2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosome, hydrolase
molecule keywords 50S ribosomal protein L7Ae
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
1S72F 3CG6A 5G4UC 4BW0B 1T0KB 3VMFB 1YI2F 2AIFA 1VQOF 3J80M 4LCKA 3LFOA 3JAMM 1W2BF 3LWVC 1E7KA 1GZ0A 3CCLF 3J81M 3RA5A 2KTUA 1GO1A 5FLXM 1K73H 1VQNF 3V7EA 1QVGF 1ZWZA 2KTVA 3VI6A 2WALA 5GIPC 1VQLF 3CMAF 2OTLF 2ALEA 3CPWF 1VQPF 3JCMM 1Q7YH 3CCJF 5DCVA 1VQ4F 3CD6F 1YJNF 2JNBA 3CCRF 2VGMA 1VQ5F 5GANK 1CK2A 1RA4A 3G4SF 3RA6A 1XBIA 1X7PA 3OBWA 3LWQC 3CCUF 1JJ2F 3I55F 3E1YA 3G71F 1SDSA 4C4WC 1DT9A 1CN7A 1GO0A 1N8RH 3CC4F 2QA4F 5GIOC 1YIJF 3J7AR 3HAXD 3CC2F 3OBYA 5EO3A 1X52A 4NUTA 3OW2F 2CZWA 2VGNA 3MCAB 1VQ9F 5G4VC 4X3LA 3SIUA 3CXCF 1YITF 5A2QM 3NK6A 3NVIB 1QVFF 1W41A 1VQ8F 1KQSF 3AGKA 3PAFA 4BY9D 3NK7A 3CCVF 1VQKF 5GAPK 1RLGA 3PLAC 1VQMF 1KC8H 1W40A 2QI2A 2OTJF 1K9MH 3IR9A 2KG4A 3E20B 1Q86H 3N4ZA 1Q81H 2I6DA 2LBWA 3WXMB 5GINC 3LWRC 3CC7F 4X3MA 3I56F 3O85A 5FJ4C 3HJWC 3LWOC 1W3EX 1YJ9F 1Q82H 3SIVA 1K8AH 3N4YA 1VQ7F 4TZZA 1YHQF 1PXWA 1NJIH 2LBXA 3NMUC 5IT9M 3CPQA 1W42A 3CCMF 3CMEF 1M1KH 2OHWA 1KD1H 2OZBA 2HVYD 3V7QA 2BO1A 1NMUB 3CCQF 3FFMA 3G6EF 5EWRA 3LWPC 1X7OA 3ON1A 2QEXF 1YJWF 3NVKE 2FC3A 1H7MA 3GYQA 1VQ6F 3CCEF 1M90H 3CCSF 1IPAA
chains in the Genus database with same CATH superfamily
3CG6A 2RHOA 2NMUA 3F6MA 2IQQA 4TV9A 3VMFB 1XHOA 4ZI7A 5LA6B 4YJ2B 1Q8RA 4C81A 3WGNA 1J7HA 3JAMM 2HP0B 4X1YA 3K14A 1GO1A 1VQNF 3N2KA 5AVMA 1ZWZA 3N2GA 1H47A 1VQLF 2ALEA 2CVLA 3KHNA 3D01A 3RYIB 5CB4B 3WGMA 3ZP7A 5IJ0B 2CW4A 3C8LA 2JNBA 5C8YA 2VGMA 3MBMA 2PMPA 3JALA 2LBTA 1VQ5F 3ESJA 3KJJA 4XCQA 2RHJA 4G4ZA 3KE1A 1XBIA 3DC2A 3OONA 4ZOLA 3RYCA 4O4LB 2GVIA 2HX0A 4ERHA 1VQVA 3RYHB 3E1YA 4EB6B 1DT9A 1FFXB 3FD5A 5MN6A 1CN7A 3E22A 1GX1A 1PF5A 3QUWA 3RYCB 1N8RH 5LOVB 3CC4F 1IV2A 2YYEA 4EI7A 5GIOC 4U3JB 4DXDA 4PWTA 4X20B 3S0HA 3CC2F 4LNUA 3OBYA 5EO3A 1X52A 3MCAB 3WGJA 3N2GB 2FGYA 1YITF 2CHSA 4X20A 3IEQA 1QVFF 4X1YB 4TUYA 5LOVA 1KQSF 2R6R1 4DRXA 2UYKA 3CCVF 4X1IA 2HS3A 5HP8A 5LA6A 2HQSC 1W40A 2Z1UA 3WPWA 1K9MH 4I50A 5EAZA 3LWRC 4X3MA 3D54A 5FJ4C 2CHTA 1W3EX 4ZHQA 1YJ9F 4TUYB 2R751 5LP6B 1IV4A 1YHQF 1SA0B 4BT6A 1IV3A 1VH8A 5FNVA 3CPQA 5LP6A 3F0DA 2H6LA 3CMEF 1QAHA 2MQEA 4YJ3A 3D00A 4U3JA 3V7QA 5ITZA 5GONB 1NMUB 5LXTA 3E22B 1TUBB 3ON1A 4B46A 4C8EA 4TV8B 3CCSF 5G4UC 5HY1A 4BW0B 3WGLA 4B45A 1YI2F 4RQOA 4G4WA 4C82A 2Q1XA 5HP7A 4B5CA 3VCZA 1W2BF 3LWVC 1E7KA 2RB9A 3VYSC 5BMVA 2VAPA 1XV2A 2KTUA 5J2TB 1YQNA 4LNUB 3K2XA 2KTVA 3TD4A 2WALA 3FBAA 1RQ7A 1VQPF 3JCMM 1Q7YH 5LP6C 3U0OA 1VQ4F 3JASA 1W5FA 4O4JA 5J2UB 3CCRF 1TVKB 4ZI7B 2ZOVA 1CLIA 3JASB 5IYZB 3ZO8A 3G4SF 1RA4A 3RA6A 3WGKA 5EB0A 2H8EA 2P6YA 5ITZB 2F9ZC 3S0YA 1SDSA 4I55A 3VYTC 5KX5B 3MDOA 5IJ0A 5FNVB 2QA4F 5CB4A 2OTMA 1JFFB 2DYYA 2BTUA 3HAXD 3J7AR 3WJQA 4NUTA 2ZF8A 4G4YA 2CZWA 2N48A 3HKDA 1VQ9F 4X1KB 1KNKA 4BVQA 4O4IA 3Q8HA 5LYJB 1W41A 1VQ8F 1RLUA 3PAFA 2UZHA 3NK7A 5LXTB 1VQKF 4BY9D 3PLAC 1VQMF 1XRGA 3M4SA 2PHNA 2HS0A 2OTJF 3F0EA 4DRXB 3IR9A 3CB2A 4ZHWA 2KG4A 4E6EA 4O2BB 1U40A 3VIUA 2I6DA 2ZVYA 5GINC 2VAWA 1W59A 5J2TA 3HJWC 4TZZA 1FNJA 3IKEA 4I55B 4I4TB 3CYPB 3C9TA 3RE3A 3HKBA 1NJIH 2LBXA 3JATA 5HY4A 5HXUA 2BTOA 5CA0A 2Z1EA 3CYQA 2DT4A 4NWOB 2OZBA 4O4LA 3CCQF 3FFMA 4O4JB 4BT7A 4IHJB 5JCOC 3QHDA 3GTZA 2L26A 5IJ9A 3HTNA 1YJWF 3JALB 3TD3A 2KGWA 3IMPA 2FC3A 4I4TA 5GONA 3GYQA 4EI8A 1VQ6F 1IPAA 5JVDB 1S72F 2CWJA 1T0KB 3IEWA 2AIFA 5JQGB 1VQOF 3C9UA 2YXZA 2BTQB 3LFOA 1GZ0A 4O2BA 3J81M 3CCLF 5IJ9B 3ERNA 4YJ2A 3V7EA 3RYHA 5JCOA 1FSZA 1R1MA 4O2AA 3CPWF 2V9YA 3CCJF 5DCVA 3P4EA 3CD6F 3P0ZA 5EIBC 5HXZA 3HKBB 3MCQA 4G4XA 2EWCA 3HKDB 3MQWA 1W5AA 5HY0A 3KIZA 1W5EA 3HKCB 5MN5A 2VXYA 4FFBB 3GHZA 1X7PA 2IAFA 3C9RA 3OBWA 5EZYA 1X25A 2CSLA 3LWQC 3CCUF 1JJ2F 3G71F 3HKCA 1W581 3TD5A 1U43A 3EORA 3HWUA 1COMA 4BT4A 4IIJB 2ZODA 1YIJF 3KJKA 4BVTA 5MN4A 5EYPA 2LCAA 4O2AB 2IG8A 5G4VC 2W8BC 4X3LA 2UYPA 2K1SA 1QD9A 3NK6A 3UT5A 3AGKA 1RLGA 3I7TA 5GAPK 4EI9A 2B33A 1KC8H 4FFBA 5KMGA 2QI2A 3RYIA 1OAPA 5HWEA 1W57A 5KX5A 5JVDA 2UYJA 3I56F 3N2KB 3O85A 3LWOC 1Q82H 4IHJA 3SIVA 5JH7B 3N4YA 3ZOPA 1VQ7F 2UYNA 1JD1A 1Z5VA 4EB6A 4TV8A 3B6NA 1TVKA 2VAMA 3WPXA 3NMUC 5JH7A 2QTPA 3ZP4A 4G88A 5LYJA 1TUBA 1RQ2A 1M1KH 2OHWA 1KD1H 4RHAA 3K0TA 2HVYD 3M1XA 2BO1A 3S0WA 4C8GA 4NQ3A 4HNAB 2Z1FA 4X1KA 4YJ3B 5EWRA 2RHLA 5EIBD 3LWPC 5BMVB 2QEXF 4ZHVA 3LMEA 4B62A 1H7MA 3F0FA 2GZLA 3WJRA 1M90H 1JFFA 2ZAUA 5IT9M 1YGYA 4BT3A 2HP0A 3S06A 1UFYA 2RHHA 1SZQA 5EB1B 3I3FA 3S02A 3J80M 4LCKA 2H8CA 4ZHYB 4I50B 2AMTA 2I6RA 5IYZA 4O4IB 3RA5A 3M84A 5FLXM 1K73H 3RYFB 1JY8A 4R40B 1QVGF 2Z1TA 4F6RA 3LYBA 3VI6A 5GIPC 3CMAF 1OFUA 2OTLF 3HKEB 2HS4A 1YJNF 5EZYB 3T80A 1H48A 3VOAA 3JAWB 5GANK 1CK2A 3V4DA 5B8FA 3WJPA 4U39A 1IV1A 2G9IA 3V3TA 3S03A 4O4HA 3I55F 3FD6A 3RYFA 4C4WC 1UI9A 5HY2A 1GO0A 3JAKA 1FFXA 3BYQA 5J2UA 2HRUA 3OW2F 4WBNA 4BVSA 2VGNA 1VK3A 3JATB 4BT5A 4BT2A 3SIUA 3CXCF 2GLZA 5JQGA 4O4HB 3VOBA 5A2QM 1ONIA 2ZVZA 3QTYA 2Q1YA 3NVIB 3C9SA 1VHAA 5KMGB 4HNAA 4C8IA 4BVRA 1SA0A 3VO8A 4ZHQB 3K12A 3VYUC 4WBNB 3E20B 1Q86H 3N4ZA 1Q81H 3L7QA 2LBWA 3FPIA 4M8IA 3WXMB 3CC7F 4TV9B 3JVHA 2UYNB 1FNKA 1KNJA 3JAKB 4ZK7A 4ZOLB 1K8AH 5CA0B 5EYPB 3R0PA 1DBFA 2AIZP 1PXWA 3P10A 4X1IB 3VTIC 1W5BA 5C8YB 4G4VA 1NQ3A 1W55A 1W42A 1JN1A 4IIJA 3DDNA 1Z5WA 3IKFA 3JAWA 3CCMF 3JARB 4KWEA 5CA1B 3HKEA 3G6EF 2Z01A 3JARA 5CA1A 1X7OA 3LDTA 1U3LA 1QU9A 1T0AA 3NVKE 3F0GA 3UT5B 1ODEA 3CCEF 2HP3A 4F6RB 3ELCA 2HRYA 1U3PA
chains in the Genus database with same CATH topology
1S72F 3CG6A 5G4UC 5HY1A 4BW0B 1T0KB 3VMFB 1YI2F 2AIFA 1VQOF 3J80M 4LCKA 3LFOA 3JAMM 1W2BF 3LWVC 1E7KA 1GZ0A 3CCLF 3J81M 3RA5A 2KTUA 1GO1A 5FLXM 1K73H 1VQNF 3V7EA 1QVGF 1ZWZA 2KTVA 3VI6A 2WALA 5GIPC 1VQLF 3CMAF 2OTLF 2ALEA 3CPWF 1VQPF 3JCMM 1Q7YH 3CCJF 5DCVA 1VQ4F 3CD6F 1YJNF 2JNBA 5HXZA 3CCRF 2VGMA 1VQ5F 5GANK 4XCQA 1CK2A 1RA4A 5HY0A 3G4SF 3RA6A 1XBIA 1X7PA 3V3TA 3OBWA 3LWQC 3CCUF 1JJ2F 2F9ZC 3I55F 3E1YA 3G71F 1SDSA 4C4WC 1DT9A 5HY2A 1CN7A 1GO0A 1N8RH 3CC4F 2QA4F 4EI7A 5GIOC 1YIJF 3J7AR 3HAXD 4BVTA 3CC2F 3OBYA 5EO3A 1X52A 4NUTA 3OW2F 2CZWA 4BVSA 2VGNA 3MCAB 1VQ9F 5G4VC 4X3LA 3SIUA 3CXCF 2FGYA 2GLZA 1YITF 5A2QM 3NK6A 4BVQA 3NVIB 1QVFF 1W41A 1VQ8F 1KQSF 3AGKA 3PAFA 4BY9D 3NK7A 3CCVF 1VQKF 5GAPK 1RLGA 3PLAC 4BVRA 1VQMF 4EI9A 1KC8H 1W40A 2QI2A 2OTJF 1K9MH 3IR9A 5HWEA 2KG4A 3E20B 1Q86H 3N4ZA 1Q81H 2I6DA 2LBWA 3WXMB 5GINC 3LWRC 3CC7F 4X3MA 3I56F 3O85A 5FJ4C 3HJWC 1W3EX 3LWOC 1YJ9F 1Q82H 3SIVA 1K8AH 3N4YA 1VQ7F 4TZZA 1YHQF 1PXWA 1NJIH 2LBXA 5HXUA 5HY4A 3NMUC 5IT9M 3CPQA 1W42A 3CCMF 3CMEF 1M1KH 2OHWA 1KD1H 2OZBA 3D00A 2HVYD 3V7QA 2BO1A 1NMUB 3CCQF 4NQ3A 3FFMA 3G6EF 5EWRA 3LWPC 1X7OA 3ON1A 2QEXF 1YJWF 3NVKE 2FC3A 4EI8A 1H7MA 3GYQA 1VQ6F 3CCEF 1M90H 3CCSF 1IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 F;  3CG6 A;  5G4U C;  4BW0 B;  1T0K B;  3VMF B;  1YI2 F;  2AIF A;  1VQO F;  3J80 M;  4LCK A;  3LFO A;  3JAM M;  1W2B F;  3LWV C;  1E7K A;  1GZ0 A;  3CCL F;  3J81 M;  3RA5 A;  2KTU A;  1GO1 A;  5FLX M;  1K73 H;  1VQN F;  3V7E A;  1QVG F;  1ZWZ A;  2KTV A;  3VI6 A;  2WAL A;  5GIP C;  1VQL F;  3CMA F;  2OTL F;  2ALE A;  3CPW F;  1VQP F;  3JCM M;  1Q7Y H;  3CCJ F;  5DCV A;  1VQ4 F;  3CD6 F;  1YJN F;  2JNB A;  3CCR F;  2VGM A;  1VQ5 F;  5GAN K;  1CK2 A;  1RA4 A;  3G4S F;  3RA6 A;  1XBI A;  1X7P A;  3OBW A;  3LWQ C;  3CCU F;  1JJ2 F;  3I55 F;  3E1Y A;  3G71 F;  1SDS A;  4C4W C;  1DT9 A;  1CN7 A;  1GO0 A;  1N8R H;  3CC4 F;  2QA4 F;  5GIO C;  1YIJ F;  3J7A R;  3HAX D;  3CC2 F;  3OBY A;  5EO3 A;  1X52 A;  4NUT A;  3OW2 F;  2CZW A;  2VGN A;  3MCA B;  1VQ9 F;  5G4V C;  4X3L A;  3SIU A;  3CXC F;  1YIT F;  5A2Q M;  3NK6 A;  3NVI B;  1QVF F;  1W41 A;  1VQ8 F;  1KQS F;  3AGK A;  3PAF A;  4BY9 D;  3NK7 A;  3CCV F;  1VQK F;  5GAP K;  1RLG A;  3PLA C;  1VQM F;  1KC8 H;  1W40 A;  2QI2 A;  2OTJ F;  1K9M H;  3IR9 A;  2KG4 A;  3E20 B;  1Q86 H;  3N4Z A;  1Q81 H;  2I6D A;  2LBW A;  3WXM B;  5GIN C;  3LWR C;  3CC7 F;  4X3M A;  3I56 F;  3O85 A;  5FJ4 C;  3HJW C;  3LWO C;  1W3E X;  1YJ9 F;  1Q82 H;  3SIV A;  1K8A H;  3N4Y A;  1VQ7 F;  4TZZ A;  1YHQ F;  1PXW A;  1NJI H;  2LBX A;  3NMU C;  5IT9 M;  3CPQ A;  1W42 A;  3CCM F;  3CME F;  1M1K H;  2OHW A;  1KD1 H;  2OZB A;  2HVY D;  3V7Q A;  2BO1 A;  1NMU B;  3CCQ F;  3FFM A;  3G6E F;  5EWR A;  3LWP C;  1X7O A;  3ON1 A;  2QEX F;  1YJW F;  3NVK E;  2FC3 A;  1H7M A;  3GYQ A;  1VQ6 F;  3CCE F;  1M90 H;  3CCS F;  1IPA A; 
#chains in the Genus database with same CATH topology
 3CG6 A;  2RHO A;  2NMU A;  3F6M A;  2IQQ A;  4TV9 A;  3VMF B;  1XHO A;  4ZI7 A;  5LA6 B;  4YJ2 B;  1Q8R A;  4C81 A;  3WGN A;  1J7H A;  3JAM M;  2HP0 B;  4X1Y A;  3K14 A;  1GO1 A;  1VQN F;  3N2K A;  5AVM A;  1ZWZ A;  3N2G A;  1H47 A;  1VQL F;  2ALE A;  2CVL A;  3KHN A;  3D01 A;  3RYI B;  5CB4 B;  3WGM A;  3ZP7 A;  5IJ0 B;  2CW4 A;  3C8L A;  2JNB A;  5C8Y A;  2VGM A;  3MBM A;  2PMP A;  3JAL A;  2LBT A;  1VQ5 F;  3ESJ A;  3KJJ A;  4XCQ A;  2RHJ A;  4G4Z A;  3KE1 A;  1XBI A;  3DC2 A;  3OON A;  4ZOL A;  3RYC A;  4O4L B;  2GVI A;  2HX0 A;  4ERH A;  1VQV A;  3RYH B;  3E1Y A;  4EB6 B;  1DT9 A;  1FFX B;  3FD5 A;  5MN6 A;  1CN7 A;  3E22 A;  1GX1 A;  1PF5 A;  3QUW A;  3RYC B;  1N8R H;  5LOV B;  3CC4 F;  1IV2 A;  2YYE A;  4EI7 A;  5GIO C;  4U3J B;  4DXD A;  4PWT A;  4X20 B;  3S0H A;  3CC2 F;  4LNU A;  3OBY A;  5EO3 A;  1X52 A;  3MCA B;  3WGJ A;  3N2G B;  2FGY A;  1YIT F;  2CHS A;  4X20 A;  3IEQ A;  1QVF F;  4X1Y B;  4TUY A;  5LOV A;  1KQS F;  2R6R 1;  4DRX A;  2UYK A;  3CCV F;  4X1I A;  2HS3 A;  5HP8 A;  5LA6 A;  2HQS C;  1W40 A;  2Z1U A;  3WPW A;  1K9M H;  4I50 A;  5EAZ A;  3LWR C;  4X3M A;  3D54 A;  5FJ4 C;  2CHT A;  1W3E X;  4ZHQ A;  1YJ9 F;  4TUY B;  2R75 1;  5LP6 B;  1IV4 A;  1YHQ F;  1SA0 B;  4BT6 A;  1IV3 A;  1VH8 A;  5FNV A;  3CPQ A;  5LP6 A;  3F0D A;  2H6L A;  3CME F;  1QAH A;  2MQE A;  4YJ3 A;  3D00 A;  4U3J A;  3V7Q A;  5ITZ A;  5GON B;  1NMU B;  5LXT A;  3E22 B;  1TUB B;  3ON1 A;  4B46 A;  4C8E A;  4TV8 B;  3CCS F;  5G4U C;  5HY1 A;  4BW0 B;  3WGL A;  4B45 A;  1YI2 F;  4RQO A;  4G4W A;  4C82 A;  2Q1X A;  5HP7 A;  4B5C A;  3VCZ A;  1W2B F;  3LWV C;  1E7K A;  2RB9 A;  3VYS C;  5BMV A;  2VAP A;  1XV2 A;  2KTU A;  5J2T B;  1YQN A;  4LNU B;  3K2X A;  2KTV A;  3TD4 A;  2WAL A;  3FBA A;  1RQ7 A;  1VQP F;  3JCM M;  1Q7Y H;  5LP6 C;  3U0O A;  1VQ4 F;  3JAS A;  1W5F A;  4O4J A;  5J2U B;  3CCR F;  1TVK B;  4ZI7 B;  2ZOV A;  1CLI A;  3JAS B;  5IYZ B;  3ZO8 A;  3G4S F;  1RA4 A;  3RA6 A;  3WGK A;  5EB0 A;  2H8E A;  2P6Y A;  5ITZ B;  2F9Z C;  3S0Y A;  1SDS A;  4I55 A;  3VYT C;  5KX5 B;  3MDO A;  5IJ0 A;  5FNV B;  2QA4 F;  5CB4 A;  2OTM A;  1JFF B;  2DYY A;  2BTU A;  3HAX D;  3J7A R;  3WJQ A;  4NUT A;  2ZF8 A;  4G4Y A;  2CZW A;  2N48 A;  3HKD A;  1VQ9 F;  4X1K B;  1KNK A;  4BVQ A;  4O4I A;  3Q8H A;  5LYJ B;  1W41 A;  1VQ8 F;  1RLU A;  3PAF A;  2UZH A;  3NK7 A;  5LXT B;  1VQK F;  4BY9 D;  3PLA C;  1VQM F;  1XRG A;  3M4S A;  2PHN A;  2HS0 A;  2OTJ F;  3F0E A;  4DRX B;  3IR9 A;  3CB2 A;  4ZHW A;  2KG4 A;  4E6E A;  4O2B B;  1U40 A;  3VIU A;  2I6D A;  2ZVY A;  5GIN C;  2VAW A;  1W59 A;  5J2T A;  3HJW C;  4TZZ A;  1FNJ A;  3IKE A;  4I55 B;  4I4T B;  3CYP B;  3C9T A;  3RE3 A;  3HKB A;  1NJI H;  2LBX A;  3JAT A;  5HY4 A;  5HXU A;  2BTO A;  5CA0 A;  2Z1E A;  3CYQ A;  2DT4 A;  4NWO B;  2OZB A;  4O4L A;  3CCQ F;  3FFM A;  4O4J B;  4BT7 A;  4IHJ B;  5JCO C;  3QHD A;  3GTZ A;  2L26 A;  5IJ9 A;  3HTN A;  1YJW F;  3JAL B;  3TD3 A;  2KGW A;  3IMP A;  2FC3 A;  4I4T A;  5GON A;  3GYQ A;  4EI8 A;  1VQ6 F;  1IPA A;  5JVD B;  1S72 F;  2CWJ A;  1T0K B;  3IEW A;  2AIF A;  5JQG B;  1VQO F;  3C9U A;  2YXZ A;  2BTQ B;  3LFO A;  1GZ0 A;  4O2B A;  3J81 M;  3CCL F;  5IJ9 B;  3ERN A;  4YJ2 A;  3V7E A;  3RYH A;  5JCO A;  1FSZ A;  1R1M A;  4O2A A;  3CPW F;  2V9Y A;  3CCJ F;  5DCV A;  3P4E A;  3CD6 F;  3P0Z A;  5EIB C;  5HXZ A;  3HKB B;  3MCQ A;  4G4X A;  2EWC A;  3HKD B;  3MQW A;  1W5A A;  5HY0 A;  3KIZ A;  1W5E A;  3HKC B;  5MN5 A;  2VXY A;  4FFB B;  3GHZ A;  1X7P A;  2IAF A;  3C9R A;  3OBW A;  5EZY A;  1X25 A;  2CSL A;  3LWQ C;  3CCU F;  1JJ2 F;  3G71 F;  3HKC A;  1W58 1;  3TD5 A;  1U43 A;  3EOR A;  3HWU A;  1COM A;  4BT4 A;  4IIJ B;  2ZOD A;  1YIJ F;  3KJK A;  4BVT A;  5MN4 A;  5EYP A;  2LCA A;  4O2A B;  2IG8 A;  5G4V C;  2W8B C;  4X3L A;  2UYP A;  2K1S A;  1QD9 A;  3NK6 A;  3UT5 A;  3AGK A;  1RLG A;  3I7T A;  5GAP K;  4EI9 A;  2B33 A;  1KC8 H;  4FFB A;  5KMG A;  2QI2 A;  3RYI A;  1OAP A;  5HWE A;  1W57 A;  5KX5 A;  5JVD A;  2UYJ A;  3I56 F;  3N2K B;  3O85 A;  3LWO C;  1Q82 H;  4IHJ A;  3SIV A;  5JH7 B;  3N4Y A;  3ZOP A;  1VQ7 F;  2UYN A;  1JD1 A;  1Z5V A;  4EB6 A;  4TV8 A;  3B6N A;  1TVK A;  2VAM A;  3WPX A;  3NMU C;  5JH7 A;  2QTP A;  3ZP4 A;  4G88 A;  5LYJ A;  1TUB A;  1RQ2 A;  1M1K H;  2OHW A;  1KD1 H;  4RHA A;  3K0T A;  2HVY D;  3M1X A;  2BO1 A;  3S0W A;  4C8G A;  4NQ3 A;  4HNA B;  2Z1F A;  4X1K A;  4YJ3 B;  5EWR A;  2RHL A;  5EIB D;  3LWP C;  5BMV B;  2QEX F;  4ZHV A;  3LME A;  4B62 A;  1H7M A;  3F0F A;  2GZL A;  3WJR A;  1M90 H;  1JFF A;  2ZAU A;  5IT9 M;  1YGY A;  4BT3 A;  2HP0 A;  3S06 A;  1UFY A;  2RHH A;  1SZQ A;  5EB1 B;  3I3F A;  3S02 A;  3J80 M;  4LCK A;  2H8C A;  4ZHY B;  4I50 B;  2AMT A;  2I6R A;  5IYZ A;  4O4I B;  3RA5 A;  3M84 A;  5FLX M;  1K73 H;  3RYF B;  1JY8 A;  4R40 B;  1QVG F;  2Z1T A;  4F6R A;  3LYB A;  3VI6 A;  5GIP C;  3CMA F;  1OFU A;  2OTL F;  3HKE B;  2HS4 A;  1YJN F;  5EZY B;  3T80 A;  1H48 A;  3VOA A;  3JAW B;  5GAN K;  1CK2 A;  3V4D A;  5B8F A;  3WJP A;  4U39 A;  1IV1 A;  2G9I A;  3V3T A;  3S03 A;  4O4H A;  3I55 F;  3FD6 A;  3RYF A;  4C4W C;  1UI9 A;  5HY2 A;  1GO0 A;  3JAK A;  1FFX A;  3BYQ A;  5J2U A;  2HRU A;  3OW2 F;  4WBN A;  4BVS A;  2VGN A;  1VK3 A;  3JAT B;  4BT5 A;  4BT2 A;  3SIU A;  3CXC F;  2GLZ A;  5JQG A;  4O4H B;  3VOB A;  5A2Q M;  1ONI A;  2ZVZ A;  3QTY A;  2Q1Y A;  3NVI B;  3C9S A;  1VHA A;  5KMG B;  4HNA A;  4C8I A;  4BVR A;  1SA0 A;  3VO8 A;  4ZHQ B;  3K12 A;  3VYU C;  4WBN B;  3E20 B;  1Q86 H;  3N4Z A;  1Q81 H;  3L7Q A;  2LBW A;  3FPI A;  4M8I A;  3WXM B;  3CC7 F;  4TV9 B;  3JVH A;  2UYN B;  1FNK A;  1KNJ A;  3JAK B;  4ZK7 A;  4ZOL B;  1K8A H;  5CA0 B;  5EYP B;  3R0P A;  1DBF A;  2AIZ P;  1PXW A;  3P10 A;  4X1I B;  3VTI C;  1W5B A;  5C8Y B;  4G4V A;  1NQ3 A;  1W55 A;  1W42 A;  1JN1 A;  4IIJ A;  3DDN A;  1Z5W A;  3IKF A;  3JAW A;  3CCM F;  3JAR B;  4KWE A;  5CA1 B;  3HKE A;  3G6E F;  2Z01 A;  3JAR A;  5CA1 A;  1X7O A;  3LDT A;  1U3L A;  1QU9 A;  1T0A A;  3NVK E;  3F0G A;  3UT5 B;  1ODE A;  3CCE F;  2HP3 A;  4F6R B;  3ELC A;  2HRY A;  1U3P A; 
#chains in the Genus database with same CATH homology
 1S72 F;  3CG6 A;  5G4U C;  5HY1 A;  4BW0 B;  1T0K B;  3VMF B;  1YI2 F;  2AIF A;  1VQO F;  3J80 M;  4LCK A;  3LFO A;  3JAM M;  1W2B F;  3LWV C;  1E7K A;  1GZ0 A;  3CCL F;  3J81 M;  3RA5 A;  2KTU A;  1GO1 A;  5FLX M;  1K73 H;  1VQN F;  3V7E A;  1QVG F;  1ZWZ A;  2KTV A;  3VI6 A;  2WAL A;  5GIP C;  1VQL F;  3CMA F;  2OTL F;  2ALE A;  3CPW F;  1VQP F;  3JCM M;  1Q7Y H;  3CCJ F;  5DCV A;  1VQ4 F;  3CD6 F;  1YJN F;  2JNB A;  5HXZ A;  3CCR F;  2VGM A;  1VQ5 F;  5GAN K;  4XCQ A;  1CK2 A;  1RA4 A;  5HY0 A;  3G4S F;  3RA6 A;  1XBI A;  1X7P A;  3V3T A;  3OBW A;  3LWQ C;  3CCU F;  1JJ2 F;  2F9Z C;  3I55 F;  3E1Y A;  3G71 F;  1SDS A;  4C4W C;  1DT9 A;  5HY2 A;  1CN7 A;  1GO0 A;  1N8R H;  3CC4 F;  2QA4 F;  4EI7 A;  5GIO C;  1YIJ F;  3J7A R;  3HAX D;  4BVT A;  3CC2 F;  3OBY A;  5EO3 A;  1X52 A;  4NUT A;  3OW2 F;  2CZW A;  4BVS A;  2VGN A;  3MCA B;  1VQ9 F;  5G4V C;  4X3L A;  3SIU A;  3CXC F;  2FGY A;  2GLZ A;  1YIT F;  5A2Q M;  3NK6 A;  4BVQ A;  3NVI B;  1QVF F;  1W41 A;  1VQ8 F;  1KQS F;  3AGK A;  3PAF A;  4BY9 D;  3NK7 A;  3CCV F;  1VQK F;  5GAP K;  1RLG A;  3PLA C;  4BVR A;  1VQM F;  4EI9 A;  1KC8 H;  1W40 A;  2QI2 A;  2OTJ F;  1K9M H;  3IR9 A;  5HWE A;  2KG4 A;  3E20 B;  1Q86 H;  3N4Z A;  1Q81 H;  2I6D A;  2LBW A;  3WXM B;  5GIN C;  3LWR C;  3CC7 F;  4X3M A;  3I56 F;  3O85 A;  5FJ4 C;  3HJW C;  1W3E X;  3LWO C;  1YJ9 F;  1Q82 H;  3SIV A;  1K8A H;  3N4Y A;  1VQ7 F;  4TZZ A;  1YHQ F;  1PXW A;  1NJI H;  2LBX A;  5HXU A;  5HY4 A;  3NMU C;  5IT9 M;  3CPQ A;  1W42 A;  3CCM F;  3CME F;  1M1K H;  2OHW A;  1KD1 H;  2OZB A;  3D00 A;  2HVY D;  3V7Q A;  2BO1 A;  1NMU B;  3CCQ F;  4NQ3 A;  3FFM A;  3G6E F;  5EWR A;  3LWP C;  1X7O A;  3ON1 A;  2QEX F;  1YJW F;  3NVK E;  2FC3 A;  4EI8 A;  1H7M A;  3GYQ A;  1VQ6 F;  3CCE F;  1M90 H;  3CCS F;  1IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...