1YQNA

E. coli ispf double mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'AEMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGMGLGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Escherichia coli
publication title A double mutation of Escherichia coli2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase disrupts six hydrogen bonds with, yet fails to prevent binding of, an isoprenoid diphosphate.
pubmed doi rcsb
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1yqnA00
1W55A 4C8EA 3P10A 1JY8A 1T0AA 1IV2A 3GHZA 3ESJA 3FBAA 3F0DA 1VH8A 1KNJA 3FPIA 3F0FA 3RE3A 5B8FA 4C82A 1JN1A 3IEWA 1U3PA 3IKEA 3K2XA 2PMPA 1VHAA 3F0GA 3KE1A 1IV4A 1IV1A 2AMTA 3ELCA 3EORA 1U3LA 3ERNA 3JVHA 3B6NA 3T80A 1IV3A 1YQNA 1U40A 3IKFA 2UZHA 4C8GA 3IEQA 1H48A 4C81A 3F0EA 1W57A 1GX1A 3Q8HA 3P0ZA 1U43A 1H47A 3F6MA 3MBMA 3QHDA 4C8IA 1KNKA 2GZLA 3K14A
chains in the Genus database with same CATH superfamily
1Z5WA 4O2BA 3C9RA 5KX5B 2BTQB 3CCJF 1K9MH 3WGNA 2H8CA 3WXMB 4G4WA 2DT4A 1Q82H 4I55B 1GZ0A 4G88A 5HY1A 3CMAF 3F0GA 4C4WC 1CLIA 3KJJA 1FFXA 2HS0A 2CW4A 4X1IA 3CC4F 3GYQA 3HKBB 4O4JA 3PLAC 2BTUA 5EIBD 5JQGB 2IAFA 3JASA 2FC3A 5JVDB 2IQQA 4DRXA 3VOAA 3ON1A 4U3JA 2QA4F 1M90H 3LWOC 4WBNB 3JARB 3FD6A 4HNAA 5CB4B 3P10A 1VK3A 1QU9A 2VGNA 5GONB 3GHZA 3RYIB 3CG6A 1YJNF 5EZYA 1VQKF 1VQOF 5HY4A 3E1YA 2AIZP 1T0KB 3CCUF 1SA0A 1W581 5C8YB 4FFBB 3JVHA 1SDSA 3CXCF 2UZHA 3RYCB 3HKDA 4YJ3A 3M84A 4IIJB 4RQOA 3RYCA 3CPQA 1YI2F 1VQ4F 3MBMA 2FGYA 1W40A 3CC7F 2I6DA 1JY8A 3VMFB 4HNAB 2LCAA 5CB4A 3RE3A 3F0FA 3VYSC 1NMUB 5EO3A 2Z1TA 2W8BC 1FSZA 3HKEA 3JATA 3CB2A 2BTOA 5GIOC 2JNBA 4G4YA 5GONA 2B33A 3JAKA 3VYTC 1OFUA 3T80A 3MCQA 3V7EA 3IKFA 5FNVA 2CSLA 3HKCA 4C81A 2UYJA 3WPWA 2ZOVA 2HRUA 3WGMA 2N48A 4BVRA 2HP3A 5EYPA 3LWVC 3P0ZA 4ZI7A 1VQ6F 5FLXM 2GZLA 5EIBC 2LBWA 3WGKA 1ODEA 4IHJA 5LP6C 5MN4A 2WALA 3RYFB 1YITF 3JARA 3I55F 3OBYA 1Q81H 4NWOB 3LYBA 3TD4A 3JASB 5JVDA 3GTZA 1KD1H 2P6YA 4O4IB 3LDTA 3ELCA 2ZVYA 1CN7A 3B6NA 4ZOLB 4RHAA 4BVQA 3N4YA 4O4LA 1DT9A 1H48A 3J7AR 2RHHA 4TV9B 1OAPA 3OW2F 1W57A 2ALEA 1KNKA 4KWEA 3J81M 1UFYA 4F6RB 5EYPB 1XBIA 3KJKA 3G4SF 5HP8A 2K1SA 5LOVA 3KE1A 4O2AA 2CZWA 3N2KB 2I6RA 1GO1A 3IEQA 3VCZA 3VIUA 2ZVZA 5FNVB 3CCVF 5FJ4C 1YGYA 2RHOA 3QHDA 3K0TA 3S0WA 5IJ9A 1W5AA 1RQ2A 4I50B 4B45A 1T0AA 2UYKA 5LYJB 1ONIA 2QI2A 5MN6A 1W2BF 3NMUC 4G4XA 3I7TA 3UT5B 5CA0B 5LA6B 5IJ0A 1VQMF 4LCKA 1X7PA 3R0PA 3WPXA 5DCVA 3HKDB 2HP0B 3DDNA 4YJ3B 2OTLF 2HVYD 5J2UA 2CHTA 2HS4A 1VQNF 5LOVB 3C8LA 4X1IB 3CYPB 4BVSA 3G71F 5IYZA 2OTJF 3HWUA 3N4ZA 3NVKE 4BT3A 1CK2A 1W55A 3VI6A 4O4HB 5J2TA 3NK6A 5JH7A 4BT6A 3V4DA 3N2GA 3AGKA 4TV8B 1DBFA 3S06A 3VTIC 1QD9A 1U40A 4BT5A 3ZP7A 4EI8A 4M8IA 3K12A 3JAWA 3BYQA 2OZBA 5EB0A 4B62A 4ZHWA 2OHWA 1W3EX 1IV2A 3RYHA 1COMA 1VH8A 3J80M 1QVFF 3CYQA 4BVTA 5GANK 5EZYB 4TV9A 3TD5A 3JAKB 4O2BB 1IV4A 3TD3A 1U3LA 4B46A 4I4TB 5ITZA 1VQLF 3CCEF 1QVGF 1Q86H 3LWQC 4X3LA 5HXUA 1JFFA 4C8IA 1FFXB 3VOBA 3LWPC 1TUBA 4C8EA 4IHJB 4EB6A 2AIFA 3CCSF 3ESJA 2ZF8A 4IIJA 5HWEA 4R40B 2QTPA 3HJWC 3D54A 2Z1UA 3N2KA 1VQ8F 1U3PA 1W5FA 2RHLA 2Z01A 5LP6B 4LNUB 3EORA 5MN5A 4ZOLA 4TZZA 5AVMA 5EAZA 3S0HA 1PF5A 4X1KA 3MDOA 1J7HA 5JH7B 5LXTB 2YYEA 4ZHQB 3F6MA 4I4TA 4I55A 2CWJA 3FD5A 3CCRF 3UT5A 1SZQA 5KMGB 3FBAA 2HS3A 1TVKB 2NMUA 5GINC 3CPWF 4BT2A 5KMGA 3RA6A 3JAMM 4EI7A 2QEXF 3IR9A 1RLUA 3LMEA 4O2AB 2VXYA 3WGJA 3ZO8A 1XRGA 2H8EA 1RQ7A 3OBWA 1W5BA 4X20A 3JATB 1Q7YH 4X20B 4LNUA 4YJ2A 2HX0A 4O4IA 3I56F 3Q8HA 5GIPC 2F9ZC 3RYIA 5G4VC 5C8YA 3M1XA 1YJ9F 3WJPA 5HXZA 3N2GB 3F0DA 4X3MA 3C9TA 3ZOPA 4NUTA 5LA6A 4EB6B 4B5CA 3ZP4A 2YXZA 1M1KH 1JD1A 5IYZB 1ZWZA 3E22A 3CCLF 2AMTA 5BMVB 3D01A 3E22B 3WJQA 1NQ3A 2GLZA 4EI9A 3LWRC 4U3JB 3JCMM 1VQPF 2UYNA 3RYHB 5HP7A 1GX1A 3P4EA 1FNJA 4TUYA 1H47A 2OTMA 3HKEB 2VAWA 2H6LA 2RHJA 4TUYB 3C9SA 2CVLA 1UI9A 4ZHQA 2CHSA 5B8FA 1X52A 3LFOA 3I3FA 1TVKA 2Q1YA 3VYUC 1VHAA 1XV2A 2LBXA 3JAWB 4TV8A 1VQ5F 1R1MA 2ZODA 3RA5A 4ZHVA 4BY9D 1VQ7F 5JQGA 5HY2A 2LBTA 5HY0A 1W41A 3O85A 5GAPK 4DXDA 4ZK7A 4BT7A 2ZAUA 5LP6A 2BO1A 3M4SA 5LYJA 3IMPA 4X1YA 1Z5VA 2V9YA 2Q1XA 3DC2A 4G4ZA 1K8AH 2R6R1 5LXTA 4FFBA 4YJ2B 3HAXD 4X1KB 1K73H 2HP0A 5IT9M 5CA1A 3CMEF 1IV3A 5CA0A 2R751 1YJWF 1Q8RA 5CA1B 4ZHYB 2KTVA 3CD6F 5J2UB 3V3TA 1U43A 5G4UC 1GO0A 3RYFA 2RB9A 2Z1EA 3D00A 1VQ9F 1KNJA 1W59A 5EWRA 2PHNA 5A2QM 2HRYA 2VAPA 4C82A 1NJIH 4WBNA 2PMPA 4NQ3A 5IJ9B 3V7QA 3KIZA 3WJRA 2GVIA 3VO8A 4XCQA 2VGMA 1KC8H 1QAHA 5ITZB 4F6RA 3NVIB 3HKCB 1H7MA 1JJ2F 3WGLA 5IJ0B 3CCQF 3S02A 1X7OA 4E6EA 3L7QA 3U0OA 2KG4A 4U39A 4ZI7B 5EB1B 5BMVA 1JFFB 1PXWA 3JALA 2DYYA 3SIVA 1JN1A 3G6EF 3MQWA 5JCOA 1N8RH 1RLGA 4O4JB 1IV1A 2IG8A 3HKBA 1FNKA 2UYNB 3OONA 3S03A 1XHOA 4O4LB 1YQNA 2L26A 3FFMA 4C8GA 2KGWA 1W5EA 1YIJF 2KTUA 2MQEA 2VAMA 4X1YB 3NK7A 1IPAA 4ERHA 3S0YA 1SA0B 4O4HA 1TUBB 5J2TB 2HQSC 3QTYA 1RA4A 3FPIA 3HTNA 3JALB 3MCAB 4BW0B 3IEWA 2G9IA 1KQSF 5JCOC 1YHQF 3IKEA 3CC2F 1X25A 3K2XA 3SIUA 4G4VA 3CCMF 1S72F 1W42A 3ERNA 3E20B 4BT4A 2UYPA 4DRXB 1E7KA 2EWCA 2Z1FA 3KHNA 3QUWA 4PWTA 3F0EA 3PAFA 4I50A 1VQVA 5KX5A 3K14A 3C9UA
chains in the Genus database with same CATH topology
1W55A 4C8EA 3P10A 1JY8A 1T0AA 1IV2A 3GHZA 3ESJA 3FBAA 3F0DA 1VH8A 1KNJA 3FPIA 3F0FA 3RE3A 5B8FA 4C82A 1JN1A 3IEWA 1U3PA 3IKEA 3K2XA 2PMPA 1VHAA 3F0GA 3KE1A 1IV4A 1IV1A 2AMTA 3ELCA 3EORA 1U3LA 3ERNA 3JVHA 3B6NA 3T80A 1IV3A 1YQNA 1U40A 3IKFA 2UZHA 4C8GA 3IEQA 1H48A 4C81A 3F0EA 1W57A 1GX1A 3Q8HA 3P0ZA 1U43A 1H47A 3F6MA 3MBMA 3QHDA 4C8IA 1KNKA 2GZLA 3K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  4C8E A;  3P10 A;  1JY8 A;  1T0A A;  1IV2 A;  3GHZ A;  3ESJ A;  3FBA A;  3F0D A;  1VH8 A;  1KNJ A;  3FPI A;  3F0F A;  3RE3 A;  5B8F A;  4C82 A;  1JN1 A;  3IEW A;  1U3P A;  3IKE A;  3K2X A;  2PMP A;  1VHA A;  3F0G A;  3KE1 A;  1IV4 A;  1IV1 A;  2AMT A;  3ELC A;  3EOR A;  1U3L A;  3ERN A;  3JVH A;  3B6N A;  3T80 A;  1IV3 A;  1YQN A;  1U40 A;  3IKF A;  2UZH A;  4C8G A;  3IEQ A;  1H48 A;  4C81 A;  3F0E A;  1W57 A;  1GX1 A;  3Q8H A;  3P0Z A;  1U43 A;  1H47 A;  3F6M A;  3MBM A;  3QHD A;  4C8I A;  1KNK A;  2GZL A;  3K14 A; 
#chains in the Genus database with same CATH topology
 1Z5W A;  4O2B A;  3C9R A;  5KX5 B;  2BTQ B;  3CCJ F;  1K9M H;  3WGN A;  2H8C A;  3WXM B;  4G4W A;  2DT4 A;  1Q82 H;  4I55 B;  1GZ0 A;  4G88 A;  5HY1 A;  3CMA F;  3F0G A;  4C4W C;  1CLI A;  3KJJ A;  1FFX A;  2HS0 A;  2CW4 A;  4X1I A;  3CC4 F;  3GYQ A;  3HKB B;  4O4J A;  3PLA C;  2BTU A;  5EIB D;  5JQG B;  2IAF A;  3JAS A;  2FC3 A;  5JVD B;  2IQQ A;  4DRX A;  3VOA A;  3ON1 A;  4U3J A;  2QA4 F;  1M90 H;  3LWO C;  4WBN B;  3JAR B;  3FD6 A;  4HNA A;  5CB4 B;  3P10 A;  1VK3 A;  1QU9 A;  2VGN A;  5GON B;  3GHZ A;  3RYI B;  3CG6 A;  1YJN F;  5EZY A;  1VQK F;  1VQO F;  5HY4 A;  3E1Y A;  2AIZ P;  1T0K B;  3CCU F;  1SA0 A;  1W58 1;  5C8Y B;  4FFB B;  3JVH A;  1SDS A;  3CXC F;  2UZH A;  3RYC B;  3HKD A;  4YJ3 A;  3M84 A;  4IIJ B;  4RQO A;  3RYC A;  3CPQ A;  1YI2 F;  1VQ4 F;  3MBM A;  2FGY A;  1W40 A;  3CC7 F;  2I6D A;  1JY8 A;  3VMF B;  4HNA B;  2LCA A;  5CB4 A;  3RE3 A;  3F0F A;  3VYS C;  1NMU B;  5EO3 A;  2Z1T A;  2W8B C;  1FSZ A;  3HKE A;  3JAT A;  3CB2 A;  2BTO A;  5GIO C;  2JNB A;  4G4Y A;  5GON A;  2B33 A;  3JAK A;  3VYT C;  1OFU A;  3T80 A;  3MCQ A;  3V7E A;  3IKF A;  5FNV A;  2CSL A;  3HKC A;  4C81 A;  2UYJ A;  3WPW A;  2ZOV A;  2HRU A;  3WGM A;  2N48 A;  4BVR A;  2HP3 A;  5EYP A;  3LWV C;  3P0Z A;  4ZI7 A;  1VQ6 F;  5FLX M;  2GZL A;  5EIB C;  2LBW A;  3WGK A;  1ODE A;  4IHJ A;  5LP6 C;  5MN4 A;  2WAL A;  3RYF B;  1YIT F;  3JAR A;  3I55 F;  3OBY A;  1Q81 H;  4NWO B;  3LYB A;  3TD4 A;  3JAS B;  5JVD A;  3GTZ A;  1KD1 H;  2P6Y A;  4O4I B;  3LDT A;  3ELC A;  2ZVY A;  1CN7 A;  3B6N A;  4ZOL B;  4RHA A;  4BVQ A;  3N4Y A;  4O4L A;  1DT9 A;  1H48 A;  3J7A R;  2RHH A;  4TV9 B;  1OAP A;  3OW2 F;  1W57 A;  2ALE A;  1KNK A;  4KWE A;  3J81 M;  1UFY A;  4F6R B;  5EYP B;  1XBI A;  3KJK A;  3G4S F;  5HP8 A;  2K1S A;  5LOV A;  3KE1 A;  4O2A A;  2CZW A;  3N2K B;  2I6R A;  1GO1 A;  3IEQ A;  3VCZ A;  3VIU A;  2ZVZ A;  5FNV B;  3CCV F;  5FJ4 C;  1YGY A;  2RHO A;  3QHD A;  3K0T A;  3S0W A;  5IJ9 A;  1W5A A;  1RQ2 A;  4I50 B;  4B45 A;  1T0A A;  2UYK A;  5LYJ B;  1ONI A;  2QI2 A;  5MN6 A;  1W2B F;  3NMU C;  4G4X A;  3I7T A;  3UT5 B;  5CA0 B;  5LA6 B;  5IJ0 A;  1VQM F;  4LCK A;  1X7P A;  3R0P A;  3WPX A;  5DCV A;  3HKD B;  2HP0 B;  3DDN A;  4YJ3 B;  2OTL F;  2HVY D;  5J2U A;  2CHT A;  2HS4 A;  1VQN F;  5LOV B;  3C8L A;  4X1I B;  3CYP B;  4BVS A;  3G71 F;  5IYZ A;  2OTJ F;  3HWU A;  3N4Z A;  3NVK E;  4BT3 A;  1CK2 A;  1W55 A;  3VI6 A;  4O4H B;  5J2T A;  3NK6 A;  5JH7 A;  4BT6 A;  3V4D A;  3N2G A;  3AGK A;  4TV8 B;  1DBF A;  3S06 A;  3VTI C;  1QD9 A;  1U40 A;  4BT5 A;  3ZP7 A;  4EI8 A;  4M8I A;  3K12 A;  3JAW A;  3BYQ A;  2OZB A;  5EB0 A;  4B62 A;  4ZHW A;  2OHW A;  1W3E X;  1IV2 A;  3RYH A;  1COM A;  1VH8 A;  3J80 M;  1QVF F;  3CYQ A;  4BVT A;  5GAN K;  5EZY B;  4TV9 A;  3TD5 A;  3JAK B;  4O2B B;  1IV4 A;  3TD3 A;  1U3L A;  4B46 A;  4I4T B;  5ITZ A;  1VQL F;  3CCE F;  1QVG F;  1Q86 H;  3LWQ C;  4X3L A;  5HXU A;  1JFF A;  4C8I A;  1FFX B;  3VOB A;  3LWP C;  1TUB A;  4C8E A;  4IHJ B;  4EB6 A;  2AIF A;  3CCS F;  3ESJ A;  2ZF8 A;  4IIJ A;  5HWE A;  4R40 B;  2QTP A;  3HJW C;  3D54 A;  2Z1U A;  3N2K A;  1VQ8 F;  1U3P A;  1W5F A;  2RHL A;  2Z01 A;  5LP6 B;  4LNU B;  3EOR A;  5MN5 A;  4ZOL A;  4TZZ A;  5AVM A;  5EAZ A;  3S0H A;  1PF5 A;  4X1K A;  3MDO A;  1J7H A;  5JH7 B;  5LXT B;  2YYE A;  4ZHQ B;  3F6M A;  4I4T A;  4I55 A;  2CWJ A;  3FD5 A;  3CCR F;  3UT5 A;  1SZQ A;  5KMG B;  3FBA A;  2HS3 A;  1TVK B;  2NMU A;  5GIN C;  3CPW F;  4BT2 A;  5KMG A;  3RA6 A;  3JAM M;  4EI7 A;  2QEX F;  3IR9 A;  1RLU A;  3LME A;  4O2A B;  2VXY A;  3WGJ A;  3ZO8 A;  1XRG A;  2H8E A;  1RQ7 A;  3OBW A;  1W5B A;  4X20 A;  3JAT B;  1Q7Y H;  4X20 B;  4LNU A;  4YJ2 A;  2HX0 A;  4O4I A;  3I56 F;  3Q8H A;  5GIP C;  2F9Z C;  3RYI A;  5G4V C;  5C8Y A;  3M1X A;  1YJ9 F;  3WJP A;  5HXZ A;  3N2G B;  3F0D A;  4X3M A;  3C9T A;  3ZOP A;  4NUT A;  5LA6 A;  4EB6 B;  4B5C A;  3ZP4 A;  2YXZ A;  1M1K H;  1JD1 A;  5IYZ B;  1ZWZ A;  3E22 A;  3CCL F;  2AMT A;  5BMV B;  3D01 A;  3E22 B;  3WJQ A;  1NQ3 A;  2GLZ A;  4EI9 A;  3LWR C;  4U3J B;  3JCM M;  1VQP F;  2UYN A;  3RYH B;  5HP7 A;  1GX1 A;  3P4E A;  1FNJ A;  4TUY A;  1H47 A;  2OTM A;  3HKE B;  2VAW A;  2H6L A;  2RHJ A;  4TUY B;  3C9S A;  2CVL A;  1UI9 A;  4ZHQ A;  2CHS A;  5B8F A;  1X52 A;  3LFO A;  3I3F A;  1TVK A;  2Q1Y A;  3VYU C;  1VHA A;  1XV2 A;  2LBX A;  3JAW B;  4TV8 A;  1VQ5 F;  1R1M A;  2ZOD A;  3RA5 A;  4ZHV A;  4BY9 D;  1VQ7 F;  5JQG A;  5HY2 A;  2LBT A;  5HY0 A;  1W41 A;  3O85 A;  5GAP K;  4DXD A;  4ZK7 A;  4BT7 A;  2ZAU A;  5LP6 A;  2BO1 A;  3M4S A;  5LYJ A;  3IMP A;  4X1Y A;  1Z5V A;  2V9Y A;  2Q1X A;  3DC2 A;  4G4Z A;  1K8A H;  2R6R 1;  5LXT A;  4FFB A;  4YJ2 B;  3HAX D;  4X1K B;  1K73 H;  2HP0 A;  5IT9 M;  5CA1 A;  3CME F;  1IV3 A;  5CA0 A;  2R75 1;  1YJW F;  1Q8R A;  5CA1 B;  4ZHY B;  2KTV A;  3CD6 F;  5J2U B;  3V3T A;  1U43 A;  5G4U C;  1GO0 A;  3RYF A;  2RB9 A;  2Z1E A;  3D00 A;  1VQ9 F;  1KNJ A;  1W59 A;  5EWR A;  2PHN A;  5A2Q M;  2HRY A;  2VAP A;  4C82 A;  1NJI H;  4WBN A;  2PMP A;  4NQ3 A;  5IJ9 B;  3V7Q A;  3KIZ A;  3WJR A;  2GVI A;  3VO8 A;  4XCQ A;  2VGM A;  1KC8 H;  1QAH A;  5ITZ B;  4F6R A;  3NVI B;  3HKC B;  1H7M A;  1JJ2 F;  3WGL A;  5IJ0 B;  3CCQ F;  3S02 A;  1X7O A;  4E6E A;  3L7Q A;  3U0O A;  2KG4 A;  4U39 A;  4ZI7 B;  5EB1 B;  5BMV A;  1JFF B;  1PXW A;  3JAL A;  2DYY A;  3SIV A;  1JN1 A;  3G6E F;  3MQW A;  5JCO A;  1N8R H;  1RLG A;  4O4J B;  1IV1 A;  2IG8 A;  3HKB A;  1FNK A;  2UYN B;  3OON A;  3S03 A;  1XHO A;  4O4L B;  1YQN A;  2L26 A;  3FFM A;  4C8G A;  2KGW A;  1W5E A;  1YIJ F;  2KTU A;  2MQE A;  2VAM A;  4X1Y B;  3NK7 A;  1IPA A;  4ERH A;  3S0Y A;  1SA0 B;  4O4H A;  1TUB B;  5J2T B;  2HQS C;  3QTY A;  1RA4 A;  3FPI A;  3HTN A;  3JAL B;  3MCA B;  4BW0 B;  3IEW A;  2G9I A;  1KQS F;  5JCO C;  1YHQ F;  3IKE A;  3CC2 F;  1X25 A;  3K2X A;  3SIU A;  4G4V A;  3CCM F;  1S72 F;  1W42 A;  3ERN A;  3E20 B;  4BT4 A;  2UYP A;  4DRX B;  1E7K A;  2EWC A;  2Z1F A;  3KHN A;  3QUW A;  4PWT A;  3F0E A;  3PAF A;  4I50 A;  1VQV A;  5KX5 A;  3K14 A;  3C9U A; 
#chains in the Genus database with same CATH homology
 1W55 A;  4C8E A;  3P10 A;  1JY8 A;  1T0A A;  1IV2 A;  3GHZ A;  3ESJ A;  3FBA A;  3F0D A;  1VH8 A;  1KNJ A;  3FPI A;  3F0F A;  3RE3 A;  5B8F A;  4C82 A;  1JN1 A;  3IEW A;  1U3P A;  3IKE A;  3K2X A;  2PMP A;  1VHA A;  3F0G A;  3KE1 A;  1IV4 A;  1IV1 A;  2AMT A;  3ELC A;  3EOR A;  1U3L A;  3ERN A;  3JVH A;  3B6N A;  3T80 A;  1IV3 A;  1YQN A;  1U40 A;  3IKF A;  2UZH A;  4C8G A;  3IEQ A;  1H48 A;  4C81 A;  3F0E A;  1W57 A;  1GX1 A;  3Q8H A;  3P0Z A;  1U43 A;  1H47 A;  3F6M A;  3MBM A;  3QHD A;  4C8I A;  1KNK A;  2GZL A;  3K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...