RHO A;  3LYB A;  3S0H A;  2OHW A;  4TV9 A;  2H8C A;  1SZQ A;  1N8R H;  3NK6 A;  3J7A R;  3RYC B;  4RHA A;  5LYJ B;  3JAW B;  2ZF8 A;  1U43 A;  1W57 A;  3J81 M;  2QEX F;  2G9I A;  2HS0 A;  2BTO A;  3UT5 B;  3J80 M;  3SIU A;  1UI9 A;  4I55 B;  4TV8 A;  3WJR A;  2ALE A;  3CCU F;  4X3M A;  1VQ4 F;  1NMU B;  1YJ9 F;  2HRY A;  3ESJ A;  3CMA F;  3CCS F;  3DDN A;  3HAX D;  3LWQ C;  3F0G A;  3MQW A;  1VQK F;  3EOR A;  3TD3 A;  2HRU A;  3N4Y A;  3M1X A;  4I55 A;  4TV8 B;  4X20 B;  2CWJ A;  1S72 F;  2Z1E A;  2H8E A;  3JAK A;  1T0A A;  3HKE B;  3E1Y A;  3HKC A;  2EWC A;  5LYJ A;  1VQM F;  1KNJ A;  5LA6 A;  3ERN A;  5CB4 A;  3K14 A;  3RYC A;  2HX0 A;  3GTZ A;  5ITZ A;  3N2G A;  1H47 A;  1K73 H;  5CA1 B;  2JNB A;  3CYQ A;  3HWU A;  3FD6 A;  3NMU C;  4TV9 B;  3ZP7 A;  4B62 A;  2DT4 A;  5JQG B;  1IV1 A;  1TVK A;  2NMU A;  4O4I B;  3S03 A;  2ZAU A;  3GHZ A;  3R0P A;  3KHN A;  5LXT A;  1Q81 H;  3RYH A;  4WBN A;  5J2U A;  3CPQ A;  2Z1F A;  3RA6 A;  3VYT C;  4IIJ A;  2OTM A;  5C8Y B;  1YQN A;  4TUY A;  3JAS B;  3D00 A;  3E22 A;  3C9R A;  3JAL B;  1TUB A;  4X3L A;  2WAL A;  3WPW A;  5KMG B;  1RQ2 A;  2VGN A;  1W58 1;  2F9Z C;  4U3J A;  5CA0 A;  3CD6 F;  2HP0 B;  1W5F A;  2ZVZ A;  3V4D A;  3CC4 F;  3AGK A;  3PAF A;  3G71 F;  2QI2 A;  3TD5 A;  4G4Z A;  3LDT A;  4E6E A;  5FNV B;  5KX5 B;  4ZOL A;  4I50 A;  1QAH A;  1FFX A;  2YYE A;  3MDO A;  3CCL F;  1KQS F;  2P6Y A;  3D01 A;  1M1K H;  4C4W C;  3ELC A;  1U40 A;  3G6E F;  2Z1U A;  3WGK A;  5IJ9 A;  1CN7 A;  1VQO F;  1GX1 A;  1R1M A;  4NWO B;  1H48 A;  3ZP4 A;  1SDS A;  1VQ8 F;  1VQ6 F;  1XV2 A;  2UYJ A;  3WGJ A;  1RLG A;  4O2A B;  2LBW A;  3VCZ A;  5MN6 A;  3C8L A;  4ZI7 A;  4R40 B;  4EB6 A;  2H6L A;  2UYN A;  1VH8 A;  1W5E A;  4I4T A;  2UYP A;  5EAZ A;  4BY9 D;  4B45 A;  5HXZ A;  1VQL F;  3WGL A;  3CCE F;  2I6R A;  3FFM A;  5JCO C;  2HQS C;  3WGM A;  5GAN K;  1Q86 H;  4O4J A;  2ZOD A;  3HKD A;  2LBT A;  2UYK A;  1VQ5 F;  2OTL F;  2QA4 F;  3CB2 A;  1SA0 A;  3L7Q A;  3VYU C;  5GIP C;  4RQO A;  2PMP A;  4X1Y B;  3KE1 A;  5JVD A;  4O2B B;  4C8E A;  2Z1T A;  1T0K B;  2RB9 A;  5AVM A;  5IT9 M;  2CZW A;  3CME F;  1Z5V A;  3F6M A;  4FFB B;  4F6R B;  2HS4 A;  2MQE A;  5MN4 A;  1CLI A;  4HNA A;  1ZWZ A;  3P4E A;  5MN5 A;  3MCA B;  5LOV A;  1VQV A;  2CW4 A;  5J2T A;  5JCO A;  1QU9 A;  4M8I A;  3IKF A;  1DT9 A;  4X1K B;  2ZVY A;  4LCK A;  2YXZ A;  5GON A;  1JY8 A;  1X7P A;  2HS3 A;  3CCQ F;  2BTU A;  3MBM A;  2R6R 1;  3JVH A;  4DXD A;  2OTJ F;  1QD9 A;  4BW0 B;  3VO8 A;  5GAP K;  5HY2 A;  3CC7 F;  2W8B C;  4ZHY B;  4LNU A;  4O4H B;  4YJ2 B;  3CC2 F;  2KG4 A;  4G4W A;  5HXU A;  5FJ4 C;  2PHN A;  2IQQ A;  4X1I A;  1J7H A;  2CVL A;  3N2K B;  3C9U A;  4ZHQ B;  5G4V C;  5EYP A;  4DRX B;  4BT4 A;  1NJI H;  1X52 A;  5A2Q M;  3ON1 A;  2Q1Y A;  4B5C A;  3QHD A;  1VQ7 F;  3ZO8 A;  3RA5 A;  3LWV C;  3N4Z A;  3GYQ A;  1YIJ F;  3NVK E;  2K1S A;  1IV3 A;  2RHL A;  1Q8R A;  2QTP A;  3DC2 A;  3IMP A;  4YJ3 A;  1W41 A;  2LCA A;  5LP6 C;  3JAR A;  3JAT B;  3RYF B;  4BT5 A;  3I55 F;  3JAM M;  5EYP B;  4DRX A;  3WGN A;  4ZHQ A;  3N2K A;  3S0Y A;  1PXW A;  3S06 A;  2IAF A;  1GZ0 A;  2DYY A;  4X1I B;  2VAM A;  3K2X A;  3QUW A;  4C82 A;  5EIB D;  5B8F A;  3S02 A;  3C9S A;  3RYI A;  4YJ2 A;  4O4H A;  4BT3 A;  3P10 A;  2UZH A;  3IKE A;  1E7K A;  3M84 A;  3OBY A;  3HKB A;  2VAP A;  1XRG A;  3G4S F;  4IHJ A;  5EZY B;  3LWP C;  1Q82 H;  5GON B;  5JH7 B;  2VGM A;  4X1K A;  4BVQ A;  3LME A;  3C9T A;  1JN1 A;  5LOV B;  3ZOP A;  1PF5 A;  2BTQ B;  4HNA B;  4EI9 A;  4G88 A;  2VXY A;  5BMV B;  3VOB A;  3I3F A;  5BMV A;  5HY0 A;  1VQ9 F;  4ZK7 A;  1YGY A;  3PLA C;  3VMF B;  4ZHV A;  4O2B A;  3HTN A;  3OBW A;  5EIB C;  3VI6 A;  3F0D A;  5HWE A;  3F0F A;  4BT6 A;  1W40 A;  1SA0 B;  2KTV A;  5JH7 A;  1VK3 A;  4IHJ B;  5EZY A;  3CCR F;  1Q7Y H;  3CPW F;  3HKB B;  1QVG F;  3LWR C;  4KWE A;  1W3E X;  2FGY A;  3RYI B;  3KJK A;  3LWO C;  1OAP A;  3S0W A;  4I4T B;  4C8G A;  5GIN C;  4EB6 B;  3Q8H A;  3NK7 A;  3TD4 A;  3FBA A;  3RYF A;  3JAT A;  3JAR B;  1OFU A;  4XCQ A;  2RHJ A;  1W5B A;  3CYP B;  3VTI C;  1YHQ F;  1K9M H;  1YJN F;  1COM A;  1RLU A;  4YJ3 B;  3CCM F; 
#chains in the Genus database with same CATH homology
 1NJI H;  1X52 A;  3D00 A;  5A2Q M;  3LFO A;  3ON1 A;  1VQ7 F;  2AIF A;  4X3L A;  2WAL A;  3RA5 A;  3I56 F;  5HY1 A;  2VGN A;  4BVT A;  2F9Z C;  5GIO C;  2OZB A;  3CD6 F;  3LWV C;  3N4Z A;  3GYQ A;  1YIJ F;  3V7E A;  3NVK E;  1RA4 A;  3CC4 F;  3E20 B;  3AGK A;  3PAF A;  3G71 F;  2QI2 A;  2HVY D;  4NUT A;  1QVF F;  3O85 A;  1YJW F;  2BO1 A;  3V3T A;  5G4U C;  2KTU A;  1YI2 F;  1KC8 H;  3CCL F;  1KQS F;  1X7O A;  3WXM B;  1M1K H;  1W41 A;  1M90 H;  4C4W C;  3G6E F;  1CN7 A;  3I55 F;  1IPA A;  3JAM M;  1VQO F;  1SDS A;  3NVI B;  1CK2 A;  1VQ8 F;  1VQ6 F;  1KD1 H;  1PXW A;  1GZ0 A;  1XBI A;  1K8A H;  2OHW A;  3CCV F;  4EI7 A;  1RLG A;  4BVR A;  5EO3 A;  2LBW A;  1E7K A;  3OBY A;  1N8R H;  3NK6 A;  3J7A R;  3G4S F;  4BY9 D;  5HXZ A;  3LWP C;  4TZZ A;  1Q82 H;  1VQL F;  3CCE F;  3FFM A;  2FC3 A;  3J81 M;  5GAN K;  2VGM A;  4BVQ A;  2QEX F;  1Q86 H;  3SIV A;  3J80 M;  1JJ2 F;  3SIU A;  4BVS A;  4EI8 A;  2ALE A;  1VQN F;  1VQ5 F;  3CCU F;  4X3M A;  2QA4 F;  1VQ4 F;  2OTL F;  1W42 A;  1NMU B;  4EI9 A;  3JCM M;  1YJ9 F;  2GLZ A;  5GIP C;  5HY0 A;  3CMA F;  3CCS F;  1VQ9 F;  5DCV A;  3HAX D;  3LWQ C;  5FLX M;  3PLA C;  1VQK F;  3VMF B;  3V7Q A;  1T0K B;  3N4Y A;  3OBW A;  5IT9 M;  3CCJ F;  2CZW A;  3VI6 A;  3CME F;  5HWE A;  1W40 A;  1GO1 A;  3CXC F;  1S72 F;  2KTV A;  2I6D A;  2LBX A;  1YIT F;  1ZWZ A;  3E1Y A;  3CCR F;  1VQM F;  3MCA B;  1Q7Y H;  3CPW F;  1GO0 A;  1QVG F;  3CG6 A;  3LWR C;  3OW2 F;  1DT9 A;  1VQP F;  1K73 H;  1W3E X;  2JNB A;  4LCK A;  2FGY A;  3NMU C;  1X7P A;  4NQ3 A;  3CCQ F;  3HJW C;  3LWO C;  2OTJ F;  4BW0 B;  5GAP K;  3IR9 A;  5HY2 A;  5GIN C;  3CC7 F;  3NK7 A;  1W2B F;  1Q81 H;  1H7M A;  3CPQ A;  3CC2 F;  2KG4 A;  5HXU A;  3RA6 A;  5FJ4 C;  4XCQ A;  5EWR A;  1YHQ F;  1K9M H;  1YJN F;  3CCM F;  5HY4 A;  5G4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...