3WPXA

Structure of pombc4, a periplasmic fragment of pomb from vibrio alginolyticus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
SQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGIVRVSGHTDNRPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords PomB
publication title Conformational change in the periplasmic region of the flagellar stator coupled with the assembly around the rotor
pubmed doi rcsb
source organism Vibrio alginolyticus
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3wpxA00
3S0YA 3TD5A 2ZF8A 3KHNA 3CYQA 1R1MA 2MQEA 4G4VA 3S0WA 3OONA 3WPWA 4G4XA 4B62A 4R40B 3LDTA 2L26A 5EAZA 3CYPB 5EB0A 4PWTA 3TD4A 4ZHYB 4G4WA 2LCAA 2ZOVA 2AIZP 2ZVYA 4G4ZA 4ERHA 3S0HA 3IMPA 2LBTA 3S03A 2W8BC 5EB1B 3WPXA 3TD3A 1OAPA 4ZHWA 2ZVZA 4B5CA 2N48A 4G4YA 3S06A 4G88A 4RHAA 2KGWA 3S02A 4ZHVA 2K1SA 2HQSC
chains in the Genus database with same CATH superfamily
4U3JA 5CA0A 3QUWA 3E22A 2QI2A 3D00A 3M1XA 4G4VA 3KIZA 3MCQA 3V7QA 2DYYA 1VHAA 1VQMF 5IYZA 4X1IA 5LP6C 4B45A 2PMPA 2YYEA 1SA0B 3CC7F 4ERHA 3FPIA 2RHOA 3HWUA 1VQ7F 2ZVZA 5JCOA 4ZHQA 2CVLA 2Z1TA 2AMTA 3MQWA 3SIVA 4O4LB 1YQNA 4ZI7A 4IHJB 2VAPA 3WGLA 3GTZA 5LOVB 4HNAB 1W41A 1JFFA 4U3JB 5CA0B 3E22B 2GLZA 4TZZA 2KTUA 3NK7A 1JJ2F 4U39A 1T0AA 3UT5A 2OHWA 5IYZB 1K8AH 4O4IA 1W5EA 1T0KB 5IT9M 4X1IB 4BVTA 2RB9A 2H8CA 3OBWA 3LWRC 1K9MH 4BY9D 3WJQA 2HQSC 4BT6A 4YJ2B 1Q7YH 2QTPA 3VYTC 2I6DA 3GYQA 3V3TA 2HX0A 1VQNF 4ZI7B 4EI9A 4C8GA 3CCUF 3B6NA 4O4JA 1FFXA 1JFFB 3NK6A 3VTIC 3RA6A 5JH7A 3F0DA 4E6EA 1YJ9F 3CXCF 3QTYA 3HKCA 4X1KA 5HY1A 2OTLF 3RE3A 3RYHB 3HKDA 5MN4A 2KG4A 3WGKA 1QD9A 3CCEF 3UT5B 3K12A 4O4IB 2UYJA 2V9YA 2RHJA 4RHAA 5GAPK 3M84A 3SIUA 2K1SA 3KE1A 5J2UA 2CHSA 3ZP4A 1TVKA 1W2BF 2R751 3IEQA 2IG8A 1FSZA 4G4XA 3ZO8A 3HJWC 3D01A 1IV1A 1QAHA 1H47A 4YJ3B 2HS4A 3GHZA 4FFBA 5LA6B 3ON1A 4O4JB 3IKFA 1H7MA 2HP3A 3C9RA 3HKCB 4X1KB 5GONA 1XHOA 2FC3A 5KMGA 1XRGA 1CN7A 1RA4A 3S0YA 1Z5VA 3NVIB 3CYQA 4O2BA 1NQ3A 2RHLA 5J2UB 1YITF 5JVDA 2LCAA 2ZAUA 3LYBA 2P6YA 3C9TA 1JD1A 3I7TA 2BO1A 1W42A 3S0HA 4NQ3A 2H8EA 1VQ4F 4BT7A 1VQ5F 1W5AA 2R6R1 5EZYB 1JN1A 1IV2A 2VAWA 3N2KA 4C82A 2KGWA 4BVSA 2EWCA 3F6MA 1M1KH 1VK3A 5GONB 5KMGB 3VYUC 2G9IA 4I4TA 3F0EA 5KX5A 3LWPC 3CC4F 2HRYA 2JNBA 4O2BB 1CLIA 3RYIA 3MCAB 2RHHA 3CCQF 4LNUA 3IR9A 2KTVA 2IAFA 3LMEA 5EYPA 5JCOC 5JVDB 2HRUA 5EB1B 5GIPC 3TD3A 1KQSF 3JVHA 1IV4A 3N4ZA 1ONIA 3F0FA 4YJ2A 3WJRA 1KC8H 1VQ9F 3P0ZA 5B8FA 5J2TB 3VOBA 3KJKA 1KNKA 3N2KB 1QU9A 1R1MA 1U3LA 2MQEA 4O4HB 5IJ9B 4TV9B 4X20B 4BW0B 1VQPF 2VXYA 2OTMA 1ODEA 3ZP7A 2YXZA 5G4VC 3RYFA 4I4TB 3RYHA 1CK2A 1VH8A 5KX5B 3S03A 1SDSA 2W8BC 3RYIB 3OBYA 3JCMM 2B33A 4LNUB 1W5FA 3D54A 1RLGA 5EYPB 3KJJA 1DBFA 1W40A 2Z1FA 3VI6A 5A2QM 3S02A 4BVRA 4ZHVA 3FFMA 3HKBB 3CMAF 2HP0A 3NVKE 3LWVC 4YJ3A 5GANK 3CCMF 3VOAA 5LA6A 3P10A 2PHNA 3DC2A 2ZOVA 4RQOA 5HXZA 1YGYA 3WGJA 4XCQA 2Q1YA 1PXWA 1Q8RA 4F6RB 3PAFA 4C8IA 3K14A 3RYFB 5C8YA 3N2GB 4EI8A 5HY2A 3DDNA 5LYJA 1RQ2A 3CC2F 1PF5A 3C8LA 3P4EA 3TD5A 2ZF8A 2ZODA 5MN5A 3CPWF 3CCLF 1K73H 1ZWZA 3LDTA 2UYKA 1VQOF 3RYCA 3PLAC 2HP0B 4DXDA 2OTJF 2AIZP 3ZOPA 5EZYA 4X3LA 3VMFB 2CWJA 3CCJF 2QA4F 5EO3A 5HP8A 3AGKA 1M90H 4EB6A 4C4WC 1Z5WA 3C9SA 5ITZA 4B5CA 4NUTA 1IV3A 3S06A 3HTNA 3MBMA 1GO0A 5C8YB 2OZBA 3S0WA 1OFUA 5LYJB 1Q86H 3G4SF 4DRXA 5DCVA 3F0GA 5GINC 3LWQC 3JARB 2HS0A 3CB2A 4BT2A 1Q81H 3C9UA 3V4DA 4C81A 4BT4A 4WBNA 3J80M 1YJWF 3RYCB 1COMA 3WXMB 3E20B 3WPXA 3V7EA 5J2TA 3L7QA 1KNJA 3M4SA 4BT5A 5FJ4C 4EB6B 4O4HA 5IJ9A 4TV9A 4X20A 5ITZB 2CW4A 1W59A 3WGMA 1E7KA 1H48A 2ALEA 4BVQA 4IIJA 4ZHYB 3HKEA 3TD4A 3K2XA 1X25A 3HAXD 3CCSF 5EWRA 4DRXB 4G4ZA 3N4YA 2Z1EA 3IMPA 2LBTA 3ESJA 3ELCA 2Q1XA 4I50B 3JAMM 3WGNA 3I3FA 3J7AR 3OW2F 4WBNB 3HKBA 2UYPA 5LXTB 1QVFF 5HXUA 3MDOA 4I55A 3OONA 3IEWA 1XBIA 1S72F 1FNKA 1SZQA 5EB0A 4F6RA 4G4WA 3FBAA 5FNVA 1W5BA 2AIFA 3EORA 4IIJB 3JASB 1W3EX 3N2GA 3HKEB 3VYSC 5LP6A 1YJNF 1VQKF 5G4UC 1GZ0A 1J7HA 4X3MA 1W55A 2LBXA 5HY0A 2HVYD 4B46A 4KWEA 3KHNA 1VQ8F 4TUYB 3FD5A 5IJ0B 3WPWA 3WJPA 1YIJF 4R40B 4C8EA 3CYPB 5FLXM 4PWTA 3NMUC 3CG6A 4I55B 4ZK7A 3IKEA 4TV8A 2BTQB 1VQVA 1FNJA 1Q82H 1X7PA 2CSLA 5FNVB 1JY8A 5AVMA 1QVGF 5LP6B 3U0OA 5CA1A 4ZOLA 4NWOB 4ZHQB 1X52A 2WALA 5CB4A 4EI7A 5GIOC 3JARA 1W581 3BYQA 3JAWA 4B62A 2GZLA 3JAKA 3O85A 5EAZA 3CMEF 3CCRF 3I56F 3JATA 2ZVYA 1N8RH 1VQLF 1U43A 5JQGA 5MN6A 4O2AA 3LWOC 3I55F 3Q8HA 5BMVA 3G71F 1UFYA 3QHDA 2UYNA 2VGMA 4TV8B 3RA5A 4G4YA 1GX1A 2Z01A 1TUBA 4G88A 1OAPA 2QEXF 1UI9A 2CZWA 1DT9A 2CHTA 2Z1UA 5CA1B 4ZOLB 5EIBD 2DT4A 2BTUA 2L26A 3VCZA 1IPAA 2LBWA 3VIUA 5CB4B 1YI2F 4X1YA 3LFOA 5HP7A 3JAWB 4I50A 3JALA 2VAMA 1KD1H 3JAKB 4M8IA 1FFXB 5HY4A 4TUYA 3JATB 5JH7B 2BTOA 4ZHWA 1W57A 3VO8A 3J81M 5LXTA 1VQ6F 3R0PA 3ERNA 5JQGB 4O2AB 3HKDB 5BMVB 3CD6F 2UYNB 5HWEA 2H6LA 3G6EF 1X7OA 2GVIA 1TUBB 2HS3A 4LCKA 1GO1A 2I6RA 1SA0A 2IQQA 3CPQA 5EIBC 1TVKB 1U3PA 1NJIH 1RLUA 2FGYA 1NMUB 3FD6A 3JASA 1U40A 3CCVF 1YHQF 3E1YA 4BT3A 3T80A 1XV2A 2UZHA 4X1YB 2VGNA 4O4LA 4FFBB 3JALB 4IHJA 2NMUA 2N48A 5LOVA 2F9ZC 1RQ7A 4HNAA 3K0TA 5IJ0A
chains in the Genus database with same CATH topology
3S0YA 3TD5A 2ZF8A 3KHNA 3CYQA 1R1MA 2MQEA 4G4VA 3S0WA 3OONA 3WPWA 4G4XA 4B62A 4R40B 3LDTA 2L26A 5EAZA 3CYPB 5EB0A 4PWTA 3TD4A 4ZHYB 4G4WA 2LCAA 2ZOVA 2AIZP 2ZVYA 4G4ZA 4ERHA 3S0HA 3IMPA 2LBTA 3S03A 2W8BC 5EB1B 3WPXA 3TD3A 1OAPA 4ZHWA 2ZVZA 4B5CA 2N48A 4G4YA 3S06A 4G88A 4RHAA 2KGWA 3S02A 4ZHVA 2K1SA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0Y A;  3TD5 A;  2ZF8 A;  3KHN A;  3CYQ A;  1R1M A;  2MQE A;  4G4V A;  3S0W A;  3OON A;  3WPW A;  4G4X A;  4B62 A;  4R40 B;  3LDT A;  2L26 A;  5EAZ A;  3CYP B;  5EB0 A;  4PWT A;  3TD4 A;  4ZHY B;  4G4W A;  2LCA A;  2ZOV A;  2AIZ P;  2ZVY A;  4G4Z A;  4ERH A;  3S0H A;  3IMP A;  2LBT A;  3S03 A;  2W8B C;  5EB1 B;  3WPX A;  3TD3 A;  1OAP A;  4ZHW A;  2ZVZ A;  4B5C A;  2N48 A;  4G4Y A;  3S06 A;  4G88 A;  4RHA A;  2KGW A;  3S02 A;  4ZHV A;  2K1S A;  2HQS C; 
#chains in the Genus database with same CATH topology
 4U3J A;  5CA0 A;  3QUW A;  3E22 A;  2QI2 A;  3D00 A;  3M1X A;  4G4V A;  3KIZ A;  3MCQ A;  3V7Q A;  2DYY A;  1VHA A;  1VQM F;  5IYZ A;  4X1I A;  5LP6 C;  4B45 A;  2PMP A;  2YYE A;  1SA0 B;  3CC7 F;  4ERH A;  3FPI A;  2RHO A;  3HWU A;  1VQ7 F;  2ZVZ A;  5JCO A;  4ZHQ A;  2CVL A;  2Z1T A;  2AMT A;  3MQW A;  3SIV A;  4O4L B;  1YQN A;  4ZI7 A;  4IHJ B;  2VAP A;  3WGL A;  3GTZ A;  5LOV B;  4HNA B;  1W41 A;  1JFF A;  4U3J B;  5CA0 B;  3E22 B;  2GLZ A;  4TZZ A;  2KTU A;  3NK7 A;  1JJ2 F;  4U39 A;  1T0A A;  3UT5 A;  2OHW A;  5IYZ B;  1K8A H;  4O4I A;  1W5E A;  1T0K B;  5IT9 M;  4X1I B;  4BVT A;  2RB9 A;  2H8C A;  3OBW A;  3LWR C;  1K9M H;  4BY9 D;  3WJQ A;  2HQS C;  4BT6 A;  4YJ2 B;  1Q7Y H;  2QTP A;  3VYT C;  2I6D A;  3GYQ A;  3V3T A;  2HX0 A;  1VQN F;  4ZI7 B;  4EI9 A;  4C8G A;  3CCU F;  3B6N A;  4O4J A;  1FFX A;  1JFF B;  3NK6 A;  3VTI C;  3RA6 A;  5JH7 A;  3F0D A;  4E6E A;  1YJ9 F;  3CXC F;  3QTY A;  3HKC A;  4X1K A;  5HY1 A;  2OTL F;  3RE3 A;  3RYH B;  3HKD A;  5MN4 A;  2KG4 A;  3WGK A;  1QD9 A;  3CCE F;  3UT5 B;  3K12 A;  4O4I B;  2UYJ A;  2V9Y A;  2RHJ A;  4RHA A;  5GAP K;  3M84 A;  3SIU A;  2K1S A;  3KE1 A;  5J2U A;  2CHS A;  3ZP4 A;  1TVK A;  1W2B F;  2R75 1;  3IEQ A;  2IG8 A;  1FSZ A;  4G4X A;  3ZO8 A;  3HJW C;  3D01 A;  1IV1 A;  1QAH A;  1H47 A;  4YJ3 B;  2HS4 A;  3GHZ A;  4FFB A;  5LA6 B;  3ON1 A;  4O4J B;  3IKF A;  1H7M A;  2HP3 A;  3C9R A;  3HKC B;  4X1K B;  5GON A;  1XHO A;  2FC3 A;  5KMG A;  1XRG A;  1CN7 A;  1RA4 A;  3S0Y A;  1Z5V A;  3NVI B;  3CYQ A;  4O2B A;  1NQ3 A;  2RHL A;  5J2U B;  1YIT F;  5JVD A;  2LCA A;  2ZAU A;  3LYB A;  2P6Y A;  3C9T A;  1JD1 A;  3I7T A;  2BO1 A;  1W42 A;  3S0H A;  4NQ3 A;  2H8E A;  1VQ4 F;  4BT7 A;  1VQ5 F;  1W5A A;  2R6R 1;  5EZY B;  1JN1 A;  1IV2 A;  2VAW A;  3N2K A;  4C82 A;  2KGW A;  4BVS A;  2EWC A;  3F6M A;  1M1K H;  1VK3 A;  5GON B;  5KMG B;  3VYU C;  2G9I A;  4I4T A;  3F0E A;  5KX5 A;  3LWP C;  3CC4 F;  2HRY A;  2JNB A;  4O2B B;  1CLI A;  3RYI A;  3MCA B;  2RHH A;  3CCQ F;  4LNU A;  3IR9 A;  2KTV A;  2IAF A;  3LME A;  5EYP A;  5JCO C;  5JVD B;  2HRU A;  5EB1 B;  5GIP C;  3TD3 A;  1KQS F;  3JVH A;  1IV4 A;  3N4Z A;  1ONI A;  3F0F A;  4YJ2 A;  3WJR A;  1KC8 H;  1VQ9 F;  3P0Z A;  5B8F A;  5J2T B;  3VOB A;  3KJK A;  1KNK A;  3N2K B;  1QU9 A;  1R1M A;  1U3L A;  2MQE A;  4O4H B;  5IJ9 B;  4TV9 B;  4X20 B;  4BW0 B;  1VQP F;  2VXY A;  2OTM A;  1ODE A;  3ZP7 A;  2YXZ A;  5G4V C;  3RYF A;  4I4T B;  3RYH A;  1CK2 A;  1VH8 A;  5KX5 B;  3S03 A;  1SDS A;  2W8B C;  3RYI B;  3OBY A;  3JCM M;  2B33 A;  4LNU B;  1W5F A;  3D54 A;  1RLG A;  5EYP B;  3KJJ A;  1DBF A;  1W40 A;  2Z1F A;  3VI6 A;  5A2Q M;  3S02 A;  4BVR A;  4ZHV A;  3FFM A;  3HKB B;  3CMA F;  2HP0 A;  3NVK E;  3LWV C;  4YJ3 A;  5GAN K;  3CCM F;  3VOA A;  5LA6 A;  3P10 A;  2PHN A;  3DC2 A;  2ZOV A;  4RQO A;  5HXZ A;  1YGY A;  3WGJ A;  4XCQ A;  2Q1Y A;  1PXW A;  1Q8R A;  4F6R B;  3PAF A;  4C8I A;  3K14 A;  3RYF B;  5C8Y A;  3N2G B;  4EI8 A;  5HY2 A;  3DDN A;  5LYJ A;  1RQ2 A;  3CC2 F;  1PF5 A;  3C8L A;  3P4E A;  3TD5 A;  2ZF8 A;  2ZOD A;  5MN5 A;  3CPW F;  3CCL F;  1K73 H;  1ZWZ A;  3LDT A;  2UYK A;  1VQO F;  3RYC A;  3PLA C;  2HP0 B;  4DXD A;  2OTJ F;  2AIZ P;  3ZOP A;  5EZY A;  4X3L A;  3VMF B;  2CWJ A;  3CCJ F;  2QA4 F;  5EO3 A;  5HP8 A;  3AGK A;  1M90 H;  4EB6 A;  4C4W C;  1Z5W A;  3C9S A;  5ITZ A;  4B5C A;  4NUT A;  1IV3 A;  3S06 A;  3HTN A;  3MBM A;  1GO0 A;  5C8Y B;  2OZB A;  3S0W A;  1OFU A;  5LYJ B;  1Q86 H;  3G4S F;  4DRX A;  5DCV A;  3F0G A;  5GIN C;  3LWQ C;  3JAR B;  2HS0 A;  3CB2 A;  4BT2 A;  1Q81 H;  3C9U A;  3V4D A;  4C81 A;  4BT4 A;  4WBN A;  3J80 M;  1YJW F;  3RYC B;  1COM A;  3WXM B;  3E20 B;  3WPX A;  3V7E A;  5J2T A;  3L7Q A;  1KNJ A;  3M4S A;  4BT5 A;  5FJ4 C;  4EB6 B;  4O4H A;  5IJ9 A;  4TV9 A;  4X20 A;  5ITZ B;  2CW4 A;  1W59 A;  3WGM A;  1E7K A;  1H48 A;  2ALE A;  4BVQ A;  4IIJ A;  4ZHY B;  3HKE A;  3TD4 A;  3K2X A;  1X25 A;  3HAX D;  3CCS F;  5EWR A;  4DRX B;  4G4Z A;  3N4Y A;  2Z1E A;  3IMP A;  2LBT A;  3ESJ A;  3ELC A;  2Q1X A;  4I50 B;  3JAM M;  3WGN A;  3I3F A;  3J7A R;  3OW2 F;  4WBN B;  3HKB A;  2UYP A;  5LXT B;  1QVF F;  5HXU A;  3MDO A;  4I55 A;  3OON A;  3IEW A;  1XBI A;  1S72 F;  1FNK A;  1SZQ A;  5EB0 A;  4F6R A;  4G4W A;  3FBA A;  5FNV A;  1W5B A;  2AIF A;  3EOR A;  4IIJ B;  3JAS B;  1W3E X;  3N2G A;  3HKE B;  3VYS C;  5LP6 A;  1YJN F;  1VQK F;  5G4U C;  1GZ0 A;  1J7H A;  4X3M A;  1W55 A;  2LBX A;  5HY0 A;  2HVY D;  4B46 A;  4KWE A;  3KHN A;  1VQ8 F;  4TUY B;  3FD5 A;  5IJ0 B;  3WPW A;  3WJP A;  1YIJ F;  4R40 B;  4C8E A;  3CYP B;  5FLX M;  4PWT A;  3NMU C;  3CG6 A;  4I55 B;  4ZK7 A;  3IKE A;  4TV8 A;  2BTQ B;  1VQV A;  1FNJ A;  1Q82 H;  1X7P A;  2CSL A;  5FNV B;  1JY8 A;  5AVM A;  1QVG F;  5LP6 B;  3U0O A;  5CA1 A;  4ZOL A;  4NWO B;  4ZHQ B;  1X52 A;  2WAL A;  5CB4 A;  4EI7 A;  5GIO C;  3JAR A;  1W58 1;  3BYQ A;  3JAW A;  4B62 A;  2GZL A;  3JAK A;  3O85 A;  5EAZ A;  3CME F;  3CCR F;  3I56 F;  3JAT A;  2ZVY A;  1N8R H;  1VQL F;  1U43 A;  5JQG A;  5MN6 A;  4O2A A;  3LWO C;  3I55 F;  3Q8H A;  5BMV A;  3G71 F;  1UFY A;  3QHD A;  2UYN A;  2VGM A;  4TV8 B;  3RA5 A;  4G4Y A;  1GX1 A;  2Z01 A;  1TUB A;  4G88 A;  1OAP A;  2QEX F;  1UI9 A;  2CZW A;  1DT9 A;  2CHT A;  2Z1U A;  5CA1 B;  4ZOL B;  5EIB D;  2DT4 A;  2BTU A;  2L26 A;  3VCZ A;  1IPA A;  2LBW A;  3VIU A;  5CB4 B;  1YI2 F;  4X1Y A;  3LFO A;  5HP7 A;  3JAW B;  4I50 A;  3JAL A;  2VAM A;  1KD1 H;  3JAK B;  4M8I A;  1FFX B;  5HY4 A;  4TUY A;  3JAT B;  5JH7 B;  2BTO A;  4ZHW A;  1W57 A;  3VO8 A;  3J81 M;  5LXT A;  1VQ6 F;  3R0P A;  3ERN A;  5JQG B;  4O2A B;  3HKD B;  5BMV B;  3CD6 F;  2UYN B;  5HWE A;  2H6L A;  3G6E F;  1X7O A;  2GVI A;  1TUB B;  2HS3 A;  4LCK A;  1GO1 A;  2I6R A;  1SA0 A;  2IQQ A;  3CPQ A;  5EIB C;  1TVK B;  1U3P A;  1NJI H;  1RLU A;  2FGY A;  1NMU B;  3FD6 A;  3JAS A;  1U40 A;  3CCV F;  1YHQ F;  3E1Y A;  4BT3 A;  3T80 A;  1XV2 A;  2UZH A;  4X1Y B;  2VGN A;  4O4L A;  4FFB B;  3JAL B;  4IHJ A;  2NMU A;  2N48 A;  5LOV A;  2F9Z C;  1RQ7 A;  4HNA A;  3K0T A;  5IJ0 A; 
#chains in the Genus database with same CATH homology
 3S0Y A;  3TD5 A;  2ZF8 A;  3KHN A;  3CYQ A;  1R1M A;  2MQE A;  4G4V A;  3S0W A;  3OON A;  3WPW A;  4G4X A;  4B62 A;  4R40 B;  3LDT A;  2L26 A;  5EAZ A;  3CYP B;  5EB0 A;  4PWT A;  3TD4 A;  4ZHY B;  4G4W A;  2LCA A;  2ZOV A;  2AIZ P;  2ZVY A;  4G4Z A;  4ERH A;  3S0H A;  3IMP A;  2LBT A;  3S03 A;  2W8B C;  5EB1 B;  3WPX A;  3TD3 A;  1OAP A;  4ZHW A;  2ZVZ A;  4B5C A;  2N48 A;  4G4Y A;  3S06 A;  4G88 A;  4RHA A;  2KGW A;  3S02 A;  4ZHV A;  2K1S A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...