1VQLF

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqlF00
4X3MA 5FLXM 5GIPC 1RA4A 3CCJF 1H7MA 3MCAB 2OTLF 2KTUA 3LWPC 1VQ8F 3AGKA 3J7AR 1XBIA 1VQNF 2FC3A 2VGNA 4LCKA 2KG4A 3NVIB 1KC8H 2CZWA 3CCRF 3JAMM 1Q7YH 1QVFF 1VQOF 1KQSF 3CG6A 1RLGA 1W41A 1T0KB 3I56F 3IR9A 3SIUA 3CCMF 1M1KH 1YJ9F 1W40A 3LWQC 5G4VC 1W3EX 1YJWF 3VI6A 3CXCF 3G6EF 3CCVF 3LFOA 2OTJF 3G4SF 2OHWA 1GZ0A 1DT9A 2QI2A 3CC7F 2WALA 3CCEF 3CC4F 1JJ2F 1YIJF 2BO1A 1W42A 1Q82H 3LWVC 3PLAC 1VQ6F 1X7PA 4BW0B 4NUTA 3OW2F 1YITF 2OZBA 3NK7A 3CMEF 3LWRC 5GANK 1PXWA 3ON1A 3NVKE 3NK6A 1VQ7F 2QEXF 1K9MH 5GINC 1YHQF 3N4ZA 5A2QM 3J80M 1YI2F 2JNBA 3WXMB 1W2BF 1S72F 5DCVA 3GYQA 1Q81H 1VQMF 3LWOC 1VQLF 5GIOC 3OBYA 5FJ4C 1IPAA 3CCUF 3HAXD 4BY9D 1VQPF 2I6DA 2VGMA 3RA5A 2KTVA 2LBWA 2AIFA 3VMFB 1X52A 1VQKF 3CCLF 2LBXA 1NJIH 2QA4F 3CC2F 3CMAF 4TZZA 1X7OA 1E7KA 5GAPK 1VQ9F 5EWRA 2ALEA 3G71F 1Q86H 3O85A 3RA6A 3E1YA 1VQ5F 3CCSF 3E20B 1CK2A 3I55F 3CD6F 3NMUC 3SIVA 1QVGF 1YJNF 3V7QA 3OBWA 1VQ4F 3V7EA 1K8AH 1GO1A 3CPWF 3JCMM 1GO0A 4X3LA 5G4UC 5EO3A 4C4WC 3J81M 3CCQF 3N4YA 1ZWZA 3CPQA 3HJWC 1KD1H 2HVYD 1N8RH 1K73H 1SDSA 5IT9M 1M90H 3PAFA 1CN7A 1NMUB 3FFMA
chains in the Genus database with same CATH superfamily
5KX5B 4YJ3B 4G4VA 3LDTA 1PF5A 2UYJA 3I7TA 1H7MA 5KMGA 1U3LA 1VQ8F 3K0TA 3P10A 1XBIA 3J7AR 5HXUA 4BT7A 4ERHA 4LCKA 5JQGA 1OAPA 3CCRF 1Q7YH 3RYIA 3KJKA 4O4LB 4G4XA 3JAWB 4ZI7B 3I56F 3SIUA 2HS4A 4BT2A 1M1KH 3GTZA 4ZHVA 4O2AB 5LA6A 3JATB 3VI6A 4BVQA 3CXCF 5MN4A 5LYJA 2OHWA 3K2XA 4B62A 4EI8A 1YIJF 1W59A 1W5BA 3LWVC 2H8CA 4C82A 1YITF 2OZBA 3CMEF 2ZF8A 4X1YA 1PXWA 3NVKE 3RYFA 3NK6A 1RLUA 3WGMA 5A2QM 2HP0A 4BVTA 5KMGB 2BTOA 2CHSA 3FPIA 3GYQA 1Q81H 1Z5VA 3S0HA 5JQGB 3HKBB 2ZVYA 3OBYA 5J2TA 3B6NA 2UYNA 5LOVA 3RYIB 2I6DA 2YYEA 2KTVA 2AIFA 3VMFB 4G88A 3CCLF 2LBXA 3QHDA 1U43A 3EORA 4ZHYB 1NJIH 3N2GA 3CYPB 2VXYA 5LA6B 5GAPK 3G71F 1Q86H 3O85A 3KIZA 5LYJB 1ODEA 3E1YA 3E20B 1CK2A 3C9TA 3CD6F 3LMEA 4B5CA 4DRXA 1K8AH 3S0YA 1GO1A 3CPWF 2RB9A 3VOAA 4I4TA 3JCMM 3M1XA 2OTMA 3C8LA 1GO0A 1IV1A 1RQ2A 1U3PA 3WPWA 2R751 4C4WC 3VTIC 4X1YB 3HKDA 1ZWZA 3CPQA 3RYFB 1T0AA 4RQOA 2PMPA 1XV2A 1X25A 2HP0B 1K73H 2Z1TA 5CB4A 1M90H 2UYKA 1NMUB 5FLXM 5IJ9A 5GIPC 3QTYA 1RA4A 5J2TB 2W8BC 2ZODA 3K14A 2UYNB 5LOVB 5LXTA 4EI7A 3VCZA 4X1KA 3AGKA 2FC3A 3HTNA 2VGNA 3IEWA 1JY8A 3M4SA 3NVIB 1KC8H 2CZWA 3VOBA 3JAMM 3N2GB 5JVDA 5FNVA 1VQOF 1KQSF 3MDOA 4HNAA 5EB1B 4DRXB 3IR9A 3CCMF 3VO8A 3LWQC 3K12A 1W3EX 3N2KA 1YJWF 4I4TB 3G6EF 3F0FA 4ZOLB 5EZYA 3CCVF 3G4SF 1GZ0A 1DT9A 3TD3A 3FD5A 3P0ZA 2WALA 3HKDB 3CCEF 3CC4F 1JJ2F 3Q8HA 4NQ3A 1W42A 3WJQA 2ZOVA 3HKBA 1Q82H 1VQ6F 3PLAC 4LNUA 2GLZA 3VYUC 5CB4B 3WJPA 3WPXA 3LWRC 5IJ9B 1VQ7F 5GINC 1YHQF 3N4ZA 2CSLA 5LXTB 2DT4A 3WXMB 1S72F 4X1KB 2G9IA 5DCVA 4O4JA 1VQMF 4E6EA 3LWOC 3JASA 5EIBC 5JVDB 3HAXD 5FNVB 1UFYA 3RA5A 3DDNA 3CB2A 2Z1FA 1VQKF 4HNAB 3F0GA 5JH7A 5GONA 2MQEA 3BYQA 1W55A 3CC2F 1FNJA 3N2KB 4I55A 3RE3A 3E22A 5EZYB 3KE1A 3NMUC 1VH8A 3V7QA 1JD1A 5J2UA 3HKEA 1JN1A 2CW4A 4LNUB 1R1MA 4X3LA 5EO3A 2L26A 5CA0A 3HJWC 3D00A 5HXZA 3WGJA 1N8RH 4U39A 5IT9M 4U3JA 1ONIA 4G4WA 3PAFA 2KGWA 4ZHQA 1CN7A 3FFMA 4O4JB 4I50A 3TD5A 5EIBD 2R6R1 3L7QA 5HWEA 3CCJF 2YXZA 1U40A 3JASB 3JALA 2OTLF 2KTUA 3LWPC 4TV9A 5EYPA 2FGYA 2UYPA 4ZOLA 2ZAUA 5JH7B 5GONB 2NMUA 1QVFF 1W5FA 4ZK7A 3V4DA 4I55B 1KNKA 3CG6A 3E22B 3JAKA 2BTUA 5AVMA 4RHAA 5J2UB 1NQ3A 1W40A 3HKEB 4PWTA 2B33A 2Z1EA 2P6YA 3M84A 3ZOPA 1GX1A 3WGNA 2RHLA 3LFOA 3FD6A 1W581 2QI2A 1SA0A 1Z5WA 3S06A 3RYHA 5CA0B 1KNJA 1TVKA 1W5EA 3WGLA 4TUYA 2RHJA 4WBNA 4R40B 3F0EA 5IJ0A 4BW0B 4U3JB 4YJ2A 4NUTA 1JFFB 2PHNA 3U0OA 4ZHQB 2Q1XA 2CVLA 3ON1A 4G4YA 4I50B 3HKCA 2QEXF 3MQWA 2QTPA 3KJJA 3D01A 3J80M 2CWJA 4C8GA 5BMVA 2I6RA 2JNBA 3JALB 1IV3A 4TV9B 2IQQA 2H8EA 4O4IA 5EYPB 3R0PA 5LP6A 1VQLF 5GIOC 5FJ4C 1FNKA 1W5AA 3CCUF 5HP8A 4BY9D 2VGMA 2LBWA 3D54A 2HRYA 5EB0A 1CLIA 4TV8A 3JAKB 3CYQA 3T80A 4EB6B 1XHOA 4DXDA 3IKEA 3I3FA 1W57A 1QD9A 5CA1B 1E7KA 5EWRA 2ALEA 5HY1A 1H47A 3RA6A 2HX0A 3CCSF 3I55F 5JCOA 3OBWA 1VQ4F 1SA0B 3RYHB 4FFBA 4EI9A 1TVKB 3V3TA 3KHNA 3IKFA 3ERNA 1YGYA 3IMPA 4IIJA 4TUYB 4WBNB 3S03A 5IJ0B 4YJ2B 1VHAA 3J81M 3CCQF 3N4YA 3C9UA 3VYTC 5HY2A 3HKCB 1KD1H 3RYCA 3QUWA 2F9ZC 1FFXA 5BMVB 2HVYD 5MN6A 3GHZA 1UI9A 4O4IB 3P4EA 5ITZA 4X3MA 3VIUA 4C8EA 5LP6B 5HP7A 3WJRA 4X1IA 2Z01A 1DBFA 3MCAB 3C9RA 3UT5A 4BT4A 4O4HA 1VQNF 1IV4A 4O2BB 4TV8B 2KG4A 2Q1YA 1Q8RA 1VQVA 5C8YA 4BT6A 3VYSC 2AMTA 3S0WA 3ELCA 3S02A 1RLGA 1W41A 1T0KB 5IYZA 1H48A 1JFFA 3HWUA 1YJ9F 4FFBB 1XRGA 1J7HA 5G4VC 3JVHA 4BT5A 2V9YA 4IIJB 2LCAA 2OTJF 1IV2A 2GVIA 5HY4A 3CC7F 3JARA 3MCQA 3RYCB 2BO1A 2BTQB 2IG8A 3OONA 1FFXB 1X7PA 2K1SA 3OW2F 4IHJA 3ZP7A 3NK7A 2HRUA 1FSZA 3ESJA 5GANK 5LP6C 5ITZB 1K9MH 2VAMA 4F6RA 1YI2F 4X1IB 1TUBA 3IEQA 3ZO8A 3DC2A 2CHTA 4EB6A 5HY0A 1W2BF 3FBAA 4X20A 3TD4A 3UT5B 4BT3A 1QU9A 4BVSA 5CA1A 4O4HB 3LYBA 5KX5A 2UZHA 4YJ3A 1SZQA 2HS3A 5MN5A 1IPAA 2N48A 5C8YB 1VQPF 3C9SA 2DYYA 2RHOA 1X52A 3MBMA 5IYZB 1OFUA 2HS0A 2RHHA 3ZP4A 5JCOC 2Z1UA 4G4ZA 2QA4F 1COMA 3CMAF 4M8IA 4TZZA 1X7OA 4O4LA 1VQ9F 3JAWA 4ZI7A 4XCQA 4BVRA 1VQ5F 3SIVA 1QVGF 1YJNF 3V7EA 3JARB 4ZHWA 2HP3A 4O2AA 3JATA 2LBTA 5B8FA 4C8IA 2HQSC 4B45A 4C81A 5G4UC 4IHJB 2GZLA 4B46A 1QAHA 2IAFA 2VAWA 3F0DA 4NWOB 3F6MA 4O2BA 1YQNA 4F6RB 2EWCA 1TUBB 2VAPA 5EAZA 1SDSA 1RQ7A 3WGKA 2ZVZA 1VK3A 2H6LA 4KWEA 4X20B 2AIZP
chains in the Genus database with same CATH topology
4X3MA 5FLXM 5GIPC 1RA4A 5HWEA 3CCJF 1H7MA 3MCAB 4EI7A 2OTLF 2KTUA 3LWPC 1VQ8F 3AGKA 3J7AR 1XBIA 5HXUA 1VQNF 2FGYA 2FC3A 2VGNA 4LCKA 2KG4A 3NVIB 1KC8H 2CZWA 3CCRF 3JAMM 1Q7YH 1QVFF 1VQOF 1KQSF 3CG6A 1RLGA 1W41A 1T0KB 3I56F 3IR9A 3SIUA 3CCMF 1M1KH 1YJ9F 1W40A 3LWQC 5G4VC 1W3EX 1YJWF 4BVQA 3VI6A 3CXCF 3G6EF 3CCVF 3LFOA 2OTJF 3G4SF 2OHWA 1GZ0A 1DT9A 5HY4A 2QI2A 3CC7F 2WALA 3CCEF 3CC4F 1JJ2F 4EI8A 1YIJF 2BO1A 1W42A 4NQ3A 1Q82H 3LWVC 3PLAC 1VQ6F 2GLZA 1X7PA 4BW0B 4NUTA 3OW2F 1YITF 2OZBA 3NK7A 3CMEF 3LWRC 5GANK 1PXWA 3ON1A 3NVKE 3NK6A 1VQ7F 2QEXF 1K9MH 5GINC 1YHQF 3N4ZA 5A2QM 3J80M 1YI2F 4BVTA 2JNBA 5HY0A 3WXMB 1W2BF 1S72F 4BVSA 5DCVA 3GYQA 1Q81H 1VQMF 3LWOC 1VQLF 5GIOC 3OBYA 5FJ4C 1IPAA 3CCUF 3HAXD 4BY9D 1VQPF 2I6DA 2VGMA 3RA5A 2KTVA 2LBWA 2AIFA 3VMFB 1X52A 1VQKF 3CCLF 2LBXA 1NJIH 2QA4F 3CC2F 3CMAF 4TZZA 1X7OA 1E7KA 5GAPK 1VQ9F 5EWRA 2ALEA 3G71F 1Q86H 5HY1A 3O85A 4XCQA 3E1YA 3RA6A 4BVRA 3E20B 1CK2A 3I55F 3CCSF 1VQ5F 3CD6F 3NMUC 1QVGF 1YJNF 3SIVA 3V7QA 3OBWA 1VQ4F 3V7EA 1K8AH 4EI9A 1GO1A 3CPWF 3JCMM 3V3TA 1GO0A 4X3LA 5G4UC 5EO3A 4C4WC 3J81M 3CCQF 3N4YA 1ZWZA 3CPQA 5HY2A 3HJWC 3D00A 1KD1H 5HXZA 2F9ZC 2HVYD 1N8RH 1K73H 1SDSA 5IT9M 1M90H 3PAFA 1CN7A 1NMUB 3FFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  5FLX M;  5GIP C;  1RA4 A;  3CCJ F;  1H7M A;  3MCA B;  2OTL F;  2KTU A;  3LWP C;  1VQ8 F;  3AGK A;  3J7A R;  1XBI A;  1VQN F;  2FC3 A;  2VGN A;  4LCK A;  2KG4 A;  3NVI B;  1KC8 H;  2CZW A;  3CCR F;  3JAM M;  1Q7Y H;  1QVF F;  1VQO F;  1KQS F;  3CG6 A;  1RLG A;  1W41 A;  1T0K B;  3I56 F;  3IR9 A;  3SIU A;  3CCM F;  1M1K H;  1YJ9 F;  1W40 A;  3LWQ C;  5G4V C;  1W3E X;  1YJW F;  3VI6 A;  3CXC F;  3G6E F;  3CCV F;  3LFO A;  2OTJ F;  3G4S F;  2OHW A;  1GZ0 A;  1DT9 A;  2QI2 A;  3CC7 F;  2WAL A;  3CCE F;  3CC4 F;  1JJ2 F;  1YIJ F;  2BO1 A;  1W42 A;  1Q82 H;  3LWV C;  3PLA C;  1VQ6 F;  1X7P A;  4BW0 B;  4NUT A;  3OW2 F;  1YIT F;  2OZB A;  3NK7 A;  3CME F;  3LWR C;  5GAN K;  1PXW A;  3ON1 A;  3NVK E;  3NK6 A;  1VQ7 F;  2QEX F;  1K9M H;  5GIN C;  1YHQ F;  3N4Z A;  5A2Q M;  3J80 M;  1YI2 F;  2JNB A;  3WXM B;  1W2B F;  1S72 F;  5DCV A;  3GYQ A;  1Q81 H;  1VQM F;  3LWO C;  1VQL F;  5GIO C;  3OBY A;  5FJ4 C;  1IPA A;  3CCU F;  3HAX D;  4BY9 D;  1VQP F;  2I6D A;  2VGM A;  3RA5 A;  2KTV A;  2LBW A;  2AIF A;  3VMF B;  1X52 A;  1VQK F;  3CCL F;  2LBX A;  1NJI H;  2QA4 F;  3CC2 F;  3CMA F;  4TZZ A;  1X7O A;  1E7K A;  5GAP K;  1VQ9 F;  5EWR A;  2ALE A;  3G71 F;  1Q86 H;  3O85 A;  3RA6 A;  3E1Y A;  1VQ5 F;  3CCS F;  3E20 B;  1CK2 A;  3I55 F;  3CD6 F;  3NMU C;  3SIV A;  1QVG F;  1YJN F;  3V7Q A;  3OBW A;  1VQ4 F;  3V7E A;  1K8A H;  1GO1 A;  3CPW F;  3JCM M;  1GO0 A;  4X3L A;  5G4U C;  5EO3 A;  4C4W C;  3J81 M;  3CCQ F;  3N4Y A;  1ZWZ A;  3CPQ A;  3HJW C;  1KD1 H;  2HVY D;  1N8R H;  1K73 H;  1SDS A;  5IT9 M;  1M90 H;  3PAF A;  1CN7 A;  1NMU B;  3FFM A; 
#chains in the Genus database with same CATH topology
 5KX5 B;  4YJ3 B;  4G4V A;  3LDT A;  1PF5 A;  2UYJ A;  3I7T A;  1H7M A;  5KMG A;  1U3L A;  1VQ8 F;  3K0T A;  3P10 A;  1XBI A;  3J7A R;  5HXU A;  4BT7 A;  4ERH A;  4LCK A;  5JQG A;  1OAP A;  3CCR F;  1Q7Y H;  3RYI A;  3KJK A;  4O4L B;  4G4X A;  3JAW B;  4ZI7 B;  3I56 F;  3SIU A;  2HS4 A;  4BT2 A;  1M1K H;  3GTZ A;  4ZHV A;  4O2A B;  5LA6 A;  3JAT B;  3VI6 A;  4BVQ A;  3CXC F;  5MN4 A;  5LYJ A;  2OHW A;  3K2X A;  4B62 A;  4EI8 A;  1YIJ F;  1W59 A;  1W5B A;  3LWV C;  2H8C A;  4C82 A;  1YIT F;  2OZB A;  3CME F;  2ZF8 A;  4X1Y A;  1PXW A;  3NVK E;  3RYF A;  3NK6 A;  1RLU A;  3WGM A;  5A2Q M;  2HP0 A;  4BVT A;  5KMG B;  2BTO A;  2CHS A;  3FPI A;  3GYQ A;  1Q81 H;  1Z5V A;  3S0H A;  5JQG B;  3HKB B;  2ZVY A;  3OBY A;  5J2T A;  3B6N A;  2UYN A;  5LOV A;  3RYI B;  2I6D A;  2YYE A;  2KTV A;  2AIF A;  3VMF B;  4G88 A;  3CCL F;  2LBX A;  3QHD A;  1U43 A;  3EOR A;  4ZHY B;  1NJI H;  3N2G A;  3CYP B;  2VXY A;  5LA6 B;  5GAP K;  3G71 F;  1Q86 H;  3O85 A;  3KIZ A;  5LYJ B;  1ODE A;  3E1Y A;  3E20 B;  1CK2 A;  3C9T A;  3CD6 F;  3LME A;  4B5C A;  4DRX A;  1K8A H;  3S0Y A;  1GO1 A;  3CPW F;  2RB9 A;  3VOA A;  4I4T A;  3JCM M;  3M1X A;  2OTM A;  3C8L A;  1GO0 A;  1IV1 A;  1RQ2 A;  1U3P A;  3WPW A;  2R75 1;  4C4W C;  3VTI C;  4X1Y B;  3HKD A;  1ZWZ A;  3CPQ A;  3RYF B;  1T0A A;  4RQO A;  2PMP A;  1XV2 A;  1X25 A;  2HP0 B;  1K73 H;  2Z1T A;  5CB4 A;  1M90 H;  2UYK A;  1NMU B;  5FLX M;  5IJ9 A;  5GIP C;  3QTY A;  1RA4 A;  5J2T B;  2W8B C;  2ZOD A;  3K14 A;  2UYN B;  5LOV B;  5LXT A;  4EI7 A;  3VCZ A;  4X1K A;  3AGK A;  2FC3 A;  3HTN A;  2VGN A;  3IEW A;  1JY8 A;  3M4S A;  3NVI B;  1KC8 H;  2CZW A;  3VOB A;  3JAM M;  3N2G B;  5JVD A;  5FNV A;  1VQO F;  1KQS F;  3MDO A;  4HNA A;  5EB1 B;  4DRX B;  3IR9 A;  3CCM F;  3VO8 A;  3LWQ C;  3K12 A;  1W3E X;  3N2K A;  1YJW F;  4I4T B;  3G6E F;  3F0F A;  4ZOL B;  5EZY A;  3CCV F;  3G4S F;  1GZ0 A;  1DT9 A;  3TD3 A;  3FD5 A;  3P0Z A;  2WAL A;  3HKD B;  3CCE F;  3CC4 F;  1JJ2 F;  3Q8H A;  4NQ3 A;  1W42 A;  3WJQ A;  2ZOV A;  3HKB A;  1Q82 H;  1VQ6 F;  3PLA C;  4LNU A;  2GLZ A;  3VYU C;  5CB4 B;  3WJP A;  3WPX A;  3LWR C;  5IJ9 B;  1VQ7 F;  5GIN C;  1YHQ F;  3N4Z A;  2CSL A;  5LXT B;  2DT4 A;  3WXM B;  1S72 F;  4X1K B;  2G9I A;  5DCV A;  4O4J A;  1VQM F;  4E6E A;  3LWO C;  3JAS A;  5EIB C;  5JVD B;  3HAX D;  5FNV B;  1UFY A;  3RA5 A;  3DDN A;  3CB2 A;  2Z1F A;  1VQK F;  4HNA B;  3F0G A;  5JH7 A;  5GON A;  2MQE A;  3BYQ A;  1W55 A;  3CC2 F;  1FNJ A;  3N2K B;  4I55 A;  3RE3 A;  3E22 A;  5EZY B;  3KE1 A;  3NMU C;  1VH8 A;  3V7Q A;  1JD1 A;  5J2U A;  3HKE A;  1JN1 A;  2CW4 A;  4LNU B;  1R1M A;  4X3L A;  5EO3 A;  2L26 A;  5CA0 A;  3HJW C;  3D00 A;  5HXZ A;  3WGJ A;  1N8R H;  4U39 A;  5IT9 M;  4U3J A;  1ONI A;  4G4W A;  3PAF A;  2KGW A;  4ZHQ A;  1CN7 A;  3FFM A;  4O4J B;  4I50 A;  3TD5 A;  5EIB D;  2R6R 1;  3L7Q A;  5HWE A;  3CCJ F;  2YXZ A;  1U40 A;  3JAS B;  3JAL A;  2OTL F;  2KTU A;  3LWP C;  4TV9 A;  5EYP A;  2FGY A;  2UYP A;  4ZOL A;  2ZAU A;  5JH7 B;  5GON B;  2NMU A;  1QVF F;  1W5F A;  4ZK7 A;  3V4D A;  4I55 B;  1KNK A;  3CG6 A;  3E22 B;  3JAK A;  2BTU A;  5AVM A;  4RHA A;  5J2U B;  1NQ3 A;  1W40 A;  3HKE B;  4PWT A;  2B33 A;  2Z1E A;  2P6Y A;  3M84 A;  3ZOP A;  1GX1 A;  3WGN A;  2RHL A;  3LFO A;  3FD6 A;  1W58 1;  2QI2 A;  1SA0 A;  1Z5W A;  3S06 A;  3RYH A;  5CA0 B;  1KNJ A;  1TVK A;  1W5E A;  3WGL A;  4TUY A;  2RHJ A;  4WBN A;  4R40 B;  3F0E A;  5IJ0 A;  4BW0 B;  4U3J B;  4YJ2 A;  4NUT A;  1JFF B;  2PHN A;  3U0O A;  4ZHQ B;  2Q1X A;  2CVL A;  3ON1 A;  4G4Y A;  4I50 B;  3HKC A;  2QEX F;  3MQW A;  2QTP A;  3KJJ A;  3D01 A;  3J80 M;  2CWJ A;  4C8G A;  5BMV A;  2I6R A;  2JNB A;  3JAL B;  1IV3 A;  4TV9 B;  2IQQ A;  2H8E A;  4O4I A;  5EYP B;  3R0P A;  5LP6 A;  1VQL F;  5GIO C;  5FJ4 C;  1FNK A;  1W5A A;  3CCU F;  5HP8 A;  4BY9 D;  2VGM A;  2LBW A;  3D54 A;  2HRY A;  5EB0 A;  1CLI A;  4TV8 A;  3JAK B;  3CYQ A;  3T80 A;  4EB6 B;  1XHO A;  4DXD A;  3IKE A;  3I3F A;  1W57 A;  1QD9 A;  5CA1 B;  1E7K A;  5EWR A;  2ALE A;  5HY1 A;  1H47 A;  3RA6 A;  2HX0 A;  3CCS F;  3I55 F;  5JCO A;  3OBW A;  1VQ4 F;  1SA0 B;  3RYH B;  4FFB A;  4EI9 A;  1TVK B;  3V3T A;  3KHN A;  3IKF A;  3ERN A;  1YGY A;  3IMP A;  4IIJ A;  4TUY B;  4WBN B;  3S03 A;  5IJ0 B;  4YJ2 B;  1VHA A;  3J81 M;  3CCQ F;  3N4Y A;  3C9U A;  3VYT C;  5HY2 A;  3HKC B;  1KD1 H;  3RYC A;  3QUW A;  2F9Z C;  1FFX A;  5BMV B;  2HVY D;  5MN6 A;  3GHZ A;  1UI9 A;  4O4I B;  3P4E A;  5ITZ A;  4X3M A;  3VIU A;  4C8E A;  5LP6 B;  5HP7 A;  3WJR A;  4X1I A;  2Z01 A;  1DBF A;  3MCA B;  3C9R A;  3UT5 A;  4BT4 A;  4O4H A;  1VQN F;  1IV4 A;  4O2B B;  4TV8 B;  2KG4 A;  2Q1Y A;  1Q8R A;  1VQV A;  5C8Y A;  4BT6 A;  3VYS C;  2AMT A;  3S0W A;  3ELC A;  3S02 A;  1RLG A;  1W41 A;  1T0K B;  5IYZ A;  1H48 A;  1JFF A;  3HWU A;  1YJ9 F;  4FFB B;  1XRG A;  1J7H A;  5G4V C;  3JVH A;  4BT5 A;  2V9Y A;  4IIJ B;  2LCA A;  2OTJ F;  1IV2 A;  2GVI A;  5HY4 A;  3CC7 F;  3JAR A;  3MCQ A;  3RYC B;  2BO1 A;  2BTQ B;  2IG8 A;  3OON A;  1FFX B;  1X7P A;  2K1S A;  3OW2 F;  4IHJ A;  3ZP7 A;  3NK7 A;  2HRU A;  1FSZ A;  3ESJ A;  5GAN K;  5LP6 C;  5ITZ B;  1K9M H;  2VAM A;  4F6R A;  1YI2 F;  4X1I B;  1TUB A;  3IEQ A;  3ZO8 A;  3DC2 A;  2CHT A;  4EB6 A;  5HY0 A;  1W2B F;  3FBA A;  4X20 A;  3TD4 A;  3UT5 B;  4BT3 A;  1QU9 A;  4BVS A;  5CA1 A;  4O4H B;  3LYB A;  5KX5 A;  2UZH A;  4YJ3 A;  1SZQ A;  2HS3 A;  5MN5 A;  1IPA A;  2N48 A;  5C8Y B;  1VQP F;  3C9S A;  2DYY A;  2RHO A;  1X52 A;  3MBM A;  5IYZ B;  1OFU A;  2HS0 A;  2RHH A;  3ZP4 A;  5JCO C;  2Z1U A;  4G4Z A;  2QA4 F;  1COM A;  3CMA F;  4M8I A;  4TZZ A;  1X7O A;  4O4L A;  1VQ9 F;  3JAW A;  4ZI7 A;  4XCQ A;  4BVR A;  1VQ5 F;  3SIV A;  1QVG F;  1YJN F;  3V7E A;  3JAR B;  4ZHW A;  2HP3 A;  4O2A A;  3JAT A;  2LBT A;  5B8F A;  4C8I A;  2HQS C;  4B45 A;  4C81 A;  5G4U C;  4IHJ B;  2GZL A;  4B46 A;  1QAH A;  2IAF A;  2VAW A;  3F0D A;  4NWO B;  3F6M A;  4O2B A;  1YQN A;  4F6R B;  2EWC A;  1TUB B;  2VAP A;  5EAZ A;  1SDS A;  1RQ7 A;  3WGK A;  2ZVZ A;  1VK3 A;  2H6L A;  4KWE A;  4X20 B;  2AIZ P; 
#chains in the Genus database with same CATH homology
 4X3M A;  5FLX M;  5GIP C;  1RA4 A;  5HWE A;  3CCJ F;  1H7M A;  3MCA B;  4EI7 A;  2OTL F;  2KTU A;  3LWP C;  1VQ8 F;  3AGK A;  3J7A R;  1XBI A;  5HXU A;  1VQN F;  2FGY A;  2FC3 A;  2VGN A;  4LCK A;  2KG4 A;  3NVI B;  1KC8 H;  2CZW A;  3CCR F;  3JAM M;  1Q7Y H;  1QVF F;  1VQO F;  1KQS F;  3CG6 A;  1RLG A;  1W41 A;  1T0K B;  3I56 F;  3IR9 A;  3SIU A;  3CCM F;  1M1K H;  1YJ9 F;  1W40 A;  3LWQ C;  5G4V C;  1W3E X;  1YJW F;  4BVQ A;  3VI6 A;  3CXC F;  3G6E F;  3CCV F;  3LFO A;  2OTJ F;  3G4S F;  2OHW A;  1GZ0 A;  1DT9 A;  5HY4 A;  2QI2 A;  3CC7 F;  2WAL A;  3CCE F;  3CC4 F;  1JJ2 F;  4EI8 A;  1YIJ F;  2BO1 A;  1W42 A;  4NQ3 A;  1Q82 H;  3LWV C;  3PLA C;  1VQ6 F;  2GLZ A;  1X7P A;  4BW0 B;  4NUT A;  3OW2 F;  1YIT F;  2OZB A;  3NK7 A;  3CME F;  3LWR C;  5GAN K;  1PXW A;  3ON1 A;  3NVK E;  3NK6 A;  1VQ7 F;  2QEX F;  1K9M H;  5GIN C;  1YHQ F;  3N4Z A;  5A2Q M;  3J80 M;  1YI2 F;  4BVT A;  2JNB A;  5HY0 A;  3WXM B;  1W2B F;  1S72 F;  4BVS A;  5DCV A;  3GYQ A;  1Q81 H;  1VQM F;  3LWO C;  1VQL F;  5GIO C;  3OBY A;  5FJ4 C;  1IPA A;  3CCU F;  3HAX D;  4BY9 D;  1VQP F;  2I6D A;  2VGM A;  3RA5 A;  2KTV A;  2LBW A;  2AIF A;  3VMF B;  1X52 A;  1VQK F;  3CCL F;  2LBX A;  1NJI H;  2QA4 F;  3CC2 F;  3CMA F;  4TZZ A;  1X7O A;  1E7K A;  5GAP K;  1VQ9 F;  5EWR A;  2ALE A;  3G71 F;  1Q86 H;  5HY1 A;  3O85 A;  4XCQ A;  3E1Y A;  3RA6 A;  4BVR A;  3E20 B;  1CK2 A;  3I55 F;  3CCS F;  1VQ5 F;  3CD6 F;  3NMU C;  1QVG F;  1YJN F;  3SIV A;  3V7Q A;  3OBW A;  1VQ4 F;  3V7E A;  1K8A H;  4EI9 A;  1GO1 A;  3CPW F;  3JCM M;  3V3T A;  1GO0 A;  4X3L A;  5G4U C;  5EO3 A;  4C4W C;  3J81 M;  3CCQ F;  3N4Y A;  1ZWZ A;  3CPQ A;  5HY2 A;  3HJW C;  3D00 A;  1KD1 H;  5HXZ A;  2F9Z C;  2HVY D;  1N8R H;  1K73 H;  1SDS A;  5IT9 M;  1M90 H;  3PAF A;  1CN7 A;  1NMU B;  3FFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...