2H6LA

X-ray crystal structure of the metal-containing protein af0104 from archaeoglobus fulgidus. northeast structural genomics consortium target gr103.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLFLWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three dimensional structure of the hypothetical protein AF0104 at the 2.0 A resolution.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 28
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2h6lA00
4BT2A 4BT6A 1XV2A 4BT7A 4BT5A 2HX0A 2DT4A 4BT3A 3HWUA 4BT4A 3HTNA 2H6LA 2P6YA 2NMUA
chains in the Genus database with same CATH superfamily
3C9UA 3VMFB 3UT5B 2UYNB 1VQ6F 4U39A 3CCQF 1Q8RA 3R0PA 2RHJA 2K1SA 4WBNB 5LXTB 2CW4A 3QUWA 3ZP4A 5MN5A 3RYIA 3K2XA 2HS4A 5GIOC 4B5CA 3FFMA 4ZHVA 3JVHA 2CWJA 5FJ4C 2V9YA 2KG4A 5CB4B 2ZAUA 4G88A 3RYHB 4BT7A 1FSZA 3VCZA 3WGLA 3I55F 3QHDA 5GONA 5HY1A 1JFFB 1J7HA 4E6EA 1W581 1TVKA 2VGNA 2GVIA 1SA0B 1TUBA 1COMA 3CG6A 1ZWZA 4BVTA 3CMEF 3V4DA 4DRXA 3ZOPA 3K12A 4EB6A 4B46A 4HNAB 4I50B 4TUYB 1UFYA 4U3JA 1K8AH 3WGNA 2YYEA 1H7MA 5EB0A 1DT9A 1R1MA 4ERHA 1JY8A 5IYZA 1M90H 4O2BA 2BTOA 1Q7YH 3VI6A 3JAWA 4ZOLA 1CLIA 2DT4A 3VYTC 5JQGA 3FBAA 5HWEA 2UZHA 4ZHYB 1YJNF 3KIZA 4I55B 4EI9A 2H8EA 4BT5A 3JAWB 4ZOLB 4KWEA 3CYQA 4O4HA 1VQ7F 3CCRF 1YJ9F 2PMPA 3N2GB 1OFUA 3E1YA 1H48A 4O4IA 5KX5B 1FNKA 1S72F 2QI2A 4ZHQB 3VIUA 3NVKE 2KGWA 2ZVYA 5LOVA 1RLUA 3VO8A 2OHWA 4G4YA 1W5AA 5CA1A 1IV4A 1JJ2F 2CVLA 5LOVB 1QU9A 4BT6A 4BY9D 1W42A 3KHNA 2LBTA 3B6NA 5ITZB 1N8RH 3LWQC 5BMVA 3C8LA 3FD6A 5EWRA 4BW0B 3S03A 4YJ2A 4X1IB 4TZZA 1YQNA 1SDSA 2B33A 4O4JA 1GO1A 5A2QM 2L26A 3JATB 3D54A 3CCEF 3S06A 4O4LB 4YJ3B 5CA0B 1ONIA 3ZO8A 1CK2A 3CCJF 1VQ5F 1KD1H 1YJWF 3ESJA 4C8EA 1U3LA 3CCMF 1M1KH 4NUTA 4YJ3A 3N4YA 1YIJF 2VAWA 3O85A 4DXDA 1VQVA 3N2KB 3HKDA 3KE1A 4NWOB 3NK7A 3HKEA 4X3LA 4BVSA 2FGYA 4DRXB 5DCVA 4G4VA 1XBIA 2RHHA 2BO1A 3JAKB 2BTUA 3J7AR 4C8GA 3LWPC 4TV8A 3M1XA 3CMAF 2OTJF 5IYZB 1PF5A 2G9IA 3WGJA 1IV2A 4O2BB 1Q82H 3JASB 3CC4F 4O4HB 2R751 3D01A 4U3JB 2Q1YA 1RQ2A 3F0GA 3PLAC 2HS3A 1KNJA 2Z1UA 3RYFB 5JVDA 3F6MA 2CZWA 5EAZA 1QD9A 2BTQB 2UYNA 5EZYA 3VOAA 3MCAB 2KTVA 2Z1FA 4ZK7A 2VXYA 4I4TA 5LA6B 3CPWF 3MCQA 5EYPA 1XRGA 5IJ0B 3CYPB 3RYCB 3CPQA 2DYYA 3IKFA 2R6R1 1QAHA 1JN1A 5ITZA 3ZP7A 1U3PA 1Q86H 3SIUA 3HKBA 3ERNA 5LP6A 2CHTA 3C9RA 3WPWA 3U0OA 3T80A 3KJKA 4X20A 4IHJA 2HRYA 5B8FA 3HJWC 1RA4A 1KNKA 3GYQA 1Q81H 3HKCB 3IEWA 4NQ3A 1VQOF 2PHNA 4O4LA 1TVKB 3CC7F 2Z1EA 5BMVB 4IIJA 4B45A 4ZI7B 4F6RA 3P0ZA 5AVMA 4LNUB 3JAMM 4X1YA 1X52A 4X1IA 3M4SA 3UT5A 2WALA 3WPXA 4EI8A 2H6LA 5IT9M 4F6RB 4LNUA 4O2AB 3WGKA 1FFXB 3AGKA 3E22A 3HAXD 1IV1A 3EORA 2LCAA 2IG8A 2AIFA 2RHLA 3CXCF 3JAKA 2MQEA 5FNVB 4O2AA 3GHZA 2Q1XA 2KTUA 3JARA 3JALB 4BT2A 5CB4A 3LWOC 4G4XA 3WJQA 1UI9A 3IMPA 3K0TA 3RE3A 5JCOA 5G4VC 3LWRC 3IKEA 4BT4A 5HY0A 2W8BC 4O4IB 1E7KA 3VOBA 3V7QA 3LWVC 1PXWA 2UYPA 4BVQA 1JD1A 5MN6A 2ZF8A 3G6EF 2N48A 3D00A 4M8IA 5JQGB 4C4WC 1YGYA 3QTYA 1KQSF 3F0EA 1VQKF 4ZHWA 2CHSA 4PWTA 4I4TB 5LA6A 3ELCA 5EO3A 3MDOA 4IHJB 1VQPF 1VQNF 4RQOA 3RYCA 4X1KA 5IJ9A 3BYQA 1GO0A 4C8IA 2OTMA 3RYHA 1GX1A 5LP6B 4ZI7A 3J81M 4G4WA 3LMEA 3WXMB 4BVRA 5GINC 3J80M 1W5EA 1W2BF 1DBFA 5C8YB 3RYIB 4TV9A 3DC2A 3IEQA 2AMTA 1VHAA 3CB2A 3DDNA 2AIZP 5GAPK 1FNJA 3K14A 1FFXA 2VGMA 2ZVZA 3N4ZA 1T0KB 2ALEA 2IAFA 2F9ZC 3P4EA 1CN7A 3JARB 5G4UC 4YJ2B 1RQ7A 5HP7A 5HXZA 2FC3A 3G4SF 1SA0A 1GZ0A 3FPIA 1XV2A 1W59A 2VAPA 1TUBB 2LBWA 4IIJB 3F0FA 5EIBC 3VYSC 3KJJA 3RA5A 2OTLF 4R40B 1JFFA 1KC8H 1OAPA 1VK3A 3TD5A 3CD6F 4EB6B 4EI7A 1RLGA 1W3EX 1W5FA 2NMUA 2UYKA 3OBYA 3OONA 2UYJA 5J2TB 4LCKA 4BT3A 3JALA 3F0DA 3TD4A 5LP6C 3IR9A 3PAFA 2QEXF 2RHOA 4TV8B 3CC2F 5GIPC 1QVGF 3ON1A 3VYUC 5J2UA 3C9SA 3NVIB 3I3FA 1IPAA 1Z5WA 2HRUA 3V3TA 2RB9A 2Z01A 2HP0A 2HX0A 4FFBB 2EWCA 5JCOC 3N2KA 2Z1TA 3WJPA 3JASA 4I55A 2P6YA 4RHAA 3S0HA 1NQ3A 4XCQA 4X1KB 1QVFF 1XHOA 2HP0B 3E20B 3HTNA 3LFOA 5EYPB 5JVDB 3RYFA 1X7PA 1VQLF 4X3MA 3L7QA 5JH7A 1X25A 3S02A 3M84A 2JNBA 3LYBA 3V7EA 1NMUB 3WGMA 3I56F 4C82A 4X1YB 1K9MH 3HKBB 5KMGA 1NJIH 2ZODA 4G4ZA 2OZBA 3CCSF 3FD5A 3MBMA 4TV9B 2HVYD 5GONB 3JATA 3HKDB 1W41A 3S0WA 4WBNA 5LXTA 3LDTA 2I6RA 3Q8HA 5EIBD 3WJRA 5CA1B 1W55A 1ODEA 4B62A 2LBXA 3SIVA 3HWUA 1K73H 3JCMM 2QTPA 1T0AA 2CSLA 1W5BA 1VQ8F 3E22B 1VQMF 3GTZA 3OBWA 3I7TA 5EB1B 5CA0A 5FNVA 5MN4A 3CCUF 3MQWA 3HKCA 3NK6A 3RA6A 3TD3A 1YI2F 1YHQF 3CCLF 1H47A 2ZOVA 4O4JB 5EZYB 4HNAA 4I50A 4TUYA 1U43A 2VAMA 2HP3A 3VTIC 5HY2A 3NMUC 3CCVF 1YITF 2GZLA 1Z5VA 1VH8A 2YXZA 5J2TA 5J2UB 1W57A 2HS0A 5LYJB 3OW2F 1VQ9F 1IV3A 3HKEB 1X7OA 5HXUA 5HP8A 5IJ9B 2HQSC 4FFBA 3P10A 4ZHQA 3S0YA 2IQQA 4C81A 2H8CA 3C9TA 2I6DA 5LYJA 1VQ4F 1SZQA 2QA4F 3N2GA 5KX5A 5FLXM 1W40A 5HY4A 2GLZA 5C8YA 5IJ0A 5JH7B 5KMGB 3G71F 5GANK 1U40A 4X20B
chains in the Genus database with same CATH topology
4BT2A 4BT6A 1XV2A 4BT7A 4BT5A 2HX0A 2DT4A 4BT3A 3HWUA 4BT4A 3HTNA 2H6LA 2P6YA 2NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT2 A;  4BT6 A;  1XV2 A;  4BT7 A;  4BT5 A;  2HX0 A;  2DT4 A;  4BT3 A;  3HWU A;  4BT4 A;  3HTN A;  2H6L A;  2P6Y A;  2NMU A; 
#chains in the Genus database with same CATH topology
 3C9U A;  3VMF B;  3UT5 B;  2UYN B;  1VQ6 F;  4U39 A;  3CCQ F;  1Q8R A;  3R0P A;  2RHJ A;  2K1S A;  4WBN B;  5LXT B;  2CW4 A;  3QUW A;  3ZP4 A;  5MN5 A;  3RYI A;  3K2X A;  2HS4 A;  5GIO C;  4B5C A;  3FFM A;  4ZHV A;  3JVH A;  2CWJ A;  5FJ4 C;  2V9Y A;  2KG4 A;  5CB4 B;  2ZAU A;  4G88 A;  3RYH B;  4BT7 A;  1FSZ A;  3VCZ A;  3WGL A;  3I55 F;  3QHD A;  5GON A;  5HY1 A;  1JFF B;  1J7H A;  4E6E A;  1W58 1;  1TVK A;  2VGN A;  2GVI A;  1SA0 B;  1TUB A;  1COM A;  3CG6 A;  1ZWZ A;  4BVT A;  3CME F;  3V4D A;  4DRX A;  3ZOP A;  3K12 A;  4EB6 A;  4B46 A;  4HNA B;  4I50 B;  4TUY B;  1UFY A;  4U3J A;  1K8A H;  3WGN A;  2YYE A;  1H7M A;  5EB0 A;  1DT9 A;  1R1M A;  4ERH A;  1JY8 A;  5IYZ A;  1M90 H;  4O2B A;  2BTO A;  1Q7Y H;  3VI6 A;  3JAW A;  4ZOL A;  1CLI A;  2DT4 A;  3VYT C;  5JQG A;  3FBA A;  5HWE A;  2UZH A;  4ZHY B;  1YJN F;  3KIZ A;  4I55 B;  4EI9 A;  2H8E A;  4BT5 A;  3JAW B;  4ZOL B;  4KWE A;  3CYQ A;  4O4H A;  1VQ7 F;  3CCR F;  1YJ9 F;  2PMP A;  3N2G B;  1OFU A;  3E1Y A;  1H48 A;  4O4I A;  5KX5 B;  1FNK A;  1S72 F;  2QI2 A;  4ZHQ B;  3VIU A;  3NVK E;  2KGW A;  2ZVY A;  5LOV A;  1RLU A;  3VO8 A;  2OHW A;  4G4Y A;  1W5A A;  5CA1 A;  1IV4 A;  1JJ2 F;  2CVL A;  5LOV B;  1QU9 A;  4BT6 A;  4BY9 D;  1W42 A;  3KHN A;  2LBT A;  3B6N A;  5ITZ B;  1N8R H;  3LWQ C;  5BMV A;  3C8L A;  3FD6 A;  5EWR A;  4BW0 B;  3S03 A;  4YJ2 A;  4X1I B;  4TZZ A;  1YQN A;  1SDS A;  2B33 A;  4O4J A;  1GO1 A;  5A2Q M;  2L26 A;  3JAT B;  3D54 A;  3CCE F;  3S06 A;  4O4L B;  4YJ3 B;  5CA0 B;  1ONI A;  3ZO8 A;  1CK2 A;  3CCJ F;  1VQ5 F;  1KD1 H;  1YJW F;  3ESJ A;  4C8E A;  1U3L A;  3CCM F;  1M1K H;  4NUT A;  4YJ3 A;  3N4Y A;  1YIJ F;  2VAW A;  3O85 A;  4DXD A;  1VQV A;  3N2K B;  3HKD A;  3KE1 A;  4NWO B;  3NK7 A;  3HKE A;  4X3L A;  4BVS A;  2FGY A;  4DRX B;  5DCV A;  4G4V A;  1XBI A;  2RHH A;  2BO1 A;  3JAK B;  2BTU A;  3J7A R;  4C8G A;  3LWP C;  4TV8 A;  3M1X A;  3CMA F;  2OTJ F;  5IYZ B;  1PF5 A;  2G9I A;  3WGJ A;  1IV2 A;  4O2B B;  1Q82 H;  3JAS B;  3CC4 F;  4O4H B;  2R75 1;  3D01 A;  4U3J B;  2Q1Y A;  1RQ2 A;  3F0G A;  3PLA C;  2HS3 A;  1KNJ A;  2Z1U A;  3RYF B;  5JVD A;  3F6M A;  2CZW A;  5EAZ A;  1QD9 A;  2BTQ B;  2UYN A;  5EZY A;  3VOA A;  3MCA B;  2KTV A;  2Z1F A;  4ZK7 A;  2VXY A;  4I4T A;  5LA6 B;  3CPW F;  3MCQ A;  5EYP A;  1XRG A;  5IJ0 B;  3CYP B;  3RYC B;  3CPQ A;  2DYY A;  3IKF A;  2R6R 1;  1QAH A;  1JN1 A;  5ITZ A;  3ZP7 A;  1U3P A;  1Q86 H;  3SIU A;  3HKB A;  3ERN A;  5LP6 A;  2CHT A;  3C9R A;  3WPW A;  3U0O A;  3T80 A;  3KJK A;  4X20 A;  4IHJ A;  2HRY A;  5B8F A;  3HJW C;  1RA4 A;  1KNK A;  3GYQ A;  1Q81 H;  3HKC B;  3IEW A;  4NQ3 A;  1VQO F;  2PHN A;  4O4L A;  1TVK B;  3CC7 F;  2Z1E A;  5BMV B;  4IIJ A;  4B45 A;  4ZI7 B;  4F6R A;  3P0Z A;  5AVM A;  4LNU B;  3JAM M;  4X1Y A;  1X52 A;  4X1I A;  3M4S A;  3UT5 A;  2WAL A;  3WPX A;  4EI8 A;  2H6L A;  5IT9 M;  4F6R B;  4LNU A;  4O2A B;  3WGK A;  1FFX B;  3AGK A;  3E22 A;  3HAX D;  1IV1 A;  3EOR A;  2LCA A;  2IG8 A;  2AIF A;  2RHL A;  3CXC F;  3JAK A;  2MQE A;  5FNV B;  4O2A A;  3GHZ A;  2Q1X A;  2KTU A;  3JAR A;  3JAL B;  4BT2 A;  5CB4 A;  3LWO C;  4G4X A;  3WJQ A;  1UI9 A;  3IMP A;  3K0T A;  3RE3 A;  5JCO A;  5G4V C;  3LWR C;  3IKE A;  4BT4 A;  5HY0 A;  2W8B C;  4O4I B;  1E7K A;  3VOB A;  3V7Q A;  3LWV C;  1PXW A;  2UYP A;  4BVQ A;  1JD1 A;  5MN6 A;  2ZF8 A;  3G6E F;  2N48 A;  3D00 A;  4M8I A;  5JQG B;  4C4W C;  1YGY A;  3QTY A;  1KQS F;  3F0E A;  1VQK F;  4ZHW A;  2CHS A;  4PWT A;  4I4T B;  5LA6 A;  3ELC A;  5EO3 A;  3MDO A;  4IHJ B;  1VQP F;  1VQN F;  4RQO A;  3RYC A;  4X1K A;  5IJ9 A;  3BYQ A;  1GO0 A;  4C8I A;  2OTM A;  3RYH A;  1GX1 A;  5LP6 B;  4ZI7 A;  3J81 M;  4G4W A;  3LME A;  3WXM B;  4BVR A;  5GIN C;  3J80 M;  1W5E A;  1W2B F;  1DBF A;  5C8Y B;  3RYI B;  4TV9 A;  3DC2 A;  3IEQ A;  2AMT A;  1VHA A;  3CB2 A;  3DDN A;  2AIZ P;  5GAP K;  1FNJ A;  3K14 A;  1FFX A;  2VGM A;  2ZVZ A;  3N4Z A;  1T0K B;  2ALE A;  2IAF A;  2F9Z C;  3P4E A;  1CN7 A;  3JAR B;  5G4U C;  4YJ2 B;  1RQ7 A;  5HP7 A;  5HXZ A;  2FC3 A;  3G4S F;  1SA0 A;  1GZ0 A;  3FPI A;  1XV2 A;  1W59 A;  2VAP A;  1TUB B;  2LBW A;  4IIJ B;  3F0F A;  5EIB C;  3VYS C;  3KJJ A;  3RA5 A;  2OTL F;  4R40 B;  1JFF A;  1KC8 H;  1OAP A;  1VK3 A;  3TD5 A;  3CD6 F;  4EB6 B;  4EI7 A;  1RLG A;  1W3E X;  1W5F A;  2NMU A;  2UYK A;  3OBY A;  3OON A;  2UYJ A;  5J2T B;  4LCK A;  4BT3 A;  3JAL A;  3F0D A;  3TD4 A;  5LP6 C;  3IR9 A;  3PAF A;  2QEX F;  2RHO A;  4TV8 B;  3CC2 F;  5GIP C;  1QVG F;  3ON1 A;  3VYU C;  5J2U A;  3C9S A;  3NVI B;  3I3F A;  1IPA A;  1Z5W A;  2HRU A;  3V3T A;  2RB9 A;  2Z01 A;  2HP0 A;  2HX0 A;  4FFB B;  2EWC A;  5JCO C;  3N2K A;  2Z1T A;  3WJP A;  3JAS A;  4I55 A;  2P6Y A;  4RHA A;  3S0H A;  1NQ3 A;  4XCQ A;  4X1K B;  1QVF F;  1XHO A;  2HP0 B;  3E20 B;  3HTN A;  3LFO A;  5EYP B;  5JVD B;  3RYF A;  1X7P A;  1VQL F;  4X3M A;  3L7Q A;  5JH7 A;  1X25 A;  3S02 A;  3M84 A;  2JNB A;  3LYB A;  3V7E A;  1NMU B;  3WGM A;  3I56 F;  4C82 A;  4X1Y B;  1K9M H;  3HKB B;  5KMG A;  1NJI H;  2ZOD A;  4G4Z A;  2OZB A;  3CCS F;  3FD5 A;  3MBM A;  4TV9 B;  2HVY D;  5GON B;  3JAT A;  3HKD B;  1W41 A;  3S0W A;  4WBN A;  5LXT A;  3LDT A;  2I6R A;  3Q8H A;  5EIB D;  3WJR A;  5CA1 B;  1W55 A;  1ODE A;  4B62 A;  2LBX A;  3SIV A;  3HWU A;  1K73 H;  3JCM M;  2QTP A;  1T0A A;  2CSL A;  1W5B A;  1VQ8 F;  3E22 B;  1VQM F;  3GTZ A;  3OBW A;  3I7T A;  5EB1 B;  5CA0 A;  5FNV A;  5MN4 A;  3CCU F;  3MQW A;  3HKC A;  3NK6 A;  3RA6 A;  3TD3 A;  1YI2 F;  1YHQ F;  3CCL F;  1H47 A;  2ZOV A;  4O4J B;  5EZY B;  4HNA A;  4I50 A;  4TUY A;  1U43 A;  2VAM A;  2HP3 A;  3VTI C;  5HY2 A;  3NMU C;  3CCV F;  1YIT F;  2GZL A;  1Z5V A;  1VH8 A;  2YXZ A;  5J2T A;  5J2U B;  1W57 A;  2HS0 A;  5LYJ B;  3OW2 F;  1VQ9 F;  1IV3 A;  3HKE B;  1X7O A;  5HXU A;  5HP8 A;  5IJ9 B;  2HQS C;  4FFB A;  3P10 A;  4ZHQ A;  3S0Y A;  2IQQ A;  4C81 A;  2H8C A;  3C9T A;  2I6D A;  5LYJ A;  1VQ4 F;  1SZQ A;  2QA4 F;  3N2G A;  5KX5 A;  5FLX M;  1W40 A;  5HY4 A;  2GLZ A;  5C8Y A;  5IJ0 A;  5JH7 B;  5KMG B;  3G71 F;  5GAN K;  1U40 A;  4X20 B; 
#chains in the Genus database with same CATH homology
 4BT2 A;  4BT6 A;  1XV2 A;  4BT7 A;  4BT5 A;  2HX0 A;  2DT4 A;  4BT3 A;  3HWU A;  4BT4 A;  3HTN A;  2H6L A;  2P6Y A;  2NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...