1VQLF

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqlF00
1K73H 2KTUA 1YJWF 1NJIH 3CXCF 3E20B 1W3EX 5GIPC 1K8AH 1NMUB 3LWQC 2AIFA 1VQKF 3I56F 2OHWA 3V7QA 2OZBA 3ON1A 3RA5A 1W2BF 5G4UC 2FC3A 3I55F 3IR9A 3JCMM 4X3MA 5DCVA 1E7KA 1M90H 2VGNA 2CZWA 5GIOC 3SIVA 3AGKA 5A2QM 5EWRA 3GYQA 1VQNF 3LWVC 3CMEF 2HVYD 3E1YA 3HAXD 1VQ6F 3OBYA 1GZ0A 3J81M 4NUTA 3LWPC 3CCMF 3CCVF 1YI2F 1N8RH 2LBWA 5EO3A 3MCAB 1RLGA 3LWOC 3LFOA 4BY9D 1W41A 3G4SF 1Q81H 3CC4F 1YITF 4BW0B 1W42A 1ZWZA 2QEXF 4X3LA 1VQOF 1DT9A 3CCQF 3CC2F 3CPQA 3OW2F 1VQ5F 3CCJF 5FJ4C 2KTVA 1M1KH 1KQSF 1VQ9F 4TZZA 3J7AR 3PAFA 3CD6F 1Q82H 1VQ4F 3V7EA 1X7PA 4C4WC 3CG6A 2JNBA 3CCUF 1QVGF 1VQ8F 2WALA 1CN7A 1PXWA 3OBWA 1X52A 1KD1H 1GO0A 2KG4A 3CPWF 2OTJF 3NVIB 1X7OA 1W40A 3CCSF 1T0KB 1VQMF 1KC8H 1GO1A 1YJ9F 1CK2A 1YJNF 3O85A 2QA4F 1RA4A 3NVKE 1Q86H 3NK6A 3WXMB 2LBXA 3NK7A 3RA6A 5FLXM 1IPAA 2QI2A 1XBIA 2I6DA 3LWRC 5GINC 3VMFB 3CCRF 1YIJF 1S72F 3PLAC 3VI6A 4LCKA 3N4ZA 5GAPK 1VQLF 1SDSA 1JJ2F 1QVFF 3NMUC 3SIUA 3FFMA 3CMAF 3G6EF 1VQPF 3CC7F 3J80M 2ALEA 1YHQF 3HJWC 2OTLF 5GANK 3CCLF 2BO1A 5G4VC 1H7MA 1K9MH 3N4YA 1Q7YH 3CCEF 3JAMM 5IT9M 3G71F 2VGMA 1VQ7F
chains in the Genus database with same CATH superfamily
5EZYA 3P4EA 4B46A 5LA6B 3RYHB 1K73H 1SZQA 3JVHA 3CXCF 2CSLA 4C82A 4O4IA 3S02A 5GIPC 1VQKF 3WGMA 3VTIC 1W5EA 3LWQC 2CVLA 1TVKA 4BT4A 2AIZP 5EYPA 2FC3A 3IR9A 4ZOLA 4E6EA 1W5FA 4FFBB 4X3MA 5DCVA 3MDOA 5CA0A 3FD6A 1H47A 3GYQA 4O4HB 1U3PA 5JH7B 3LWVC 2HRUA 1VQ6F 3C9TA 3F0EA 1GZ0A 3J81M 3LWPC 2LBTA 2LBWA 3D54A 4BT3A 3JATA 2NMUA 5LXTA 3M84A 5HXZA 1Q81H 1PF5A 2GLZA 5BMVA 3VO8A 1W42A 2QEXF 4X3LA 1VQOF 1DT9A 2RB9A 1VK3A 3CC2F 3BYQA 4TV8B 1U40A 3IEWA 3CB2A 3RYIA 3CCJF 5EZYB 2CHSA 3PAFA 1VQ4F 3ESJA 4O4IB 4LNUA 3HKEA 3U0OA 2F9ZC 1FNKA 5LYJA 5HWEA 3S0WA 5HY1A 4ZOLB 1CN7A 1PXWA 3OBWA 1X52A 3T80A 5JVDA 1GO0A 1SA0B 3KIZA 3V4DA 5GONA 3I7TA 3IKEA 4X1IB 2RHLA 4I55A 3JASA 1ODEA 4ZHYB 4TUYA 3CYPB 1FSZA 1FNJA 5ITZA 2Q1XA 3JATB 5MN4A 2HQSC 4O4JA 2H8EA 2I6DA 1YIJF 1RLUA 2K1SA 3ZOPA 3SIUA 1IV1A 1R1MA 3WPWA 1VQPF 3RYIB 4C8IA 1YHQF 3CC7F 2OTLF 3JAWA 5IJ0B 2BO1A 4FFBA 3JAMM 4LNUB 3P10A 3HKEB 4M8IA 3C8LA 3G71F 5LYJB 1FFXA 1UI9A 5HY0A 1YJWF 2I6RA 3ZP4A 3E20B 3WPXA 1K8AH 2AIFA 3VYSC 3I56F 2Z1UA 2OHWA 3V7QA 3L7QA 4ZI7B 2R6R1 5G4UC 5GONB 4I50A 2W8BC 4TV9A 3LYBA 3JCMM 2B33A 1XV2A 2VGNA 3TD3A 4DRXA 3OONA 3JASB 4I55B 3AGKA 4TUYB 5EB0A 4RHAA 2OTMA 3K14A 5ITZB 3KJJA 4G4YA 1W581 3VCZA 2HVYD 3E1YA 5LP6C 1VH8A 4O4JB 1TUBB 4U39A 2HX0A 1OFUA 1YI2F 1N8RH 1KNJA 5EO3A 2PHNA 2BTUA 5EIBD 3LFOA 2YXZA 3WJQA 3C9SA 1YITF 3JAWB 3HKDA 3WGNA 3WJPA 1ZWZA 3UT5A 4ERHA 3HKCA 3CCQF 1SA0A 4ZHQA 4O2BA 3F0DA 2HP0A 3Q8HA 3OW2F 2FGYA 1CLIA 4G4WA 3QHDA 1XRGA 1FFXB 3I3FA 4BT6A 4O4LA 5JCOA 4C8EA 3CD6F 3V7EA 1X7PA 4X1IA 2JNBA 3CCUF 2DYYA 1J7HA 1UFYA 1W5BA 2YYEA 1VQ8F 4I50B 4TV9B 2WALA 2HRYA 4X1KA 3CYQA 1YGYA 3C9UA 4DRXB 3CPWF 4X1YA 3C9RA 4O2AA 4RQOA 1JFFA 5HY2A 1X7OA 1W40A 1T0KB 1JD1A 1GO1A 3WGKA 2ZOVA 3IEQA 1CK2A 3HKBA 4BT5A 3O85A 5IJ0A 5JQGB 3NVKE 4BVQA 3NK6A 1KNKA 3WXMB 3NK7A 4YJ3A 3RA6A 3VOAA 1VHAA 3K12A 3DDNA 1XBIA 4BVSA 4WBNA 3M1XA 3HKDB 5J2TA 5GINC 2Q1YA 3F0GA 2V9YA 3R0PA 4HNAA 3UT5B 3N4ZA 1W5AA 3HKCB 1JJ2F 1SDSA 3FPIA 2N48A 3FFMA 4O2BB 2ZAUA 4ZHQB 2HP0B 3G6EF 3S03A 3HJWC 2ALEA 2CW4A 4ZI7A 2G9IA 4O4LB 5G4VC 2CHTA 3JALA 1K9MH 3ERNA 1IV3A 1COMA 1IV4A 2VGMA 1VQ7F 3F0FA 5EB1B 2IG8A 3B6NA 3M4SA 3ZO8A 1H48A 2KTUA 2HS4A 1U43A 4X1KB 4BVTA 4ZHWA 1W3EX 1TUBA 1NMUB 2BTQB 1JN1A 4X1YB 4G4XA 4O2AB 1JFFB 2IQQA 5EAZA 3RA5A 3D00A 2Z1FA 3HKBB 2L26A 1M90H 2CZWA 1OAPA 3FD5A 3SIVA 2UYPA 2ZVYA 4U3JA 5EWRA 3TD5A 5A2QM 3ZP7A 1VQNF 2DT4A 3CMEF 3JAKA 4YJ3B 4EI8A 4WBNB 4XCQA 2RHJA 4NUTA 5J2TB 3CCMF 2P6YA 3QUWA 4F6RB 1NQ3A 4HNAB 3HTNA 1RLGA 5FNVA 2RHHA 5LP6B 2H8CA 3EORA 1W59A 1W41A 4I4TA 3G4SF 4B45A 3CC4F 5EIBC 3VOBA 2HS0A 2Z1TA 3JALB 5C8YA 2PMPA 2UYKA 2UYNA 1QAHA 3KJKA 3CPQA 1KQSF 4R40B 3WGJA 2HS3A 3J7AR 1Q82H 2EWCA 3E22A 3CG6A 4EI9A 2MQEA 1QU9A 5JQGA 2H6LA 3S0HA 2QTPA 5CA1A 3ELCA 5CB4B 3FBAA 3MBMA 2OTJF 4U3JB 2ZF8A 3JAKB 4G4VA 1VQMF 1YJ9F 5J2UA 2VXYA 4NQ3A 5IYZA 1YJNF 1X25A 2AMTA 5MN6A 3S06A 2VAMA 2QA4F 1RA4A 3MCQA 5FNVB 2LBXA 5FLXM 1W57A 4I4TB 3DC2A 3VYUC 3GTZA 3LWRC 1XHOA 3HWUA 1S72F 3VI6A 5C8YB 3RE3A 1VQLF 4IIJA 3F6MA 3LDTA 3NMUC 2UYNB 3KE1A 5KX5B 4B5CA 5GANK 3KHNA 5HP7A 5IT9M 3E22B 4IHJA 3VYTC 5B8FA 4DXDA 2GZLA 5IJ9A 3RYFA 5CA1B 2ZVZA 1NJIH 3K0TA 5LOVB 4F6RA 2OZBA 4ZK7A 3ON1A 1W2BF 3N2KA 3I55F 4G4ZA 5LP6A 2IAFA 4ZHVA 1U3LA 2BTOA 5J2UB 1E7KA 5IYZB 5GIOC 3IMPA 1VQVA 4YJ2A 3LMEA 1IV2A 4BT7A 2VAWA 2UZHA 3HAXD 3N2GA 3OBYA 4X20A 3WGLA 3K2XA 1Q8RA 3CCVF 2UYJA 1TVKB 3MCAB 5EYPB 2CWJA 4IIJB 2VAPA 3LWOC 4BY9D 2R751 4EB6A 5CA0B 4G88A 4BW0B 5KMGA 5CB4A 5HY4A 3IKFA 2KGWA 4IHJB 1VQ5F 5HP8A 5FJ4C 5IJ9B 3RYCA 2KTVA 1M1KH 1VQ9F 1RQ7A 3RYFB 3WJRA 4TZZA 3JARA 3VIUA 5LXTB 4C4WC 2Z01A 2LCAA 4NWOB 5BMVB 3P0ZA 1QVGF 1DBFA 3N2KB 3QTYA 5LA6A 3RYHA 5JCOC 1KD1H 3MQWA 1T0AA 2KG4A 5AVMA 4C81A 3NVIB 3CCSF 4YJ2B 1KC8H 5KX5A 3TD4A 3D01A 3N2GB 4X20B 4PWTA 5HXUA 4C8GA 1GX1A 1Q86H 4O4HA 5JH7A 1Z5WA 4EB6B 1IPAA 5JVDB 2QI2A 1ONIA 1RQ2A 3S0YA 4BT2A 3VMFB 4BVRA 3CCRF 1W55A 1Z5VA 3PLAC 1YQNA 2Z1EA 4LCKA 2GVIA 5KMGB 5GAPK 1QVFF 2HP3A 4EI7A 4KWEA 3CMAF 1JY8A 5LOVA 3J80M 5MN5A 3CCLF 3RYCB 1QD9A 3JARB 4B62A 1H7MA 3V3TA 3N4YA 1Q7YH 3GHZA 3CCEF 2ZODA 2RHOA 4TV8A
chains in the Genus database with same CATH topology
5HY0A 1K73H 2KTUA 1YJWF 4BVTA 1NJIH 3CXCF 3E20B 1W3EX 5GIPC 1K8AH 1NMUB 3LWQC 2AIFA 1VQKF 3I56F 2OHWA 3V7QA 2OZBA 3ON1A 3RA5A 1W2BF 5G4UC 2FC3A 3I55F 3IR9A 3JCMM 3D00A 4X3MA 5DCVA 1E7KA 1M90H 2VGNA 2CZWA 5GIOC 3SIVA 3AGKA 5A2QM 5EWRA 3GYQA 1VQNF 3LWVC 3CMEF 2HVYD 3E1YA 4EI8A 3HAXD 1VQ6F 3OBYA 4XCQA 1GZ0A 3J81M 4NUTA 3LWPC 3CCMF 3CCVF 1YI2F 1N8RH 2LBWA 5EO3A 3MCAB 1RLGA 3LWOC 3LFOA 4BY9D 5HXZA 1W41A 3G4SF 1Q81H 2GLZA 1YITF 3CC4F 4BW0B 1W42A 1ZWZA 2QEXF 4X3LA 1VQOF 5HY4A 1DT9A 3CCQF 3CC2F 3CPQA 3OW2F 1VQ5F 3CCJF 2FGYA 5FJ4C 2KTVA 1M1KH 1KQSF 1VQ9F 4TZZA 3J7AR 3PAFA 3CD6F 1Q82H 1VQ4F 3V7EA 1X7PA 4C4WC 3CG6A 4EI9A 2F9ZC 2JNBA 3CCUF 5HWEA 1QVGF 1VQ8F 5HY1A 2WALA 1CN7A 1PXWA 3OBWA 1X52A 1KD1H 1GO0A 2KG4A 3CPWF 2OTJF 5HY2A 3NVIB 1X7OA 1W40A 3CCSF 1T0KB 1VQMF 1KC8H 1GO1A 1YJ9F 4NQ3A 1CK2A 1YJNF 5HXUA 3O85A 2QA4F 1RA4A 3NVKE 4BVQA 1Q86H 3NK6A 3WXMB 2LBXA 3NK7A 3RA6A 5FLXM 1IPAA 2QI2A 1XBIA 4BVSA 2I6DA 3LWRC 5GINC 3VMFB 4BVRA 3CCRF 1YIJF 1S72F 3PLAC 3VI6A 4LCKA 3N4ZA 5GAPK 1VQLF 1SDSA 1JJ2F 1QVFF 3NMUC 4EI7A 3SIUA 3FFMA 3CMAF 3G6EF 1VQPF 3CC7F 3J80M 2ALEA 1YHQF 3HJWC 2OTLF 5GANK 3CCLF 2BO1A 5G4VC 1H7MA 3V3TA 3N4YA 1Q7YH 1K9MH 3CCEF 3JAMM 5IT9M 3G71F 2VGMA 1VQ7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 H;  2KTU A;  1YJW F;  1NJI H;  3CXC F;  3E20 B;  1W3E X;  5GIP C;  1K8A H;  1NMU B;  3LWQ C;  2AIF A;  1VQK F;  3I56 F;  2OHW A;  3V7Q A;  2OZB A;  3ON1 A;  3RA5 A;  1W2B F;  5G4U C;  2FC3 A;  3I55 F;  3IR9 A;  3JCM M;  4X3M A;  5DCV A;  1E7K A;  1M90 H;  2VGN A;  2CZW A;  5GIO C;  3SIV A;  3AGK A;  5A2Q M;  5EWR A;  3GYQ A;  1VQN F;  3LWV C;  3CME F;  2HVY D;  3E1Y A;  3HAX D;  1VQ6 F;  3OBY A;  1GZ0 A;  3J81 M;  4NUT A;  3LWP C;  3CCM F;  3CCV F;  1YI2 F;  1N8R H;  2LBW A;  5EO3 A;  3MCA B;  1RLG A;  3LWO C;  3LFO A;  4BY9 D;  1W41 A;  3G4S F;  1Q81 H;  3CC4 F;  1YIT F;  4BW0 B;  1W42 A;  1ZWZ A;  2QEX F;  4X3L A;  1VQO F;  1DT9 A;  3CCQ F;  3CC2 F;  3CPQ A;  3OW2 F;  1VQ5 F;  3CCJ F;  5FJ4 C;  2KTV A;  1M1K H;  1KQS F;  1VQ9 F;  4TZZ A;  3J7A R;  3PAF A;  3CD6 F;  1Q82 H;  1VQ4 F;  3V7E A;  1X7P A;  4C4W C;  3CG6 A;  2JNB A;  3CCU F;  1QVG F;  1VQ8 F;  2WAL A;  1CN7 A;  1PXW A;  3OBW A;  1X52 A;  1KD1 H;  1GO0 A;  2KG4 A;  3CPW F;  2OTJ F;  3NVI B;  1X7O A;  1W40 A;  3CCS F;  1T0K B;  1VQM F;  1KC8 H;  1GO1 A;  1YJ9 F;  1CK2 A;  1YJN F;  3O85 A;  2QA4 F;  1RA4 A;  3NVK E;  1Q86 H;  3NK6 A;  3WXM B;  2LBX A;  3NK7 A;  3RA6 A;  5FLX M;  1IPA A;  2QI2 A;  1XBI A;  2I6D A;  3LWR C;  5GIN C;  3VMF B;  3CCR F;  1YIJ F;  1S72 F;  3PLA C;  3VI6 A;  4LCK A;  3N4Z A;  5GAP K;  1VQL F;  1SDS A;  1JJ2 F;  1QVF F;  3NMU C;  3SIU A;  3FFM A;  3CMA F;  3G6E F;  1VQP F;  3CC7 F;  3J80 M;  2ALE A;  1YHQ F;  3HJW C;  2OTL F;  5GAN K;  3CCL F;  2BO1 A;  5G4V C;  1H7M A;  1K9M H;  3N4Y A;  1Q7Y H;  3CCE F;  3JAM M;  5IT9 M;  3G71 F;  2VGM A;  1VQ7 F; 
#chains in the Genus database with same CATH topology
 5EZY A;  3P4E A;  4B46 A;  5LA6 B;  3RYH B;  1K73 H;  1SZQ A;  3JVH A;  3CXC F;  2CSL A;  4C82 A;  4O4I A;  3S02 A;  5GIP C;  1VQK F;  3WGM A;  3VTI C;  1W5E A;  3LWQ C;  2CVL A;  1TVK A;  4BT4 A;  2AIZ P;  5EYP A;  2FC3 A;  3IR9 A;  4ZOL A;  4E6E A;  1W5F A;  4FFB B;  4X3M A;  5DCV A;  3MDO A;  5CA0 A;  3FD6 A;  1H47 A;  3GYQ A;  4O4H B;  1U3P A;  5JH7 B;  3LWV C;  2HRU A;  1VQ6 F;  3C9T A;  3F0E A;  1GZ0 A;  3J81 M;  3LWP C;  2LBT A;  2LBW A;  3D54 A;  4BT3 A;  3JAT A;  2NMU A;  5LXT A;  3M84 A;  5HXZ A;  1Q81 H;  1PF5 A;  2GLZ A;  5BMV A;  3VO8 A;  1W42 A;  2QEX F;  4X3L A;  1VQO F;  1DT9 A;  2RB9 A;  1VK3 A;  3CC2 F;  3BYQ A;  4TV8 B;  1U40 A;  3IEW A;  3CB2 A;  3RYI A;  3CCJ F;  5EZY B;  2CHS A;  3PAF A;  1VQ4 F;  3ESJ A;  4O4I B;  4LNU A;  3HKE A;  3U0O A;  2F9Z C;  1FNK A;  5LYJ A;  5HWE A;  3S0W A;  5HY1 A;  4ZOL B;  1CN7 A;  1PXW A;  3OBW A;  1X52 A;  3T80 A;  5JVD A;  1GO0 A;  1SA0 B;  3KIZ A;  3V4D A;  5GON A;  3I7T A;  3IKE A;  4X1I B;  2RHL A;  4I55 A;  3JAS A;  1ODE A;  4ZHY B;  4TUY A;  3CYP B;  1FSZ A;  1FNJ A;  5ITZ A;  2Q1X A;  3JAT B;  5MN4 A;  2HQS C;  4O4J A;  2H8E A;  2I6D A;  1YIJ F;  1RLU A;  2K1S A;  3ZOP A;  3SIU A;  1IV1 A;  1R1M A;  3WPW A;  1VQP F;  3RYI B;  4C8I A;  1YHQ F;  3CC7 F;  2OTL F;  3JAW A;  5IJ0 B;  2BO1 A;  4FFB A;  3JAM M;  4LNU B;  3P10 A;  3HKE B;  4M8I A;  3C8L A;  3G71 F;  5LYJ B;  1FFX A;  1UI9 A;  5HY0 A;  1YJW F;  2I6R A;  3ZP4 A;  3E20 B;  3WPX A;  1K8A H;  2AIF A;  3VYS C;  3I56 F;  2Z1U A;  2OHW A;  3V7Q A;  3L7Q A;  4ZI7 B;  2R6R 1;  5G4U C;  5GON B;  4I50 A;  2W8B C;  4TV9 A;  3LYB A;  3JCM M;  2B33 A;  1XV2 A;  2VGN A;  3TD3 A;  4DRX A;  3OON A;  3JAS B;  4I55 B;  3AGK A;  4TUY B;  5EB0 A;  4RHA A;  2OTM A;  3K14 A;  5ITZ B;  3KJJ A;  4G4Y A;  1W58 1;  3VCZ A;  2HVY D;  3E1Y A;  5LP6 C;  1VH8 A;  4O4J B;  1TUB B;  4U39 A;  2HX0 A;  1OFU A;  1YI2 F;  1N8R H;  1KNJ A;  5EO3 A;  2PHN A;  2BTU A;  5EIB D;  3LFO A;  2YXZ A;  3WJQ A;  3C9S A;  1YIT F;  3JAW B;  3HKD A;  3WGN A;  3WJP A;  1ZWZ A;  3UT5 A;  4ERH A;  3HKC A;  3CCQ F;  1SA0 A;  4ZHQ A;  4O2B A;  3F0D A;  2HP0 A;  3Q8H A;  3OW2 F;  2FGY A;  1CLI A;  4G4W A;  3QHD A;  1XRG A;  1FFX B;  3I3F A;  4BT6 A;  4O4L A;  5JCO A;  4C8E A;  3CD6 F;  3V7E A;  1X7P A;  4X1I A;  2JNB A;  3CCU F;  2DYY A;  1J7H A;  1UFY A;  1W5B A;  2YYE A;  1VQ8 F;  4I50 B;  4TV9 B;  2WAL A;  2HRY A;  4X1K A;  3CYQ A;  1YGY A;  3C9U A;  4DRX B;  3CPW F;  4X1Y A;  3C9R A;  4O2A A;  4RQO A;  1JFF A;  5HY2 A;  1X7O A;  1W40 A;  1T0K B;  1JD1 A;  1GO1 A;  3WGK A;  2ZOV A;  3IEQ A;  1CK2 A;  3HKB A;  4BT5 A;  3O85 A;  5IJ0 A;  5JQG B;  3NVK E;  4BVQ A;  3NK6 A;  1KNK A;  3WXM B;  3NK7 A;  4YJ3 A;  3RA6 A;  3VOA A;  1VHA A;  3K12 A;  3DDN A;  1XBI A;  4BVS A;  4WBN A;  3M1X A;  3HKD B;  5J2T A;  5GIN C;  2Q1Y A;  3F0G A;  2V9Y A;  3R0P A;  4HNA A;  3UT5 B;  3N4Z A;  1W5A A;  3HKC B;  1JJ2 F;  1SDS A;  3FPI A;  2N48 A;  3FFM A;  4O2B B;  2ZAU A;  4ZHQ B;  2HP0 B;  3G6E F;  3S03 A;  3HJW C;  2ALE A;  2CW4 A;  4ZI7 A;  2G9I A;  4O4L B;  5G4V C;  2CHT A;  3JAL A;  1K9M H;  3ERN A;  1IV3 A;  1COM A;  1IV4 A;  2VGM A;  1VQ7 F;  3F0F A;  5EB1 B;  2IG8 A;  3B6N A;  3M4S A;  3ZO8 A;  1H48 A;  2KTU A;  2HS4 A;  1U43 A;  4X1K B;  4BVT A;  4ZHW A;  1W3E X;  1TUB A;  1NMU B;  2BTQ B;  1JN1 A;  4X1Y B;  4G4X A;  4O2A B;  1JFF B;  2IQQ A;  5EAZ A;  3RA5 A;  3D00 A;  2Z1F A;  3HKB B;  2L26 A;  1M90 H;  2CZW A;  1OAP A;  3FD5 A;  3SIV A;  2UYP A;  2ZVY A;  4U3J A;  5EWR A;  3TD5 A;  5A2Q M;  3ZP7 A;  1VQN F;  2DT4 A;  3CME F;  3JAK A;  4YJ3 B;  4EI8 A;  4WBN B;  4XCQ A;  2RHJ A;  4NUT A;  5J2T B;  3CCM F;  2P6Y A;  3QUW A;  4F6R B;  1NQ3 A;  4HNA B;  3HTN A;  1RLG A;  5FNV A;  2RHH A;  5LP6 B;  2H8C A;  3EOR A;  1W59 A;  1W41 A;  4I4T A;  3G4S F;  4B45 A;  3CC4 F;  5EIB C;  3VOB A;  2HS0 A;  2Z1T A;  3JAL B;  5C8Y A;  2PMP A;  2UYK A;  2UYN A;  1QAH A;  3KJK A;  3CPQ A;  1KQS F;  4R40 B;  3WGJ A;  2HS3 A;  3J7A R;  1Q82 H;  2EWC A;  3E22 A;  3CG6 A;  4EI9 A;  2MQE A;  1QU9 A;  5JQG A;  2H6L A;  3S0H A;  2QTP A;  5CA1 A;  3ELC A;  5CB4 B;  3FBA A;  3MBM A;  2OTJ F;  4U3J B;  2ZF8 A;  3JAK B;  4G4V A;  1VQM F;  1YJ9 F;  5J2U A;  2VXY A;  4NQ3 A;  5IYZ A;  1YJN F;  1X25 A;  2AMT A;  5MN6 A;  3S06 A;  2VAM A;  2QA4 F;  1RA4 A;  3MCQ A;  5FNV B;  2LBX A;  5FLX M;  1W57 A;  4I4T B;  3DC2 A;  3VYU C;  3GTZ A;  3LWR C;  1XHO A;  3HWU A;  1S72 F;  3VI6 A;  5C8Y B;  3RE3 A;  1VQL F;  4IIJ A;  3F6M A;  3LDT A;  3NMU C;  2UYN B;  3KE1 A;  5KX5 B;  4B5C A;  5GAN K;  3KHN A;  5HP7 A;  5IT9 M;  3E22 B;  4IHJ A;  3VYT C;  5B8F A;  4DXD A;  2GZL A;  5IJ9 A;  3RYF A;  5CA1 B;  2ZVZ A;  1NJI H;  3K0T A;  5LOV B;  4F6R A;  2OZB A;  4ZK7 A;  3ON1 A;  1W2B F;  3N2K A;  3I55 F;  4G4Z A;  5LP6 A;  2IAF A;  4ZHV A;  1U3L A;  2BTO A;  5J2U B;  1E7K A;  5IYZ B;  5GIO C;  3IMP A;  1VQV A;  4YJ2 A;  3LME A;  1IV2 A;  4BT7 A;  2VAW A;  2UZH A;  3HAX D;  3N2G A;  3OBY A;  4X20 A;  3WGL A;  3K2X A;  1Q8R A;  3CCV F;  2UYJ A;  1TVK B;  3MCA B;  5EYP B;  2CWJ A;  4IIJ B;  2VAP A;  3LWO C;  4BY9 D;  2R75 1;  4EB6 A;  5CA0 B;  4G88 A;  4BW0 B;  5KMG A;  5CB4 A;  5HY4 A;  3IKF A;  2KGW A;  4IHJ B;  1VQ5 F;  5HP8 A;  5FJ4 C;  5IJ9 B;  3RYC A;  2KTV A;  1M1K H;  1VQ9 F;  1RQ7 A;  3RYF B;  3WJR A;  4TZZ A;  3JAR A;  3VIU A;  5LXT B;  4C4W C;  2Z01 A;  2LCA A;  4NWO B;  5BMV B;  3P0Z A;  1QVG F;  1DBF A;  3N2K B;  3QTY A;  5LA6 A;  3RYH A;  5JCO C;  1KD1 H;  3MQW A;  1T0A A;  2KG4 A;  5AVM A;  4C81 A;  3NVI B;  3CCS F;  4YJ2 B;  1KC8 H;  5KX5 A;  3TD4 A;  3D01 A;  3N2G B;  4X20 B;  4PWT A;  5HXU A;  4C8G A;  1GX1 A;  1Q86 H;  4O4H A;  5JH7 A;  1Z5W A;  4EB6 B;  1IPA A;  5JVD B;  2QI2 A;  1ONI A;  1RQ2 A;  3S0Y A;  4BT2 A;  3VMF B;  4BVR A;  3CCR F;  1W55 A;  1Z5V A;  3PLA C;  1YQN A;  2Z1E A;  4LCK A;  2GVI A;  5KMG B;  5GAP K;  1QVF F;  2HP3 A;  4EI7 A;  4KWE A;  3CMA F;  1JY8 A;  5LOV A;  3J80 M;  5MN5 A;  3CCL F;  3RYC B;  1QD9 A;  3JAR B;  4B62 A;  1H7M A;  3V3T A;  3N4Y A;  1Q7Y H;  3GHZ A;  3CCE F;  2ZOD A;  2RHO A;  4TV8 A; 
#chains in the Genus database with same CATH homology
 5HY0 A;  1K73 H;  2KTU A;  1YJW F;  4BVT A;  1NJI H;  3CXC F;  3E20 B;  1W3E X;  5GIP C;  1K8A H;  1NMU B;  3LWQ C;  2AIF A;  1VQK F;  3I56 F;  2OHW A;  3V7Q A;  2OZB A;  3ON1 A;  3RA5 A;  1W2B F;  5G4U C;  2FC3 A;  3I55 F;  3IR9 A;  3JCM M;  3D00 A;  4X3M A;  5DCV A;  1E7K A;  1M90 H;  2VGN A;  2CZW A;  5GIO C;  3SIV A;  3AGK A;  5A2Q M;  5EWR A;  3GYQ A;  1VQN F;  3LWV C;  3CME F;  2HVY D;  3E1Y A;  4EI8 A;  3HAX D;  1VQ6 F;  3OBY A;  4XCQ A;  1GZ0 A;  3J81 M;  4NUT A;  3LWP C;  3CCM F;  3CCV F;  1YI2 F;  1N8R H;  2LBW A;  5EO3 A;  3MCA B;  1RLG A;  3LWO C;  3LFO A;  4BY9 D;  5HXZ A;  1W41 A;  3G4S F;  1Q81 H;  2GLZ A;  1YIT F;  3CC4 F;  4BW0 B;  1W42 A;  1ZWZ A;  2QEX F;  4X3L A;  1VQO F;  5HY4 A;  1DT9 A;  3CCQ F;  3CC2 F;  3CPQ A;  3OW2 F;  1VQ5 F;  3CCJ F;  2FGY A;  5FJ4 C;  2KTV A;  1M1K H;  1KQS F;  1VQ9 F;  4TZZ A;  3J7A R;  3PAF A;  3CD6 F;  1Q82 H;  1VQ4 F;  3V7E A;  1X7P A;  4C4W C;  3CG6 A;  4EI9 A;  2F9Z C;  2JNB A;  3CCU F;  5HWE A;  1QVG F;  1VQ8 F;  5HY1 A;  2WAL A;  1CN7 A;  1PXW A;  3OBW A;  1X52 A;  1KD1 H;  1GO0 A;  2KG4 A;  3CPW F;  2OTJ F;  5HY2 A;  3NVI B;  1X7O A;  1W40 A;  3CCS F;  1T0K B;  1VQM F;  1KC8 H;  1GO1 A;  1YJ9 F;  4NQ3 A;  1CK2 A;  1YJN F;  5HXU A;  3O85 A;  2QA4 F;  1RA4 A;  3NVK E;  4BVQ A;  1Q86 H;  3NK6 A;  3WXM B;  2LBX A;  3NK7 A;  3RA6 A;  5FLX M;  1IPA A;  2QI2 A;  1XBI A;  4BVS A;  2I6D A;  3LWR C;  5GIN C;  3VMF B;  4BVR A;  3CCR F;  1YIJ F;  1S72 F;  3PLA C;  3VI6 A;  4LCK A;  3N4Z A;  5GAP K;  1VQL F;  1SDS A;  1JJ2 F;  1QVF F;  3NMU C;  4EI7 A;  3SIU A;  3FFM A;  3CMA F;  3G6E F;  1VQP F;  3CC7 F;  3J80 M;  2ALE A;  1YHQ F;  3HJW C;  2OTL F;  5GAN K;  3CCL F;  2BO1 A;  5G4V C;  1H7M A;  3V3T A;  3N4Y A;  1Q7Y H;  1K9M H;  3CCE F;  3JAM M;  5IT9 M;  3G71 F;  2VGM A;  1VQ7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...