2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosome, hydrolase
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
3JCMM 5G4UC 1X7PA 5GAPK 3RA5A 2BO1A 3IR9A 1VQ8F 1VQ5F 3HJWC 3SIUA 3CC4F 1CN7A 1KQSF 1VQOF 2OHWA 2QA4F 2VGMA 1YHQF 1QVGF 2OTLF 5IT9M 1SDSA 5EO3A 1X7OA 3MCAB 2JNBA 3NVKE 3NK6A 3LWRC 5GANK 3CCRF 1K9MH 3LWVC 4TZZA 1VQPF 1YI2F 2HVYD 1GO1A 3NK7A 3CCEF 1CK2A 1GZ0A 3V7QA 1Q81H 4BY9D 3CCQF 1K73H 1XBIA 1VQ7F 2QEXF 3OBYA 3SIVA 3OBWA 2LBXA 3ON1A 3CC2F 1NMUB 2KG4A 3NVIB 3LWPC 1IPAA 2KTVA 5GIPC 3CCJF 1YIJF 1K8AH 1VQKF 3CD6F 2VGNA 1VQMF 1YITF 1RA4A 3G6EF 1DT9A 1Q82H 1T0KB 3RA6A 1ZWZA 3WXMB 1PXWA 1GO0A 4BW0B 3N4ZA 5A2QM 3NMUC 1VQ6F 2I6DA 3VMFB 1YJ9F 5FJ4C 3GYQA 1VQ9F 1W2BF 3E20B 2FC3A 1M1KH 3J80M 1KD1H 3J7AR 1YJNF 5FLXM 5GINC 1M90H 1RLGA 1KC8H 5GIOC 1X52A 3FFMA 3G4SF 3CMEF 1N8RH 3CC7F 2QI2A 1W3EX 3CXCF 5DCVA 3LWOC 1W41A 5EWRA 2AIFA 2WALA 2LBWA 3CPWF 3CG6A 1W40A 3J81M 1S72F 3LWQC 3CCVF 1NJIH 4C4WC 3I55F 2OTJF 1Q86H 1H7MA 1JJ2F 2OZBA 3CMAF 1QVFF 3VI6A 2KTUA 3PLAC 4X3MA 3CCUF 3E1YA 3CPQA 1VQNF 4NUTA 3LFOA 3N4YA 3HAXD 5G4VC 3CCLF 1Q7YH 3CCMF 3CCSF 4LCKA 3OW2F 3JAMM 1VQ4F 3V7EA 3O85A 3PAFA 2CZWA 1VQLF 3AGKA 1YJWF 1W42A 3G71F 4X3LA 3I56F 1E7KA 2ALEA
chains in the Genus database with same CATH superfamily
3S0WA 5GAPK 3RA5A 1XV2A 4PWTA 3HKEB 3HWUA 3JAWB 1VQ8F 3S02A 3IMPA 1KQSF 3EORA 1QU9A 2VGMA 2OTLF 3M84A 4ZHWA 3HTNA 5EO3A 1U3PA 5J2UB 5LOVB 4BVQA 3ERNA 5IJ9A 4G4WA 3NK6A 1K9MH 5HY0A 5LP6A 4O2AA 2EWCA 1DBFA 4O4LA 1RLUA 3KIZA 1VQPF 5LA6B 3JATB 1W57A 3CCEF 1RQ7A 2CSLA 1CK2A 4U3JA 3JARB 1Q81H 4WBNB 3S0HA 1K73H 5EB1B 3K14A 3WJRA 4BT2A 4E6EA 1QD9A 3ON1A 1SA0B 5CA1A 3CC2F 1NMUB 4KWEA 5FNVA 2KTVA 5GIPC 3CD6F 2HRUA 2K1SA 5J2TB 3RYHA 1DT9A 3B6NA 5EZYA 3RA6A 1JFFB 4I50B 5MN5A 4BT4A 4BW0B 5A2QM 5BMVA 3N2KA 1GO0A 1VQ6F 3F0EA 1YJ9F 3J7AR 2FC3A 3E20B 3IKEA 1JD1A 2H8CA 5HY1A 2Z01A 5FLXM 1PF5A 3MBMA 5C8YA 4G4YA 4C82A 1N8RH 3RYIA 1TVKA 3OONA 2HX0A 4RHAA 3V4DA 2AIZP 5JCOC 2HP3A 5JVDA 3J81M 5IJ9B 1NJIH 1W5AA 5LP6B 5ITZA 1JJ2F 1COMA 4U3JB 3VI6A 2RHLA 4ZHYB 4DXDA 1W59A 3CCUF 3E1YA 1VQNF 3N2GA 4NUTA 3D00A 2PHNA 5GONA 2W8BC 1FNKA 3N4YA 2F9ZC 3QUWA 5KMGB 3HAXD 2CW4A 1Q7YH 5FNVB 4LCKA 5KX5B 3JAMM 3RYHB 5EZYB 4RQOA 1VQLF 5HY4A 5BMVB 5HP7A 4X3LA 1JY8A 2L26A 3JASA 3IEQA 3WPWA 5G4UC 4IHJA 2H6LA 1X7PA 3WJQA 4B62A 2Z1FA 4BVSA 3IR9A 5MN6A 5C8YB 1VQ5F 3VYTC 3GTZA 3P10A 3RYIB 1TVKB 3RYCB 4C81A 4BVRA 2CHTA 5IT9M 1YQNA 1T0AA 2YYEA 3JALB 4G4VA 1X7OA 3MCAB 5JVDB 3FBAA 4BT5A 3VO8A 4LNUB 3CXCF 1QAHA 4TZZA 2V9YA 3MCQA 3TD3A 4C8EA 2RHOA 4IIJA 2HVYD 1GO1A 4O4JA 1GZ0A 3LYBA 3S03A 4BY9D 3CCQF 1SZQA 2QEXF 3VYUC 3CYQA 1FNJA 1VK3A 4ZI7A 3TD5A 3N2GB 1IV4A 2Q1XA 3NVIB 5GONB 4ZHQA 3VOAA 3M1XA 1K8AH 3KJKA 2HP0A 1VQMF 1YITF 1R1MA 2HQSC 4ZHVA 3CB2A 1TUBA 2MQEA 2YXZA 1KNKA 3HKCB 1J7HA 1PXWA 2QTPA 5EYPA 3N4ZA 5IJ0A 2HS0A 3WGMA 4G4XA 5CB4B 3KHNA 3D01A 5FJ4C 1W2BF 1GX1A 3J80M 3JASB 1YJNF 1W5FA 2UYKA 4EI7A 1RLGA 3I7TA 5GIOC 3ZOPA 3T80A 5IYZA 3FFMA 4TV9A 3R0PA 3G4SF 3P4EA 2IAFA 4X1YA 5JH7A 5DCVA 2WALA 1Q8RA 2LBWA 3CPWF 4BT6A 3CG6A 3D54A 3LWQC 3CCVF 3KJJA 2Q1YA 4C4WC 3WGLA 2I6RA 4X20A 2UYNA 2VXYA 4IIJB 3MQWA 2DYYA 5CA0A 2VAMA 2LBTA 3U0OA 3F0FA 1Z5VA 3CPQA 3MDOA 4EI9A 4EB6A 5HP8A 2Z1UA 2IQQA 3F0GA 1H47A 4R40B 3IEWA 1RQ2A 1YGYA 3OW2F 3V7EA 1TUBB 2CZWA 5EYPB 5AVMA 1U3LA 5IJ0B 3AGKA 4O2AB 4O2BA 1YJWF 4O4LB 4B46A 4HNAA 3K12A 3UT5A 4G4ZA 3JCMM 4DRXA 1OFUA 4NQ3A 2BO1A 3DDNA 3LDTA 2HRYA 2UZHA 5IYZB 5JQGA 4TV9B 1CN7A 5CA1B 3JAKA 4I4TA 4ZOLA 1YHQF 1QVGF 3RYFA 4X1YB 1SDSA 4NWOB 1FSZA 2AMTA 2LCAA 1XHOA 3LWRC 5GANK 2R6R1 4FFBA 3P0ZA 2B33A 3BYQA 4XCQA 4X20B 2UYNB 3N2KB 3NK7A 5EIBC 1NQ3A 3ZP4A 5EIBD 4ZK7A 2BTUA 1OAPA 3V7QA 2PMPA 3WGKA 1XBIA 1U43A 1VQ7F 3RE3A 3S06A 3VCZA 3L7QA 2ZF8A 3SIVA 3HKEA 3WJPA 3C9UA 3JAWA 2ZODA 2IG8A 2KG4A 2VAWA 1VHAA 2ZVZA 5HWEA 1IPAA 3CCJF 2VGNA 2HS4A 1T0KB 1ZWZA 2VAPA 3GHZA 5LA6A 3QHDA 2UYPA 4O2BB 5ITZB 3NMUC 4WBNA 2I6DA 3V3TA 3VMFB 3GYQA 1VQ9F 1KD1H 2BTOA 3UT5B 4DRXB 1IV3A 4YJ2A 5GINC 1M90H 1SA0A 3HKDA 2G9IA 1VQVA 1X52A 2NMUA 4I55A 5JQGB 3CMEF 3CC7F 5EB0A 3JAKB 1W3EX 4I4TB 4ZOLB 3S0YA 2GVIA 2Z1EA 3LWOC 3RYFB 1W41A 2CHSA 2P6YA 4TUYA 1W40A 1S72F 4I50A 5EAZA 4FFBB 2OTJF 1FFXA 3FD6A 1U40A 2DT4A 4B45A 1Q86H 1H7MA 3CMAF 3C9TA 1QVFF 4X1IA 3PLAC 1Z5WA 3CYPB 4O4HA 4IHJB 4TV8A 2Z1TA 3K0TA 5B8FA 2CWJA 3LFOA 2RHJA 5LYJA 2ZAUA 3CCSF 3M4SA 2H8EA 2BTQB 4BT3A 3O85A 3Q8HA 2ZOVA 1UI9A 1E7KA 2CVLA 4YJ3A 4O4JB 4F6RA 3VTIC 1ODEA 1KNJA 4BT7A 4G88A 4U39A 4YJ2B 3ZO8A 4X1KA 3HKDB 2ZVYA 3VIUA 4ZI7B 3HJWC 3SIUA 3CC4F 4I55B 5KMGA 1VQOF 3K2XA 5LXTA 2OHWA 2QA4F 4BVTA 3C9RA 3QTYA 4ZHQB 5KX5A 2JNBA 3VYSC 4TUYB 3NVKE 3KE1A 4B5CA 3CCRF 4O4IA 2HP0B 3E22A 3LWVC 4M8IA 1FFXB 1VH8A 2N48A 3C9SA 3VOBA 1YI2F 3ZP7A 4C8IA 5HY2A 3OBYA 4X1IB 4O4HB 3OBWA 2LBXA 3JVHA 5HXZA 4TV8B 3FPIA 3F0DA 1W581 3RYCA 3LWPC 2KGWA 3JALA 4EI8A 3HKBA 5LYJB 1YIJF 1VQKF 5JH7B 4ERHA 4LNUA 1RA4A 3G6EF 1Q82H 3WXMB 1XRGA 1X25A 3WGJA 4YJ3B 1M1KH 3DC2A 1H48A 4F6RB 5CA0B 3WGNA 3TD4A 1KC8H 4X1KB 4EB6B 3I3FA 2QI2A 5LXTB 5EWRA 2AIFA 1IV1A 5LOVA 5J2UA 1IV2A 1W5EA 2GZLA 3HKCA 4O4IB 3I55F 3E22B 5LP6C 1W5BA 3FD5A 1W55A 2RB9A 3JATA 3ELCA 3C8LA 5CB4A 3JARA 3ESJA 2OZBA 4HNAB 2GLZA 2R751 2KTUA 4X3MA 3IKFA 2UYJA 1ONIA 2OTMA 3F6MA 3LMEA 5JCOA 5HXUA 5G4VC 3CCLF 3CCMF 3HKBB 3WPXA 5J2TA 1CLIA 1UFYA 1VQ4F 2RHHA 1JFFA 3PAFA 2FGYA 4C8GA 1W42A 3G71F 2HS3A 3I56F 5MN4A 1JN1A 2ALEA
chains in the Genus database with same CATH topology
3JCMM 5G4UC 1X7PA 4NQ3A 5GAPK 3RA5A 2BO1A 4BVSA 3IR9A 1VQ8F 1VQ5F 3HJWC 3SIUA 3CC4F 1CN7A 1KQSF 1VQOF 2OHWA 2QA4F 4BVTA 2VGMA 1YHQF 1QVGF 2OTLF 4BVRA 5IT9M 1SDSA 5EO3A 1X7OA 3MCAB 4BVQA 2JNBA 3NVKE 3NK6A 3LWRC 5GANK 3CCRF 1K9MH 5HY0A 3LWVC 4TZZA 1VQPF 4XCQA 1YI2F 2HVYD 1GO1A 3NK7A 3CCEF 1CK2A 1GZ0A 3V7QA 1Q81H 4BY9D 3CCQF 1K73H 1XBIA 5HY2A 1VQ7F 2QEXF 3OBYA 3SIVA 3OBWA 2LBXA 3ON1A 5HXZA 3CC2F 1NMUB 2KG4A 3NVIB 3LWPC 5HWEA 1IPAA 4EI8A 2KTVA 5GIPC 3CCJF 1YIJF 1K8AH 1VQKF 3CD6F 2VGNA 1VQMF 1YITF 1RA4A 3G6EF 1DT9A 1Q82H 1T0KB 3RA6A 1ZWZA 3WXMB 1PXWA 1GO0A 4BW0B 3N4ZA 5A2QM 3NMUC 1VQ6F 2I6DA 3V3TA 3VMFB 1YJ9F 5FJ4C 3GYQA 1VQ9F 1W2BF 3E20B 2FC3A 1M1KH 3J80M 1KD1H 3J7AR 1YJNF 5HY1A 5FLXM 4EI7A 5GINC 1M90H 1RLGA 1KC8H 5GIOC 1X52A 3FFMA 3G4SF 3CMEF 1N8RH 3CC7F 2QI2A 1W3EX 3CXCF 5DCVA 3LWOC 1W41A 5EWRA 2AIFA 2WALA 2LBWA 3CPWF 3CG6A 1W40A 3J81M 1S72F 3LWQC 3CCVF 1NJIH 4C4WC 3I55F 2OTJF 1Q86H 1H7MA 1JJ2F 2OZBA 3CMAF 1QVFF 3VI6A 2GLZA 2KTUA 3PLAC 4X3MA 3CCUF 3E1YA 3CPQA 1VQNF 4EI9A 4NUTA 3D00A 3LFOA 3N4YA 2F9ZC 3HAXD 5HXUA 5G4VC 3CCLF 1Q7YH 3CCMF 3CCSF 4LCKA 3OW2F 3JAMM 1VQ4F 3V7EA 3O85A 3PAFA 2CZWA 1VQLF 2FGYA 5HY4A 3AGKA 1YJWF 1W42A 3G71F 4X3LA 3I56F 1E7KA 2ALEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM M;  5G4U C;  1X7P A;  5GAP K;  3RA5 A;  2BO1 A;  3IR9 A;  1VQ8 F;  1VQ5 F;  3HJW C;  3SIU A;  3CC4 F;  1CN7 A;  1KQS F;  1VQO F;  2OHW A;  2QA4 F;  2VGM A;  1YHQ F;  1QVG F;  2OTL F;  5IT9 M;  1SDS A;  5EO3 A;  1X7O A;  3MCA B;  2JNB A;  3NVK E;  3NK6 A;  3LWR C;  5GAN K;  3CCR F;  1K9M H;  3LWV C;  4TZZ A;  1VQP F;  1YI2 F;  2HVY D;  1GO1 A;  3NK7 A;  3CCE F;  1CK2 A;  1GZ0 A;  3V7Q A;  1Q81 H;  4BY9 D;  3CCQ F;  1K73 H;  1XBI A;  1VQ7 F;  2QEX F;  3OBY A;  3SIV A;  3OBW A;  2LBX A;  3ON1 A;  3CC2 F;  1NMU B;  2KG4 A;  3NVI B;  3LWP C;  1IPA A;  2KTV A;  5GIP C;  3CCJ F;  1YIJ F;  1K8A H;  1VQK F;  3CD6 F;  2VGN A;  1VQM F;  1YIT F;  1RA4 A;  3G6E F;  1DT9 A;  1Q82 H;  1T0K B;  3RA6 A;  1ZWZ A;  3WXM B;  1PXW A;  1GO0 A;  4BW0 B;  3N4Z A;  5A2Q M;  3NMU C;  1VQ6 F;  2I6D A;  3VMF B;  1YJ9 F;  5FJ4 C;  3GYQ A;  1VQ9 F;  1W2B F;  3E20 B;  2FC3 A;  1M1K H;  3J80 M;  1KD1 H;  3J7A R;  1YJN F;  5FLX M;  5GIN C;  1M90 H;  1RLG A;  1KC8 H;  5GIO C;  1X52 A;  3FFM A;  3G4S F;  3CME F;  1N8R H;  3CC7 F;  2QI2 A;  1W3E X;  3CXC F;  5DCV A;  3LWO C;  1W41 A;  5EWR A;  2AIF A;  2WAL A;  2LBW A;  3CPW F;  3CG6 A;  1W40 A;  3J81 M;  1S72 F;  3LWQ C;  3CCV F;  1NJI H;  4C4W C;  3I55 F;  2OTJ F;  1Q86 H;  1H7M A;  1JJ2 F;  2OZB A;  3CMA F;  1QVF F;  3VI6 A;  2KTU A;  3PLA C;  4X3M A;  3CCU F;  3E1Y A;  3CPQ A;  1VQN F;  4NUT A;  3LFO A;  3N4Y A;  3HAX D;  5G4V C;  3CCL F;  1Q7Y H;  3CCM F;  3CCS F;  4LCK A;  3OW2 F;  3JAM M;  1VQ4 F;  3V7E A;  3O85 A;  3PAF A;  2CZW A;  1VQL F;  3AGK A;  1YJW F;  1W42 A;  3G71 F;  4X3L A;  3I56 F;  1E7K A;  2ALE A; 
#chains in the Genus database with same CATH topology
 3S0W A;  5GAP K;  3RA5 A;  1XV2 A;  4PWT A;  3HKE B;  3HWU A;  3JAW B;  1VQ8 F;  3S02 A;  3IMP A;  1KQS F;  3EOR A;  1QU9 A;  2VGM A;  2OTL F;  3M84 A;  4ZHW A;  3HTN A;  5EO3 A;  1U3P A;  5J2U B;  5LOV B;  4BVQ A;  3ERN A;  5IJ9 A;  4G4W A;  3NK6 A;  1K9M H;  5HY0 A;  5LP6 A;  4O2A A;  2EWC A;  1DBF A;  4O4L A;  1RLU A;  3KIZ A;  1VQP F;  5LA6 B;  3JAT B;  1W57 A;  3CCE F;  1RQ7 A;  2CSL A;  1CK2 A;  4U3J A;  3JAR B;  1Q81 H;  4WBN B;  3S0H A;  1K73 H;  5EB1 B;  3K14 A;  3WJR A;  4BT2 A;  4E6E A;  1QD9 A;  3ON1 A;  1SA0 B;  5CA1 A;  3CC2 F;  1NMU B;  4KWE A;  5FNV A;  2KTV A;  5GIP C;  3CD6 F;  2HRU A;  2K1S A;  5J2T B;  3RYH A;  1DT9 A;  3B6N A;  5EZY A;  3RA6 A;  1JFF B;  4I50 B;  5MN5 A;  4BT4 A;  4BW0 B;  5A2Q M;  5BMV A;  3N2K A;  1GO0 A;  1VQ6 F;  3F0E A;  1YJ9 F;  3J7A R;  2FC3 A;  3E20 B;  3IKE A;  1JD1 A;  2H8C A;  5HY1 A;  2Z01 A;  5FLX M;  1PF5 A;  3MBM A;  5C8Y A;  4G4Y A;  4C82 A;  1N8R H;  3RYI A;  1TVK A;  3OON A;  2HX0 A;  4RHA A;  3V4D A;  2AIZ P;  5JCO C;  2HP3 A;  5JVD A;  3J81 M;  5IJ9 B;  1NJI H;  1W5A A;  5LP6 B;  5ITZ A;  1JJ2 F;  1COM A;  4U3J B;  3VI6 A;  2RHL A;  4ZHY B;  4DXD A;  1W59 A;  3CCU F;  3E1Y A;  1VQN F;  3N2G A;  4NUT A;  3D00 A;  2PHN A;  5GON A;  2W8B C;  1FNK A;  3N4Y A;  2F9Z C;  3QUW A;  5KMG B;  3HAX D;  2CW4 A;  1Q7Y H;  5FNV B;  4LCK A;  5KX5 B;  3JAM M;  3RYH B;  5EZY B;  4RQO A;  1VQL F;  5HY4 A;  5BMV B;  5HP7 A;  4X3L A;  1JY8 A;  2L26 A;  3JAS A;  3IEQ A;  3WPW A;  5G4U C;  4IHJ A;  2H6L A;  1X7P A;  3WJQ A;  4B62 A;  2Z1F A;  4BVS A;  3IR9 A;  5MN6 A;  5C8Y B;  1VQ5 F;  3VYT C;  3GTZ A;  3P10 A;  3RYI B;  1TVK B;  3RYC B;  4C81 A;  4BVR A;  2CHT A;  5IT9 M;  1YQN A;  1T0A A;  2YYE A;  3JAL B;  4G4V A;  1X7O A;  3MCA B;  5JVD B;  3FBA A;  4BT5 A;  3VO8 A;  4LNU B;  3CXC F;  1QAH A;  4TZZ A;  2V9Y A;  3MCQ A;  3TD3 A;  4C8E A;  2RHO A;  4IIJ A;  2HVY D;  1GO1 A;  4O4J A;  1GZ0 A;  3LYB A;  3S03 A;  4BY9 D;  3CCQ F;  1SZQ A;  2QEX F;  3VYU C;  3CYQ A;  1FNJ A;  1VK3 A;  4ZI7 A;  3TD5 A;  3N2G B;  1IV4 A;  2Q1X A;  3NVI B;  5GON B;  4ZHQ A;  3VOA A;  3M1X A;  1K8A H;  3KJK A;  2HP0 A;  1VQM F;  1YIT F;  1R1M A;  2HQS C;  4ZHV A;  3CB2 A;  1TUB A;  2MQE A;  2YXZ A;  1KNK A;  3HKC B;  1J7H A;  1PXW A;  2QTP A;  5EYP A;  3N4Z A;  5IJ0 A;  2HS0 A;  3WGM A;  4G4X A;  5CB4 B;  3KHN A;  3D01 A;  5FJ4 C;  1W2B F;  1GX1 A;  3J80 M;  3JAS B;  1YJN F;  1W5F A;  2UYK A;  4EI7 A;  1RLG A;  3I7T A;  5GIO C;  3ZOP A;  3T80 A;  5IYZ A;  3FFM A;  4TV9 A;  3R0P A;  3G4S F;  3P4E A;  2IAF A;  4X1Y A;  5JH7 A;  5DCV A;  2WAL A;  1Q8R A;  2LBW A;  3CPW F;  4BT6 A;  3CG6 A;  3D54 A;  3LWQ C;  3CCV F;  3KJJ A;  2Q1Y A;  4C4W C;  3WGL A;  2I6R A;  4X20 A;  2UYN A;  2VXY A;  4IIJ B;  3MQW A;  2DYY A;  5CA0 A;  2VAM A;  2LBT A;  3U0O A;  3F0F A;  1Z5V A;  3CPQ A;  3MDO A;  4EI9 A;  4EB6 A;  5HP8 A;  2Z1U A;  2IQQ A;  3F0G A;  1H47 A;  4R40 B;  3IEW A;  1RQ2 A;  1YGY A;  3OW2 F;  3V7E A;  1TUB B;  2CZW A;  5EYP B;  5AVM A;  1U3L A;  5IJ0 B;  3AGK A;  4O2A B;  4O2B A;  1YJW F;  4O4L B;  4B46 A;  4HNA A;  3K12 A;  3UT5 A;  4G4Z A;  3JCM M;  4DRX A;  1OFU A;  4NQ3 A;  2BO1 A;  3DDN A;  3LDT A;  2HRY A;  2UZH A;  5IYZ B;  5JQG A;  4TV9 B;  1CN7 A;  5CA1 B;  3JAK A;  4I4T A;  4ZOL A;  1YHQ F;  1QVG F;  3RYF A;  4X1Y B;  1SDS A;  4NWO B;  1FSZ A;  2AMT A;  2LCA A;  1XHO A;  3LWR C;  5GAN K;  2R6R 1;  4FFB A;  3P0Z A;  2B33 A;  3BYQ A;  4XCQ A;  4X20 B;  2UYN B;  3N2K B;  3NK7 A;  5EIB C;  1NQ3 A;  3ZP4 A;  5EIB D;  4ZK7 A;  2BTU A;  1OAP A;  3V7Q A;  2PMP A;  3WGK A;  1XBI A;  1U43 A;  1VQ7 F;  3RE3 A;  3S06 A;  3VCZ A;  3L7Q A;  2ZF8 A;  3SIV A;  3HKE A;  3WJP A;  3C9U A;  3JAW A;  2ZOD A;  2IG8 A;  2KG4 A;  2VAW A;  1VHA A;  2ZVZ A;  5HWE A;  1IPA A;  3CCJ F;  2VGN A;  2HS4 A;  1T0K B;  1ZWZ A;  2VAP A;  3GHZ A;  5LA6 A;  3QHD A;  2UYP A;  4O2B B;  5ITZ B;  3NMU C;  4WBN A;  2I6D A;  3V3T A;  3VMF B;  3GYQ A;  1VQ9 F;  1KD1 H;  2BTO A;  3UT5 B;  4DRX B;  1IV3 A;  4YJ2 A;  5GIN C;  1M90 H;  1SA0 A;  3HKD A;  2G9I A;  1VQV A;  1X52 A;  2NMU A;  4I55 A;  5JQG B;  3CME F;  3CC7 F;  5EB0 A;  3JAK B;  1W3E X;  4I4T B;  4ZOL B;  3S0Y A;  2GVI A;  2Z1E A;  3LWO C;  3RYF B;  1W41 A;  2CHS A;  2P6Y A;  4TUY A;  1W40 A;  1S72 F;  4I50 A;  5EAZ A;  4FFB B;  2OTJ F;  1FFX A;  3FD6 A;  1U40 A;  2DT4 A;  4B45 A;  1Q86 H;  1H7M A;  3CMA F;  3C9T A;  1QVF F;  4X1I A;  3PLA C;  1Z5W A;  3CYP B;  4O4H A;  4IHJ B;  4TV8 A;  2Z1T A;  3K0T A;  5B8F A;  2CWJ A;  3LFO A;  2RHJ A;  5LYJ A;  2ZAU A;  3CCS F;  3M4S A;  2H8E A;  2BTQ B;  4BT3 A;  3O85 A;  3Q8H A;  2ZOV A;  1UI9 A;  1E7K A;  2CVL A;  4YJ3 A;  4O4J B;  4F6R A;  3VTI C;  1ODE A;  1KNJ A;  4BT7 A;  4G88 A;  4U39 A;  4YJ2 B;  3ZO8 A;  4X1K A;  3HKD B;  2ZVY A;  3VIU A;  4ZI7 B;  3HJW C;  3SIU A;  3CC4 F;  4I55 B;  5KMG A;  1VQO F;  3K2X A;  5LXT A;  2OHW A;  2QA4 F;  4BVT A;  3C9R A;  3QTY A;  4ZHQ B;  5KX5 A;  2JNB A;  3VYS C;  4TUY B;  3NVK E;  3KE1 A;  4B5C A;  3CCR F;  4O4I A;  2HP0 B;  3E22 A;  3LWV C;  4M8I A;  1FFX B;  1VH8 A;  2N48 A;  3C9S A;  3VOB A;  1YI2 F;  3ZP7 A;  4C8I A;  5HY2 A;  3OBY A;  4X1I B;  4O4H B;  3OBW A;  2LBX A;  3JVH A;  5HXZ A;  4TV8 B;  3FPI A;  3F0D A;  1W58 1;  3RYC A;  3LWP C;  2KGW A;  3JAL A;  4EI8 A;  3HKB A;  5LYJ B;  1YIJ F;  1VQK F;  5JH7 B;  4ERH A;  4LNU A;  1RA4 A;  3G6E F;  1Q82 H;  3WXM B;  1XRG A;  1X25 A;  3WGJ A;  4YJ3 B;  1M1K H;  3DC2 A;  1H48 A;  4F6R B;  5CA0 B;  3WGN A;  3TD4 A;  1KC8 H;  4X1K B;  4EB6 B;  3I3F A;  2QI2 A;  5LXT B;  5EWR A;  2AIF A;  1IV1 A;  5LOV A;  5J2U A;  1IV2 A;  1W5E A;  2GZL A;  3HKC A;  4O4I B;  3I55 F;  3E22 B;  5LP6 C;  1W5B A;  3FD5 A;  1W55 A;  2RB9 A;  3JAT A;  3ELC A;  3C8L A;  5CB4 A;  3JAR A;  3ESJ A;  2OZB A;  4HNA B;  2GLZ A;  2R75 1;  2KTU A;  4X3M A;  3IKF A;  2UYJ A;  1ONI A;  2OTM A;  3F6M A;  3LME A;  5JCO A;  5HXU A;  5G4V C;  3CCL F;  3CCM F;  3HKB B;  3WPX A;  5J2T A;  1CLI A;  1UFY A;  1VQ4 F;  2RHH A;  1JFF A;  3PAF A;  2FGY A;  4C8G A;  1W42 A;  3G71 F;  2HS3 A;  3I56 F;  5MN4 A;  1JN1 A;  2ALE A; 
#chains in the Genus database with same CATH homology
 3JCM M;  5G4U C;  1X7P A;  4NQ3 A;  5GAP K;  3RA5 A;  2BO1 A;  4BVS A;  3IR9 A;  1VQ8 F;  1VQ5 F;  3HJW C;  3SIU A;  3CC4 F;  1CN7 A;  1KQS F;  1VQO F;  2OHW A;  2QA4 F;  4BVT A;  2VGM A;  1YHQ F;  1QVG F;  2OTL F;  4BVR A;  5IT9 M;  1SDS A;  5EO3 A;  1X7O A;  3MCA B;  4BVQ A;  2JNB A;  3NVK E;  3NK6 A;  3LWR C;  5GAN K;  3CCR F;  1K9M H;  5HY0 A;  3LWV C;  4TZZ A;  1VQP F;  4XCQ A;  1YI2 F;  2HVY D;  1GO1 A;  3NK7 A;  3CCE F;  1CK2 A;  1GZ0 A;  3V7Q A;  1Q81 H;  4BY9 D;  3CCQ F;  1K73 H;  1XBI A;  5HY2 A;  1VQ7 F;  2QEX F;  3OBY A;  3SIV A;  3OBW A;  2LBX A;  3ON1 A;  5HXZ A;  3CC2 F;  1NMU B;  2KG4 A;  3NVI B;  3LWP C;  5HWE A;  1IPA A;  4EI8 A;  2KTV A;  5GIP C;  3CCJ F;  1YIJ F;  1K8A H;  1VQK F;  3CD6 F;  2VGN A;  1VQM F;  1YIT F;  1RA4 A;  3G6E F;  1DT9 A;  1Q82 H;  1T0K B;  3RA6 A;  1ZWZ A;  3WXM B;  1PXW A;  1GO0 A;  4BW0 B;  3N4Z A;  5A2Q M;  3NMU C;  1VQ6 F;  2I6D A;  3V3T A;  3VMF B;  1YJ9 F;  5FJ4 C;  3GYQ A;  1VQ9 F;  1W2B F;  3E20 B;  2FC3 A;  1M1K H;  3J80 M;  1KD1 H;  3J7A R;  1YJN F;  5HY1 A;  5FLX M;  4EI7 A;  5GIN C;  1M90 H;  1RLG A;  1KC8 H;  5GIO C;  1X52 A;  3FFM A;  3G4S F;  3CME F;  1N8R H;  3CC7 F;  2QI2 A;  1W3E X;  3CXC F;  5DCV A;  3LWO C;  1W41 A;  5EWR A;  2AIF A;  2WAL A;  2LBW A;  3CPW F;  3CG6 A;  1W40 A;  3J81 M;  1S72 F;  3LWQ C;  3CCV F;  1NJI H;  4C4W C;  3I55 F;  2OTJ F;  1Q86 H;  1H7M A;  1JJ2 F;  2OZB A;  3CMA F;  1QVF F;  3VI6 A;  2GLZ A;  2KTU A;  3PLA C;  4X3M A;  3CCU F;  3E1Y A;  3CPQ A;  1VQN F;  4EI9 A;  4NUT A;  3D00 A;  3LFO A;  3N4Y A;  2F9Z C;  3HAX D;  5HXU A;  5G4V C;  3CCL F;  1Q7Y H;  3CCM F;  3CCS F;  4LCK A;  3OW2 F;  3JAM M;  1VQ4 F;  3V7E A;  3O85 A;  3PAF A;  2CZW A;  1VQL F;  2FGY A;  5HY4 A;  3AGK A;  1YJW F;  1W42 A;  3G71 F;  4X3L A;  3I56 F;  1E7K A;  2ALE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...