2H6LA

X-ray crystal structure of the metal-containing protein af0104 from archaeoglobus fulgidus. northeast structural genomics consortium target gr103.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
140
structure length
140
Chain Sequence
MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLFLWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Three dimensional structure of the hypothetical protein AF0104 at the 2.0 A resolution.
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 28
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03479 DUF296 Plants and Prokaryotes Conserved (PCC) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.80 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 2h6lA00
4BT3A 4BT7A 4BT2A 3HTNA 2HX0A 4BT4A 4BT5A 1XV2A 3HWUA 2NMUA 2DT4A 2P6YA 4BT6A 2H6LA
chains in the Genus database with same CATH superfamily
5JVDB 4BT3A 4FFBB 3F0GA 5MN4A 5J2UB 4R40B 3CCMF 1XHOA 3JARB 2GLZA 1Q81H 4BT2A 5KX5A 2CVLA 3KIZA 1KQSF 4LNUB 1VQVA 2L26A 3P4EA 2QTPA 4M8IA 4DXDA 2ZVZA 3N2GA 4I50B 1ZWZA 1KNKA 4X1KB 2HS4A 3HKBB 1GX1A 3RYHA 5FLXM 3RE3A 5LOVB 3G6EF 3V3TA 3R0PA 3JALA 2RHHA 1SA0B 4X1YB 2AMTA 3F6MA 3WJPA 1Z5WA 1YQNA 2IG8A 3BYQA 4TV8B 3F0FA 3FD6A 3C8LA 1R1MA 4TUYB 5AVMA 1M1KH 4IIJA 5HXZA 4X20A 1NQ3A 1JY8A 1YJNF 1VH8A 4TZZA 3S0YA 3IKFA 3HKCA 1YITF 4BVTA 5IJ9B 5G4UC 5KMGA 3JAWB 5EYPA 3RYCB 1GO1A 2OTJF 4U3JA 1DT9A 3WXMB 3ZOPA 3HAXD 4WBNB 4X3LA 4I4TA 2UYNB 5HP7A 3GHZA 3CMEF 3HKEA 2W8BC 3PAFA 1NMUB 5EWRA 1YGYA 1W3EX 3E22A 3DDNA 2QA4F 2VAWA 4G4WA 5LXTA 2YYEA 3VYTC 5GANK 4O4LB 5A2QM 5HWEA 3N2KB 4TV9B 5EZYA 1VQPF 1SDSA 2LBXA 4X1IA 3U0OA 3CPWF 5DCVA 2V9YA 5KX5B 2N48A 5EB0A 1W42A 4B5CA 2UYJA 3CCSF 3CMAF 4O4IA 5IT9M 3KHNA 3LWOC 3N2GB 2Z1FA 3RYHB 3JVHA 5G4VC 4ZOLA 4F6RA 5BMVA 1TUBA 4ZHWA 5HY2A 1XRGA 3OONA 4BW0B 2Q1YA 5FNVA 3JALB 3ZP4A 1VK3A 3IEWA 1IV2A 4G4VA 1FNJA 3JATA 5C8YA 5JH7A 3CCUF 3I55F 2ZOVA 4IIJB 4X20B 3Q8HA 1Q8RA 3LFOA 1W41A 3C9UA 3M1XA 4E6EA 2RHJA 1YJWF 3HKCB 3VO8A 4ZI7A 1T0AA 5KMGB 1U40A 5EYPB 1VQMF 1E7KA 3P10A 4U3JB 5GAPK 1Q7YH 2MQEA 3C9RA 4I4TB 1RQ2A 4C4WC 4C8EA 2FC3A 3HKEB 4B46A 4YJ2A 3J80M 3S0WA 3MDOA 3DC2A 3E22B 1K73H 1J7HA 3RA5A 3S02A 2HP3A 3IEQA 4YJ3A 5LXTB 3G4SF 1W55A 1VQ7F 3JAKA 3WPWA 2DYYA 1FSZA 1RQ7A 2VGMA 5JQGA 1VQ8F 5EZYB 4BT4A 1UI9A 2BTOA 5JCOA 1QU9A 1IV4A 4X1IB 1OAPA 2ZF8A 2HVYD 3MBMA 2Z1EA 4EI7A 2CHSA 4O4IB 5FJ4C 3PLAC 3LWPC 1W5BA 2NMUA 4EB6A 1PF5A 2ZVYA 3FPIA 5B8FA 1QAHA 2G9IA 4ZOLB 4F6RB 5BMVB 4B45A 1TUBB 3VTIC 3VOAA 3CCEF 3GTZA 2R6R1 5FNVB 4BY9D 4XCQA 3TD5A 2CZWA 3QTYA 2RB9A 3JATB 5J2TA 2GVIA 1X7PA 1COMA 1Z5VA 2Z1TA 5C8YB 5JH7B 1KNJA 4ZHVA 3UT5A 3IMPA 5CA1A 2LBTA 4O4JA 3T80A 4ZI7B 5CA0A 4B62A 4BT7A 4O4HA 4BT5A 3P0ZA 4X3MA 3LWRC 5EIBD 1CN7A 5JCOC 1IV1A 2UZHA 2PHNA 1W2BF 4YJ2B 4BT6A 3M4SA 1DBFA 4EI9A 2HS0A 1VHAA 1W57A 2AIZP 4C8GA 1IV3A 2CSLA 2HP0A 4YJ3B 1H47A 3LYBA 1VQ5F 2ZAUA 3AGKA 3JAKB 3S03A 3ELCA 2IAFA 3QUWA 5JQGB 1VQ4F 3CYQA 3LDTA 3I7TA 1YIJF 2VAMA 3CB2A 3FBAA 3JCMM 1OFUA 3OBWA 1YI2F 1VQ6F 1RA4A 5HP8A 4ZK7A 1SZQA 3ESJA 3KJKA 3CC7F 1VQNF 3IR9A 3KE1A 3WJQA 5CB4A 1YHQF 1YJ9F 2P6YA 1QD9A 4EB6B 2BO1A 1K9MH 3K14A 3HJWC 3NMUC 2FGYA 3WPXA 3C9TA 2LCAA 1VQOF 3CCLF 5J2TB 2GZLA 1RLUA 3WGNA 4BVSA 1QVGF 3D00A 1Q82H 2CWJA 3OBYA 3NVKE 1W5EA 3VIUA 3HKDA 5LP6A 3V7EA 4BVQA 4NQ3A 3UT5B 1N8RH 1QVFF 5CA1B 1X25A 3MCQA 4O4JB 5CA0B 4I55A 4O4HB 4HNAA 3TD4A 1U3PA 3ON1A 3VYUC 5LYJA 2LBWA 1FFXA 2RHLA 5MN6A 1W59A 3TD3A 2BTQB 2VGNA 3O85A 4C82A 2F9ZC 1IPAA 2DT4A 2HP0B 2KGWA 2BTUA 3CCJF 2KTVA 3JASA 2QI2A 1FNKA 2HX0A 2H8CA 1NJIH 3J7AR 4KWEA 3V4DA 2IQQA 3E1YA 2I6DA 1RLGA 3N4YA 2Z1UA 4RQOA 2OHWA 3E20B 5EIBC 2UYKA 3NVIB 3CYPB 3K2XA 2VXYA 1VQLF 2HRUA 2Z01A 1GO0A 4G4YA 3LWVC 5LP6C 3MQWA 1UFYA 5CB4B 3S06A 3CC4F 2OTMA 2WALA 5IYZA 3NK7A 3VYSC 1XV2A 3VI6A 3VMFB 2ALEA 5GONA 2B33A 1W40A 3FFMA 2KTUA 3HWUA 3CPQA 4O2BA 2OZBA 1W581 3RA6A 1CLIA 3WGKA 5IJ0A 1KC8H 2I6RA 4O2AA 1TVKA 3G71F 2Q1XA 4NUTA 3HKDB 3L7QA 5HY0A 5LP6B 2CW4A 3WGLA 5GINC 4DRXA 2RHOA 2VAPA 5LA6A 3RYFA 5HXUA 4I55B 3B6NA 2HS3A 3J81M 2AIFA 4IHJA 2ZODA 4HNAB 1JFFA 5ITZA 2R751 1X7OA 3IKEA 4ZHQA 5LYJB 1FFXB 2JNBA 5MN5A 3KJJA 3HTNA 5EB1B 3ZO8A 5HY1A 2UYPA 2YXZA 1M90H 3I3FA 3RYIA 1KD1H 1H48A 5JVDA 4FFBA 2CHTA 5J2UA 2K1SA 3JARA 1JN1A 2PMPA 3ERNA 1CK2A 3CCRF 1XBIA 3JASB 4LNUA 4PWTA 2OTLF 4G88A 3QHDA 4C81A 5EO3A 2HRYA 3D01A 4G4XA 4I50A 1W5AA 4U39A 4X1KA 3CG6A 5EAZA 3HKBA 1PXWA 5GIOC 3CCVF 3GYQA 3MCAB 3NK6A 4NWOB 2QEXF 1JD1A 1X52A 4ERHA 5LOVA 3CXCF 1SA0A 4X1YA 3LWQC 4TV8A 1ONIA 3I56F 1VQ9F 4TUYA 1JJ2F 3VCZA 5IYZB 4G4ZA 1S72F 3EORA 5GONB 3S0HA 3CCQF 5HY4A 3M84A 3VOBA 1Q86H 5IJ9A 4LCKA 3JAWA 4O2BB 3RYCA 3F0DA 5GIPC 3WGMA 3OW2F 3CD6F 4WBNA 1W5FA 3ZP7A 1T0KB 5IJ0B 1K8AH 2UYNA 3N4ZA 4O2AB 1TVKB 3V7QA 4EI8A 3CC2F 1U43A 3SIVA 2EWCA 4C8IA 1VQKF 1GZ0A 2H8EA 3LMEA 4DRXB 3SIUA 3FD5A 5LA6B 3RYFB 1ODEA 1U3LA 3WGJA 3WJRA 3JAMM 4IHJB 1JFFB 2KG4A 3C9SA 3D54A 3K0TA 5ITZB 2H6LA 4ZHQB 4O4LA 4ZHYB 4RHAA 2HQSC 3N2KA 3K12A 4TV9A 4BVRA 3RYIB 3F0EA 1H7MA
chains in the Genus database with same CATH topology
4BT3A 4BT7A 4BT2A 3HTNA 2HX0A 4BT4A 4BT5A 1XV2A 3HWUA 2NMUA 2DT4A 2P6YA 4BT6A 2H6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BT3 A;  4BT7 A;  4BT2 A;  3HTN A;  2HX0 A;  4BT4 A;  4BT5 A;  1XV2 A;  3HWU A;  2NMU A;  2DT4 A;  2P6Y A;  4BT6 A;  2H6L A; 
#chains in the Genus database with same CATH topology
 5JVD B;  4BT3 A;  4FFB B;  3F0G A;  5MN4 A;  5J2U B;  4R40 B;  3CCM F;  1XHO A;  3JAR B;  2GLZ A;  1Q81 H;  4BT2 A;  5KX5 A;  2CVL A;  3KIZ A;  1KQS F;  4LNU B;  1VQV A;  2L26 A;  3P4E A;  2QTP A;  4M8I A;  4DXD A;  2ZVZ A;  3N2G A;  4I50 B;  1ZWZ A;  1KNK A;  4X1K B;  2HS4 A;  3HKB B;  1GX1 A;  3RYH A;  5FLX M;  3RE3 A;  5LOV B;  3G6E F;  3V3T A;  3R0P A;  3JAL A;  2RHH A;  1SA0 B;  4X1Y B;  2AMT A;  3F6M A;  3WJP A;  1Z5W A;  1YQN A;  2IG8 A;  3BYQ A;  4TV8 B;  3F0F A;  3FD6 A;  3C8L A;  1R1M A;  4TUY B;  5AVM A;  1M1K H;  4IIJ A;  5HXZ A;  4X20 A;  1NQ3 A;  1JY8 A;  1YJN F;  1VH8 A;  4TZZ A;  3S0Y A;  3IKF A;  3HKC A;  1YIT F;  4BVT A;  5IJ9 B;  5G4U C;  5KMG A;  3JAW B;  5EYP A;  3RYC B;  1GO1 A;  2OTJ F;  4U3J A;  1DT9 A;  3WXM B;  3ZOP A;  3HAX D;  4WBN B;  4X3L A;  4I4T A;  2UYN B;  5HP7 A;  3GHZ A;  3CME F;  3HKE A;  2W8B C;  3PAF A;  1NMU B;  5EWR A;  1YGY A;  1W3E X;  3E22 A;  3DDN A;  2QA4 F;  2VAW A;  4G4W A;  5LXT A;  2YYE A;  3VYT C;  5GAN K;  4O4L B;  5A2Q M;  5HWE A;  3N2K B;  4TV9 B;  5EZY A;  1VQP F;  1SDS A;  2LBX A;  4X1I A;  3U0O A;  3CPW F;  5DCV A;  2V9Y A;  5KX5 B;  2N48 A;  5EB0 A;  1W42 A;  4B5C A;  2UYJ A;  3CCS F;  3CMA F;  4O4I A;  5IT9 M;  3KHN A;  3LWO C;  3N2G B;  2Z1F A;  3RYH B;  3JVH A;  5G4V C;  4ZOL A;  4F6R A;  5BMV A;  1TUB A;  4ZHW A;  5HY2 A;  1XRG A;  3OON A;  4BW0 B;  2Q1Y A;  5FNV A;  3JAL B;  3ZP4 A;  1VK3 A;  3IEW A;  1IV2 A;  4G4V A;  1FNJ A;  3JAT A;  5C8Y A;  5JH7 A;  3CCU F;  3I55 F;  2ZOV A;  4IIJ B;  4X20 B;  3Q8H A;  1Q8R A;  3LFO A;  1W41 A;  3C9U A;  3M1X A;  4E6E A;  2RHJ A;  1YJW F;  3HKC B;  3VO8 A;  4ZI7 A;  1T0A A;  5KMG B;  1U40 A;  5EYP B;  1VQM F;  1E7K A;  3P10 A;  4U3J B;  5GAP K;  1Q7Y H;  2MQE A;  3C9R A;  4I4T B;  1RQ2 A;  4C4W C;  4C8E A;  2FC3 A;  3HKE B;  4B46 A;  4YJ2 A;  3J80 M;  3S0W A;  3MDO A;  3DC2 A;  3E22 B;  1K73 H;  1J7H A;  3RA5 A;  3S02 A;  2HP3 A;  3IEQ A;  4YJ3 A;  5LXT B;  3G4S F;  1W55 A;  1VQ7 F;  3JAK A;  3WPW A;  2DYY A;  1FSZ A;  1RQ7 A;  2VGM A;  5JQG A;  1VQ8 F;  5EZY B;  4BT4 A;  1UI9 A;  2BTO A;  5JCO A;  1QU9 A;  1IV4 A;  4X1I B;  1OAP A;  2ZF8 A;  2HVY D;  3MBM A;  2Z1E A;  4EI7 A;  2CHS A;  4O4I B;  5FJ4 C;  3PLA C;  3LWP C;  1W5B A;  2NMU A;  4EB6 A;  1PF5 A;  2ZVY A;  3FPI A;  5B8F A;  1QAH A;  2G9I A;  4ZOL B;  4F6R B;  5BMV B;  4B45 A;  1TUB B;  3VTI C;  3VOA A;  3CCE F;  3GTZ A;  2R6R 1;  5FNV B;  4BY9 D;  4XCQ A;  3TD5 A;  2CZW A;  3QTY A;  2RB9 A;  3JAT B;  5J2T A;  2GVI A;  1X7P A;  1COM A;  1Z5V A;  2Z1T A;  5C8Y B;  5JH7 B;  1KNJ A;  4ZHV A;  3UT5 A;  3IMP A;  5CA1 A;  2LBT A;  4O4J A;  3T80 A;  4ZI7 B;  5CA0 A;  4B62 A;  4BT7 A;  4O4H A;  4BT5 A;  3P0Z A;  4X3M A;  3LWR C;  5EIB D;  1CN7 A;  5JCO C;  1IV1 A;  2UZH A;  2PHN A;  1W2B F;  4YJ2 B;  4BT6 A;  3M4S A;  1DBF A;  4EI9 A;  2HS0 A;  1VHA A;  1W57 A;  2AIZ P;  4C8G A;  1IV3 A;  2CSL A;  2HP0 A;  4YJ3 B;  1H47 A;  3LYB A;  1VQ5 F;  2ZAU A;  3AGK A;  3JAK B;  3S03 A;  3ELC A;  2IAF A;  3QUW A;  5JQG B;  1VQ4 F;  3CYQ A;  3LDT A;  3I7T A;  1YIJ F;  2VAM A;  3CB2 A;  3FBA A;  3JCM M;  1OFU A;  3OBW A;  1YI2 F;  1VQ6 F;  1RA4 A;  5HP8 A;  4ZK7 A;  1SZQ A;  3ESJ A;  3KJK A;  3CC7 F;  1VQN F;  3IR9 A;  3KE1 A;  3WJQ A;  5CB4 A;  1YHQ F;  1YJ9 F;  2P6Y A;  1QD9 A;  4EB6 B;  2BO1 A;  1K9M H;  3K14 A;  3HJW C;  3NMU C;  2FGY A;  3WPX A;  3C9T A;  2LCA A;  1VQO F;  3CCL F;  5J2T B;  2GZL A;  1RLU A;  3WGN A;  4BVS A;  1QVG F;  3D00 A;  1Q82 H;  2CWJ A;  3OBY A;  3NVK E;  1W5E A;  3VIU A;  3HKD A;  5LP6 A;  3V7E A;  4BVQ A;  4NQ3 A;  3UT5 B;  1N8R H;  1QVF F;  5CA1 B;  1X25 A;  3MCQ A;  4O4J B;  5CA0 B;  4I55 A;  4O4H B;  4HNA A;  3TD4 A;  1U3P A;  3ON1 A;  3VYU C;  5LYJ A;  2LBW A;  1FFX A;  2RHL A;  5MN6 A;  1W59 A;  3TD3 A;  2BTQ B;  2VGN A;  3O85 A;  4C82 A;  2F9Z C;  1IPA A;  2DT4 A;  2HP0 B;  2KGW A;  2BTU A;  3CCJ F;  2KTV A;  3JAS A;  2QI2 A;  1FNK A;  2HX0 A;  2H8C A;  1NJI H;  3J7A R;  4KWE A;  3V4D A;  2IQQ A;  3E1Y A;  2I6D A;  1RLG A;  3N4Y A;  2Z1U A;  4RQO A;  2OHW A;  3E20 B;  5EIB C;  2UYK A;  3NVI B;  3CYP B;  3K2X A;  2VXY A;  1VQL F;  2HRU A;  2Z01 A;  1GO0 A;  4G4Y A;  3LWV C;  5LP6 C;  3MQW A;  1UFY A;  5CB4 B;  3S06 A;  3CC4 F;  2OTM A;  2WAL A;  5IYZ A;  3NK7 A;  3VYS C;  1XV2 A;  3VI6 A;  3VMF B;  2ALE A;  5GON A;  2B33 A;  1W40 A;  3FFM A;  2KTU A;  3HWU A;  3CPQ A;  4O2B A;  2OZB A;  1W58 1;  3RA6 A;  1CLI A;  3WGK A;  5IJ0 A;  1KC8 H;  2I6R A;  4O2A A;  1TVK A;  3G71 F;  2Q1X A;  4NUT A;  3HKD B;  3L7Q A;  5HY0 A;  5LP6 B;  2CW4 A;  3WGL A;  5GIN C;  4DRX A;  2RHO A;  2VAP A;  5LA6 A;  3RYF A;  5HXU A;  4I55 B;  3B6N A;  2HS3 A;  3J81 M;  2AIF A;  4IHJ A;  2ZOD A;  4HNA B;  1JFF A;  5ITZ A;  2R75 1;  1X7O A;  3IKE A;  4ZHQ A;  5LYJ B;  1FFX B;  2JNB A;  5MN5 A;  3KJJ A;  3HTN A;  5EB1 B;  3ZO8 A;  5HY1 A;  2UYP A;  2YXZ A;  1M90 H;  3I3F A;  3RYI A;  1KD1 H;  1H48 A;  5JVD A;  4FFB A;  2CHT A;  5J2U A;  2K1S A;  3JAR A;  1JN1 A;  2PMP A;  3ERN A;  1CK2 A;  3CCR F;  1XBI A;  3JAS B;  4LNU A;  4PWT A;  2OTL F;  4G88 A;  3QHD A;  4C81 A;  5EO3 A;  2HRY A;  3D01 A;  4G4X A;  4I50 A;  1W5A A;  4U39 A;  4X1K A;  3CG6 A;  5EAZ A;  3HKB A;  1PXW A;  5GIO C;  3CCV F;  3GYQ A;  3MCA B;  3NK6 A;  4NWO B;  2QEX F;  1JD1 A;  1X52 A;  4ERH A;  5LOV A;  3CXC F;  1SA0 A;  4X1Y A;  3LWQ C;  4TV8 A;  1ONI A;  3I56 F;  1VQ9 F;  4TUY A;  1JJ2 F;  3VCZ A;  5IYZ B;  4G4Z A;  1S72 F;  3EOR A;  5GON B;  3S0H A;  3CCQ F;  5HY4 A;  3M84 A;  3VOB A;  1Q86 H;  5IJ9 A;  4LCK A;  3JAW A;  4O2B B;  3RYC A;  3F0D A;  5GIP C;  3WGM A;  3OW2 F;  3CD6 F;  4WBN A;  1W5F A;  3ZP7 A;  1T0K B;  5IJ0 B;  1K8A H;  2UYN A;  3N4Z A;  4O2A B;  1TVK B;  3V7Q A;  4EI8 A;  3CC2 F;  1U43 A;  3SIV A;  2EWC A;  4C8I A;  1VQK F;  1GZ0 A;  2H8E A;  3LME A;  4DRX B;  3SIU A;  3FD5 A;  5LA6 B;  3RYF B;  1ODE A;  1U3L A;  3WGJ A;  3WJR A;  3JAM M;  4IHJ B;  1JFF B;  2KG4 A;  3C9S A;  3D54 A;  3K0T A;  5ITZ B;  2H6L A;  4ZHQ B;  4O4L A;  4ZHY B;  4RHA A;  2HQS C;  3N2K A;  3K12 A;  4TV9 A;  4BVR A;  3RYI B;  3F0E A;  1H7M A; 
#chains in the Genus database with same CATH homology
 4BT3 A;  4BT7 A;  4BT2 A;  3HTN A;  2HX0 A;  4BT4 A;  4BT5 A;  1XV2 A;  3HWU A;  2NMU A;  2DT4 A;  2P6Y A;  4BT6 A;  2H6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...