3WPXA

Structure of pombc4, a periplasmic fragment of pomb from vibrio alginolyticus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PomB
publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Membrane protein
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpxA00
5EAZA 2LCAA 3WPXA 3S03A 3S0YA 2LBTA 4B62A 4ZHYB 4G4YA 2L26A 4G88A 5EB1B 3CYPB 4ZHWA 3IMPA 2ZF8A 2W8BC 4PWTA 4G4WA 3TD5A 3CYQA 4G4XA 2HQSC 4ZHVA 4B5CA 1R1MA 3S06A 3S0HA 4R40B 2ZVYA 3LDTA 4G4ZA 2ZVZA 3TD4A 3S02A 4ERHA 2N48A 3S0WA 5EB0A 2MQEA 3OONA 1OAPA 2AIZP 2ZOVA 2K1SA 4RHAA 3WPWA 3KHNA 2KGWA 3TD3A 4G4VA
chains in the Genus database with same CATH superfamily
5IJ0B 1XBIA 2VAPA 4NQ3A 4X1IB 3WGLA 3CCJF 2BO1A 5JH7B 3CC7F 5FNVB 2Z1EA 2HP0B 3CCVF 3SIUA 2RHJA 3D00A 4F6RB 2ZVYA 4X1KA 3MCQA 4C8IA 5HY1A 3S0WA 3GYQA 4ZI7B 1U43A 5CB4B 1NMUB 1NQ3A 3D01A 4IIJA 1VQMF 3K0TA 3NVIB 3FBAA 3WJPA 3ELCA 2CW4A 4BT5A 3KHNA 2Z1FA 3C9UA 3IR9A 3M1XA 2HRYA 4DRXB 1Z5WA 3C9TA 5KMGA 2CHSA 4YJ3A 1VQPF 5MN5A 5LP6A 3S02A 4TZZA 2RHHA 3OBYA 2ALEA 2KG4A 4TUYA 2Z1UA 2CSLA 1CK2A 4X3MA 3N2GA 3D54A 4RHAA 4ZOLB 3IKEA 1JY8A 5HY0A 1IPAA 1W5EA 3FPIA 4G4YA 4ZK7A 2DT4A 2L26A 4O2BB 3V7EA 3JCMM 3CYPB 4I50B 1DT9A 1FFXB 1VQOF 4O2AA 1H47A 2H8EA 4EB6B 2P6YA 3JAWA 4R40B 3RYCA 3LWPC 3ON1A 3HKCA 3MDOA 3V7QA 3JVHA 3KIZA 3QUWA 3VI6A 1CN7A 3RYFB 3LWOC 3CCMF 3CCEF 3HKDA 1W57A 2MQEA 1VQ5F 3AGKA 4DXDA 5LA6B 1H7MA 3I55F 3PLAC 4BVTA 5CA0A 5IJ0A 1JFFB 3IKFA 1YGYA 3CMAF 2IAFA 5JH7A 3ESJA 5J2UA 1Z5VA 3NK7A 2HP0A 4G4XA 4F6RA 2R751 3CC4F 1JD1A 3WGNA 1RLGA 1Q82H 3HJWC 2OHWA 3VO8A 2WALA 3J81M 3WGJA 1XV2A 1TUBB 5JCOA 3B6NA 1FSZA 4C82A 1K9MH 2OTMA 5EZYA 4BW0B 3HKBB 3WPWA 5B8FA 3KE1A 2UYNB 2UYPA 3G71F 4U3JA 4DRXA 3T80A 1GO1A 4HNAB 1JJ2F 4O4JB 2PHNA 2V9YA 3ZO8A 3F0FA 4O4LB 3WGKA 3E22B 5FLXM 3I56F 1M90H 1VQ8F 2RB9A 3DC2A 4TV8B 3GTZA 2RHLA 1XRGA 3LWQC 1YQNA 2AMTA 2UZHA 5HXZA 2YXZA 2LBWA 3VYTC 5GIPC 3RYHB 2FGYA 4O2BA 1W5AA 3QHDA 4B62A 3ZP4A 5IJ9A 1SZQA 4O4IB 5A2QM 3R0PA 4EB6A 1VQNF 5HP8A 3RA6A 5LYJA 3CYQA 2HS4A 3C8LA 3S0HA 3CC2F 1VQLF 1YJNF 5JVDB 1X25A 3TD4A 5J2TB 2BTUA 3RYFA 3VYUC 5HY4A 4I4TB 5C8YA 2Z1TA 3LYBA 4TV9B 1JFFA 3ERNA 4I55B 4LCKA 2VGNA 4C81A 1Q81H 3RE3A 1T0KB 2BTQB 5EO3A 4B45A 1X52A 3UT5B 5KX5B 5ITZA 1Q8RA 1RLUA 3LMEA 4X20A 1J7HA 5HP7A 1KNKA 2LBXA 5LXTB 3CCUF 3ZP7A 4EI7A 3MCAB 2HRUA 1VHAA 4LNUA 1XHOA 3LDTA 3JAKB 4FFBA 3JARB 1E7KA 1U40A 5JQGA 3VCZA 3CCSF 3K2XA 3HKEB 1VQ6F 1OAPA 2UYNA 2K1SA 3TD3A 1QD9A 5GIOC 5IT9M 1PF5A 2IQQA 2YYEA 3HTNA 1RQ7A 3FFMA 5GONA 3WJQA 1KQSF 4YJ2A 2AIFA 2FC3A 4PWTA 2JNBA 3VOBA 2GLZA 3E22A 2HX0A 1IV4A 4X1YB 1GO0A 3E20B 4BVRA 5CA1A 3V4DA 1COMA 1W41A 2N48A 1TVKA 2CWJA 1YI2F 3F0GA 1UFYA 1W2BF 3FD5A 1VK3A 4B46A 3HAXD 1SA0A 5EIBD 3JALA 2IG8A 5IYZB 1ODEA 5LYJB 1YIJF 4EI8A 3VOAA 3WPXA 3S0YA 1FNKA 4X1IA 3G4SF 2KTVA 5HWEA 4WBNB 4BY9D 5GANK 5FNVA 2GVIA 3QTYA 2DYYA 3JASB 4BT6A 5JVDA 2I6DA 5J2TA 3BYQA 1U3PA 4BT2A 4X1KB 1T0AA 1UI9A 4ZI7A 5CB4A 4I4TA 4M8IA 4IIJB 3V3TA 1M1KH 3GHZA 1QVFF 1QU9A 2ZAUA 5BMVB 5DCVA 4I55A 3IEQA 3CCRF 1VQ9F 5JCOC 2QI2A 3FD6A 5KX5A 5EIBC 1GX1A 1ZWZA 2ZF8A 3E1YA 5LXTA 1OFUA 3CMEF 1VH8A 1RA4A 3I3FA 3CB2A 1W59A 2HQSC 1W3EX 3ZOPA 4E6EA 1VQKF 3RA5A 4G4ZA 2PMPA 3JARA 2UYKA 5LP6B 3I7TA 1QVGF 1KNJA 4TUYB 3CCLF 1IV2A 1W55A 3IEWA 3N2GB 1YITF 4ZOLA 4G4VA 4IHJB 3OW2F 3M84A 3S03A 4ZHYB 3LWRC 3K12A 4I50A 4NUTA 2NMUA 1FFXA 4ZHWA 1W40A 3CPWF 1X7OA 3CCQF 4BT7A 1N8RH 1VQ7F 4O2AB 1CLIA 1JN1A 1IV1A 2OTLF 3KJJA 4X1YA 5LOVB 1S72F 1ONIA 4BVSA 4B5CA 4C4WC 3VTIC 5HXUA 1W5BA 2G9IA 5HY2A 2ZVZA 1Q7YH 1SDSA 4U39A 1IV3A 1VQVA 3HKCB 3WXMB 3RYIB 2VAWA 3HWUA 5G4UC 1Q86H 5LA6A 3DDNA 5IYZA 3CPQA 5CA0B 1VQ4F 2HS0A 2OTJF 1YJWF 5EB1B 4WBNA 3NK6A 3N2KB 3VIUA 2HVYD 3VYSC 5J2UB 4XCQA 3JASA 5EYPB 2CHTA 3LWVC 5FJ4C 1TUBA 2OZBA 3EORA 3KJKA 4O4HB 5BMVA 1W42A 3CD6F 2GZLA 3F0EA 5LP6C 3HKBA 3P10A 1W5FA 2AIZP 2VGMA 5EZYB 4BT4A 2CZWA 4U3JB 4BT3A 4HNAA 3VMFB 3WJRA 4O4JA 1W581 2B33A 3O85A 1DBFA 3JATB 3CXCF 4O4LA 3SIVA 2QTPA 3S06A 4TV8A 2ZODA 2VAMA 3F0DA 5MN6A 3JAMM 4EI9A 4ZHQB 4IHJA 1QAHA 5AVMA 3RYHA 2LCAA 5GINC 2H8CA 2BTOA 2R6R1 3F6MA 4G88A 5IJ9B 4O4IA 1NJIH 3IMPA 3M4SA 2KTUA 1H48A 5LOVA 3LFOA 3TD5A 3CG6A 2RHOA 5GAPK 3P4EA 2CVLA 4NWOB 1RQ2A 3RYIA 1KD1H 3NVKE 5C8YB 4TV9A 3J7AR 5EWRA 2Q1YA 5EAZA 2LBTA 3UT5A 3N2KA 1K8AH 1U3LA 1KC8H 5ITZB 3C9RA 1PXWA 4X20B 5EYPA 2W8BC 3MQWA 2QA4F 4C8EA 3PAFA 5MN4A 4ZHVA 1R1MA 2QEXF 4BVQA 3C9SA 5KMGB 4LNUB 3JAKA 4YJ3B 2I6RA 3P0ZA 4FFBB 4ERHA 2HP3A 4O4HA 5JQGB 3HKEA 4X3LA 3NMUC 2Z01A 1FNJA 4C8GA 2ZOVA 1YHQF 3L7QA 2Q1XA 2KGWA 2F9ZC 1X7PA 4KWEA 3N4ZA 2EWCA 3JATA 2H6LA 5GONB 2HS3A 1K73H 3K14A 5G4VC 4G4WA 4YJ2B 3MBMA 3WGMA 1GZ0A 3G6EF 3Q8HA 1YJ9F 3JAWB 5CA1B 3RYCB 3OBWA 2UYJA 3N4YA 1TVKB 2VXYA 5EB0A 3J80M 4ZHQA 3U0OA 3OONA 3HKDB 4RQOA 1SA0B 3JALB
chains in the Genus database with same CATH topology
5EAZA 2LCAA 3WPXA 3S03A 3S0YA 2LBTA 4B62A 4ZHYB 4G4YA 2L26A 4G88A 5EB1B 3CYPB 4ZHWA 3IMPA 2ZF8A 2W8BC 4PWTA 4G4WA 3TD5A 3CYQA 4G4XA 2HQSC 4ZHVA 4B5CA 1R1MA 3S06A 3S0HA 4R40B 2ZVYA 3LDTA 4G4ZA 2ZVZA 3TD4A 3S02A 4ERHA 2N48A 3S0WA 5EB0A 2MQEA 3OONA 1OAPA 2AIZP 2ZOVA 2K1SA 4RHAA 3WPWA 3KHNA 2KGWA 3TD3A 4G4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAZ A;  2LCA A;  3WPX A;  3S03 A;  3S0Y A;  2LBT A;  4B62 A;  4ZHY B;  4G4Y A;  2L26 A;  4G88 A;  5EB1 B;  3CYP B;  4ZHW A;  3IMP A;  2ZF8 A;  2W8B C;  4PWT A;  4G4W A;  3TD5 A;  3CYQ A;  4G4X A;  2HQS C;  4ZHV A;  4B5C A;  1R1M A;  3S06 A;  3S0H A;  4R40 B;  2ZVY A;  3LDT A;  4G4Z A;  2ZVZ A;  3TD4 A;  3S02 A;  4ERH A;  2N48 A;  3S0W A;  5EB0 A;  2MQE A;  3OON A;  1OAP A;  2AIZ P;  2ZOV A;  2K1S A;  4RHA A;  3WPW A;  3KHN A;  2KGW A;  3TD3 A;  4G4V A; 
#chains in the Genus database with same CATH topology
 5IJ0 B;  1XBI A;  2VAP A;  4NQ3 A;  4X1I B;  3WGL A;  3CCJ F;  2BO1 A;  5JH7 B;  3CC7 F;  5FNV B;  2Z1E A;  2HP0 B;  3CCV F;  3SIU A;  2RHJ A;  3D00 A;  4F6R B;  2ZVY A;  4X1K A;  3MCQ A;  4C8I A;  5HY1 A;  3S0W A;  3GYQ A;  4ZI7 B;  1U43 A;  5CB4 B;  1NMU B;  1NQ3 A;  3D01 A;  4IIJ A;  1VQM F;  3K0T A;  3NVI B;  3FBA A;  3WJP A;  3ELC A;  2CW4 A;  4BT5 A;  3KHN A;  2Z1F A;  3C9U A;  3IR9 A;  3M1X A;  2HRY A;  4DRX B;  1Z5W A;  3C9T A;  5KMG A;  2CHS A;  4YJ3 A;  1VQP F;  5MN5 A;  5LP6 A;  3S02 A;  4TZZ A;  2RHH A;  3OBY A;  2ALE A;  2KG4 A;  4TUY A;  2Z1U A;  2CSL A;  1CK2 A;  4X3M A;  3N2G A;  3D54 A;  4RHA A;  4ZOL B;  3IKE A;  1JY8 A;  5HY0 A;  1IPA A;  1W5E A;  3FPI A;  4G4Y A;  4ZK7 A;  2DT4 A;  2L26 A;  4O2B B;  3V7E A;  3JCM M;  3CYP B;  4I50 B;  1DT9 A;  1FFX B;  1VQO F;  4O2A A;  1H47 A;  2H8E A;  4EB6 B;  2P6Y A;  3JAW A;  4R40 B;  3RYC A;  3LWP C;  3ON1 A;  3HKC A;  3MDO A;  3V7Q A;  3JVH A;  3KIZ A;  3QUW A;  3VI6 A;  1CN7 A;  3RYF B;  3LWO C;  3CCM F;  3CCE F;  3HKD A;  1W57 A;  2MQE A;  1VQ5 F;  3AGK A;  4DXD A;  5LA6 B;  1H7M A;  3I55 F;  3PLA C;  4BVT A;  5CA0 A;  5IJ0 A;  1JFF B;  3IKF A;  1YGY A;  3CMA F;  2IAF A;  5JH7 A;  3ESJ A;  5J2U A;  1Z5V A;  3NK7 A;  2HP0 A;  4G4X A;  4F6R A;  2R75 1;  3CC4 F;  1JD1 A;  3WGN A;  1RLG A;  1Q82 H;  3HJW C;  2OHW A;  3VO8 A;  2WAL A;  3J81 M;  3WGJ A;  1XV2 A;  1TUB B;  5JCO A;  3B6N A;  1FSZ A;  4C82 A;  1K9M H;  2OTM A;  5EZY A;  4BW0 B;  3HKB B;  3WPW A;  5B8F A;  3KE1 A;  2UYN B;  2UYP A;  3G71 F;  4U3J A;  4DRX A;  3T80 A;  1GO1 A;  4HNA B;  1JJ2 F;  4O4J B;  2PHN A;  2V9Y A;  3ZO8 A;  3F0F A;  4O4L B;  3WGK A;  3E22 B;  5FLX M;  3I56 F;  1M90 H;  1VQ8 F;  2RB9 A;  3DC2 A;  4TV8 B;  3GTZ A;  2RHL A;  1XRG A;  3LWQ C;  1YQN A;  2AMT A;  2UZH A;  5HXZ A;  2YXZ A;  2LBW A;  3VYT C;  5GIP C;  3RYH B;  2FGY A;  4O2B A;  1W5A A;  3QHD A;  4B62 A;  3ZP4 A;  5IJ9 A;  1SZQ A;  4O4I B;  5A2Q M;  3R0P A;  4EB6 A;  1VQN F;  5HP8 A;  3RA6 A;  5LYJ A;  3CYQ A;  2HS4 A;  3C8L A;  3S0H A;  3CC2 F;  1VQL F;  1YJN F;  5JVD B;  1X25 A;  3TD4 A;  5J2T B;  2BTU A;  3RYF A;  3VYU C;  5HY4 A;  4I4T B;  5C8Y A;  2Z1T A;  3LYB A;  4TV9 B;  1JFF A;  3ERN A;  4I55 B;  4LCK A;  2VGN A;  4C81 A;  1Q81 H;  3RE3 A;  1T0K B;  2BTQ B;  5EO3 A;  4B45 A;  1X52 A;  3UT5 B;  5KX5 B;  5ITZ A;  1Q8R A;  1RLU A;  3LME A;  4X20 A;  1J7H A;  5HP7 A;  1KNK A;  2LBX A;  5LXT B;  3CCU F;  3ZP7 A;  4EI7 A;  3MCA B;  2HRU A;  1VHA A;  4LNU A;  1XHO A;  3LDT A;  3JAK B;  4FFB A;  3JAR B;  1E7K A;  1U40 A;  5JQG A;  3VCZ A;  3CCS F;  3K2X A;  3HKE B;  1VQ6 F;  1OAP A;  2UYN A;  2K1S A;  3TD3 A;  1QD9 A;  5GIO C;  5IT9 M;  1PF5 A;  2IQQ A;  2YYE A;  3HTN A;  1RQ7 A;  3FFM A;  5GON A;  3WJQ A;  1KQS F;  4YJ2 A;  2AIF A;  2FC3 A;  4PWT A;  2JNB A;  3VOB A;  2GLZ A;  3E22 A;  2HX0 A;  1IV4 A;  4X1Y B;  1GO0 A;  3E20 B;  4BVR A;  5CA1 A;  3V4D A;  1COM A;  1W41 A;  2N48 A;  1TVK A;  2CWJ A;  1YI2 F;  3F0G A;  1UFY A;  1W2B F;  3FD5 A;  1VK3 A;  4B46 A;  3HAX D;  1SA0 A;  5EIB D;  3JAL A;  2IG8 A;  5IYZ B;  1ODE A;  5LYJ B;  1YIJ F;  4EI8 A;  3VOA A;  3WPX A;  3S0Y A;  1FNK A;  4X1I A;  3G4S F;  2KTV A;  5HWE A;  4WBN B;  4BY9 D;  5GAN K;  5FNV A;  2GVI A;  3QTY A;  2DYY A;  3JAS B;  4BT6 A;  5JVD A;  2I6D A;  5J2T A;  3BYQ A;  1U3P A;  4BT2 A;  4X1K B;  1T0A A;  1UI9 A;  4ZI7 A;  5CB4 A;  4I4T A;  4M8I A;  4IIJ B;  3V3T A;  1M1K H;  3GHZ A;  1QVF F;  1QU9 A;  2ZAU A;  5BMV B;  5DCV A;  4I55 A;  3IEQ A;  3CCR F;  1VQ9 F;  5JCO C;  2QI2 A;  3FD6 A;  5KX5 A;  5EIB C;  1GX1 A;  1ZWZ A;  2ZF8 A;  3E1Y A;  5LXT A;  1OFU A;  3CME F;  1VH8 A;  1RA4 A;  3I3F A;  3CB2 A;  1W59 A;  2HQS C;  1W3E X;  3ZOP A;  4E6E A;  1VQK F;  3RA5 A;  4G4Z A;  2PMP A;  3JAR A;  2UYK A;  5LP6 B;  3I7T A;  1QVG F;  1KNJ A;  4TUY B;  3CCL F;  1IV2 A;  1W55 A;  3IEW A;  3N2G B;  1YIT F;  4ZOL A;  4G4V A;  4IHJ B;  3OW2 F;  3M84 A;  3S03 A;  4ZHY B;  3LWR C;  3K12 A;  4I50 A;  4NUT A;  2NMU A;  1FFX A;  4ZHW A;  1W40 A;  3CPW F;  1X7O A;  3CCQ F;  4BT7 A;  1N8R H;  1VQ7 F;  4O2A B;  1CLI A;  1JN1 A;  1IV1 A;  2OTL F;  3KJJ A;  4X1Y A;  5LOV B;  1S72 F;  1ONI A;  4BVS A;  4B5C A;  4C4W C;  3VTI C;  5HXU A;  1W5B A;  2G9I A;  5HY2 A;  2ZVZ A;  1Q7Y H;  1SDS A;  4U39 A;  1IV3 A;  1VQV A;  3HKC B;  3WXM B;  3RYI B;  2VAW A;  3HWU A;  5G4U C;  1Q86 H;  5LA6 A;  3DDN A;  5IYZ A;  3CPQ A;  5CA0 B;  1VQ4 F;  2HS0 A;  2OTJ F;  1YJW F;  5EB1 B;  4WBN A;  3NK6 A;  3N2K B;  3VIU A;  2HVY D;  3VYS C;  5J2U B;  4XCQ A;  3JAS A;  5EYP B;  2CHT A;  3LWV C;  5FJ4 C;  1TUB A;  2OZB A;  3EOR A;  3KJK A;  4O4H B;  5BMV A;  1W42 A;  3CD6 F;  2GZL A;  3F0E A;  5LP6 C;  3HKB A;  3P10 A;  1W5F A;  2AIZ P;  2VGM A;  5EZY B;  4BT4 A;  2CZW A;  4U3J B;  4BT3 A;  4HNA A;  3VMF B;  3WJR A;  4O4J A;  1W58 1;  2B33 A;  3O85 A;  1DBF A;  3JAT B;  3CXC F;  4O4L A;  3SIV A;  2QTP A;  3S06 A;  4TV8 A;  2ZOD A;  2VAM A;  3F0D A;  5MN6 A;  3JAM M;  4EI9 A;  4ZHQ B;  4IHJ A;  1QAH A;  5AVM A;  3RYH A;  2LCA A;  5GIN C;  2H8C A;  2BTO A;  2R6R 1;  3F6M A;  4G88 A;  5IJ9 B;  4O4I A;  1NJI H;  3IMP A;  3M4S A;  2KTU A;  1H48 A;  5LOV A;  3LFO A;  3TD5 A;  3CG6 A;  2RHO A;  5GAP K;  3P4E A;  2CVL A;  4NWO B;  1RQ2 A;  3RYI A;  1KD1 H;  3NVK E;  5C8Y B;  4TV9 A;  3J7A R;  5EWR A;  2Q1Y A;  5EAZ A;  2LBT A;  3UT5 A;  3N2K A;  1K8A H;  1U3L A;  1KC8 H;  5ITZ B;  3C9R A;  1PXW A;  4X20 B;  5EYP A;  2W8B C;  3MQW A;  2QA4 F;  4C8E A;  3PAF A;  5MN4 A;  4ZHV A;  1R1M A;  2QEX F;  4BVQ A;  3C9S A;  5KMG B;  4LNU B;  3JAK A;  4YJ3 B;  2I6R A;  3P0Z A;  4FFB B;  4ERH A;  2HP3 A;  4O4H A;  5JQG B;  3HKE A;  4X3L A;  3NMU C;  2Z01 A;  1FNJ A;  4C8G A;  2ZOV A;  1YHQ F;  3L7Q A;  2Q1X A;  2KGW A;  2F9Z C;  1X7P A;  4KWE A;  3N4Z A;  2EWC A;  3JAT A;  2H6L A;  5GON B;  2HS3 A;  1K73 H;  3K14 A;  5G4V C;  4G4W A;  4YJ2 B;  3MBM A;  3WGM A;  1GZ0 A;  3G6E F;  3Q8H A;  1YJ9 F;  3JAW B;  5CA1 B;  3RYC B;  3OBW A;  2UYJ A;  3N4Y A;  1TVK B;  2VXY A;  5EB0 A;  3J80 M;  4ZHQ A;  3U0O A;  3OON A;  3HKD B;  4RQO A;  1SA0 B;  3JAL B; 
#chains in the Genus database with same CATH homology
 5EAZ A;  2LCA A;  3WPX A;  3S03 A;  3S0Y A;  2LBT A;  4B62 A;  4ZHY B;  4G4Y A;  2L26 A;  4G88 A;  5EB1 B;  3CYP B;  4ZHW A;  3IMP A;  2ZF8 A;  2W8B C;  4PWT A;  4G4W A;  3TD5 A;  3CYQ A;  4G4X A;  2HQS C;  4ZHV A;  4B5C A;  1R1M A;  3S06 A;  3S0H A;  4R40 B;  2ZVY A;  3LDT A;  4G4Z A;  2ZVZ A;  3TD4 A;  3S02 A;  4ERH A;  2N48 A;  3S0W A;  5EB0 A;  2MQE A;  3OON A;  1OAP A;  2AIZ P;  2ZOV A;  2K1S A;  4RHA A;  3WPW A;  3KHN A;  2KGW A;  3TD3 A;  4G4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...