2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
b'YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
molecule tags Ribosome, hydrolase
source organism Pyrococcus horikoshii
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
1KQSF 3J81M 1W41A 3J7AR 3SIVA 5DCVA 3NK7A 3AGKA 3O85A 1K73H 3LWPC 1K8AH 1VQ7F 1H7MA 3E20B 1KC8H 3OW2F 3SIUA 3J80M 3NMUC 1VQ5F 1JJ2F 4BW0B 1CK2A 1KD1H 3CD6F 1X7OA 1CN7A 2QEXF 3N4ZA 1RA4A 3VMFB 5GANK 3NVIB 4C4WC 4LCKA 1GO1A 3RA6A 3LWQC 1QVFF 1X52A 1W2BF 1VQ4F 2JNBA 3MCAB 3G71F 2HVYD 1K9MH 1YJ9F 3OBWA 2I6DA 1Q81H 1GO0A 4TZZA 3VI6A 1VQKF 3E1YA 2QA4F 3CCJF 1X7PA 3CCVF 1VQ8F 1NMUB 1VQ6F 2OHWA 2OTJF 1M1KH 3CG6A 2LBWA 3FFMA 2WALA 3I56F 2KTVA 1VQMF 3RA5A 1VQ9F 4BY9D 2KG4A 3HAXD 3WXMB 1VQNF 5GIOC 3G4SF 1VQOF 3CCUF 3CPWF 3NK6A 1YIJF 3CMAF 2AIFA 5FJ4C 3CXCF 1VQLF 3CC2F 2KTUA 1Q82H 3CCLF 3LWRC 3V7EA 3IR9A 3CMEF 5GAPK 3JAMM 3PAFA 5FLXM 2BO1A 3CCRF 5EWRA 5GIPC 1SDSA 3CC7F 3N4YA 1Q7YH 1YHQF 3G6EF 5EO3A 3LFOA 3CC4F 1E7KA 3GYQA 2VGNA 4NUTA 1S72F 2OTLF 2FC3A 3JCMM 1W42A 3CPQA 3I55F 3NVKE 1YITF 4X3MA 1VQPF 3LWOC 1ZWZA 3HJWC 3CCQF 5G4VC 4X3LA 1W3EX 2ALEA 1Q86H 3V7QA 3OBYA 3CCSF 2QI2A 1QVGF 2VGMA 1NJIH 5GINC 1YJNF 1GZ0A 1DT9A 1W40A 3CCMF 3ON1A 1T0KB 1IPAA 1RLGA 1YJWF 1M90H 2OZBA 1PXWA 1XBIA 5A2QM 2CZWA 2LBXA 3CCEF 1YI2F 1N8RH 3LWVC 5G4UC 3PLAC 5IT9M
chains in the Genus database with same CATH superfamily
2GLZA 5LOVA 2Z1TA 4C8GA 1W5BA 1ODEA 2H8EA 3JASA 2RHLA 1RLUA 2QTPA 3KJKA 1KNKA 3HWUA 1YQNA 4O4LA 5JCOC 5HP7A 4RHAA 1K73H 1VK3A 3DC2A 3P10A 1H7MA 3CYPB 1KC8H 3F6MA 4F6RB 4G4YA 2Z1EA 3K0TA 3T80A 1XRGA 3JAWB 4BW0B 3M4SA 5EB1B 1JY8A 1RA4A 2UYPA 3NVIB 3WPWA 4C82A 1VQVA 3RA6A 1Z5VA 3K14A 5GONA 2JNBA 3MCAB 4O4JA 2HP3A 5JVDA 3ZP4A 4WBNB 3VOAA 4TZZA 2PMPA 2QA4F 4IIJA 1X7PA 4TV8B 1TVKB 4ERHA 3JALA 2P6YA 4O4IB 1SA0A 4I4TA 3JARB 3HKCA 4BT5A 2BTUA 2R751 4BY9D 2HS0A 4X1YB 5GIOC 3CYQA 1VQOF 3LMEA 2YYEA 3VYTC 3JVHA 2AIFA 5J2UB 2W8BC 3WGNA 1VQLF 3DDNA 3IEWA 4BT4A 3S0HA 3S0YA 4TV9B 1Q82H 3V7EA 3IR9A 2BTOA 5EYPB 3JAMM 4WBNA 1SDSA 5EWRA 2DYYA 1XHOA 4X20A 3LFOA 3CC4F 4B46A 5JQGA 2OTLF 4LNUB 3JCMM 4X1KB 4ZHQB 1U3PA 3JARA 4F6RA 4ZHVA 3LWOC 2UYNB 4ZHYB 4LNUA 3MCQA 4ZHQA 3JATA 2VGMA 5GINC 2GZLA 3JAKA 1GZ0A 1DT9A 1IPAA 1M90H 2DT4A 4DRXB 2CWJA 3EORA 2CZWA 2LBXA 5G4UC 1W5FA 3PLAC 5GONB 4X1YA 3J7AR 4DRXA 4BVSA 2ZVZA 2HP0A 3N2GA 5DCVA 1FFXB 3AGKA 1JN1A 3F0DA 3GHZA 2UYNA 5IJ0A 4I55B 1K8AH 3E20B 3TD4A 3KHNA 1RQ2A 4XCQA 4ZHWA 3J80M 3HKCB 1JJ2F 5C8YB 1VHAA 1X7OA 2AMTA 4NWOB 5IJ0B 4B5CA 3IKEA 2QEXF 4EI7A 2ZF8A 1SZQA 3ZO8A 3LDTA 3WGLA 5BMVB 1QAHA 2EWCA 1NQ3A 5CB4B 5LP6C 4R40B 1W5EA 1GO1A 3ZP7A 3P4EA 5CA1B 4HNAA 2MQEA 2LCAA 5IYZB 2LBTA 1ONIA 3ESJA 3G71F 5HP8A 3E22A 2ZAUA 3HKBB 3VIUA 3WGKA 3IEQA 5CA0A 2I6DA 1GO0A 5ITZB 5JH7A 3VI6A 4G4XA 3E1YA 4O4HA 3IKFA 3ELCA 1U3LA 3HKBA 1VQ6F 2OTJF 1U40A 5JCOA 3LYBA 3CG6A 3I56F 2KTVA 3QTYA 3RA5A 1VQMF 3WXMB 1VQNF 3G4SF 2I6RA 4RQOA 3CPWF 3MDOA 4HNAB 5FJ4C 3CXCF 4O4LB 5EB0A 5LA6B 4EI9A 3CCLF 3LWRC 2ZOVA 1PF5A 3CMEF 5IJ9B 3VOBA 4O2BB 5FLXM 3CCRF 5FNVA 1IV2A 3V3TA 5J2TA 3S03A 5HY4A 1TUBA 4E6EA 4X1IA 5EO3A 5ITZA 5JH7B 4ZI7B 1E7KA 2NMUA 3GYQA 4KWEA 1FFXA 3VO8A 2VGNA 4NUTA 1KNJA 1W57A 3QHDA 1W42A 3I55F 2V9YA 3ZOPA 5J2TB 5LYJB 4B45A 3KE1A 1TVKA 4G4WA 5G4VC 1W3EX 3V7QA 2L26A 4EI8A 4I50A 5EIBD 3CCSF 2Z01A 3CB2A 1QVGF 2IQQA 1YJNF 4G4VA 4BT3A 3CCMF 2VXYA 3RYFA 5HWEA 5LOVB 1RLGA 2Z1UA 2CHSA 5J2UA 1JFFB 1FSZA 3L7QA 1OAPA 3K12A 1RQ7A 2UZHA 1N8RH 3ERNA 3N2KA 3RYIB 2H8CA 4TV8A 3D00A 4PWTA 1KQSF 3J81M 4O4IA 4FFBB 4NQ3A 3F0FA 5CA0B 3S0WA 2ZVYA 3FD5A 3WGMA 3WJPA 1J7HA 1VQ7F 3WJQA 2VAPA 2H6LA 3C9SA 4O2BA 2HRYA 1IV3A 2YXZA 3SIUA 5FNVB 1FNKA 1CK2A 1KD1H 3CD6F 4BVRA 1CLIA 1T0AA 5EYPA 1CN7A 3JATB 3N4ZA 4U3JA 3VTIC 5AVMA 2Z1FA 3Q8HA 4LCKA 3M1XA 3QUWA 4YJ2B 3LWQC 1QVFF 1OFUA 3HKDA 1X52A 3FPIA 1W2BF 1QD9A 1VQ4F 1DBFA 2RHOA 2RHHA 2HVYD 1K9MH 4BVTA 4ZI7A 1YJ9F 5HXUA 2FGYA 2IG8A 2HRUA 3OBWA 2RHJA 3C9TA 2CVLA 4IHJB 3CCJF 5JQGB 3RYIA 5JVDB 2HS4A 2OHWA 2LBWA 3R0PA 4I50B 3WGJA 3JASB 4IHJA 3M84A 3FBAA 3CCUF 3UT5B 3S02A 3HTNA 3NK6A 1W59A 5MN4A 3VYUC 4ZK7A 3CC2F 3I7TA 3MBMA 4BT7A 3F0EA 2KTUA 4C8EA 3JAWA 3N2KB 2Q1XA 5EIBC 3WJRA 3PAFA 1IV1A 4BT6A 3CC7F 3N4YA 1Q7YH 2IAFA 2OTMA 4ZOLA 1U43A 4DXDA 5KMGA 4U39A 2HS3A 3C9UA 1IV4A 3RYHB 5EZYA 1GX1A 1ZWZA 3HJWC 4O2AB 4ZOLB 3KIZA 5KMGB 2ALEA 4O4JB 3C8LA 2UYKA 2Q1YA 3OBYA 5HY2A 3VYSC 3RYHA 5HY1A 1XV2A 4BT2A 3U0OA 1NJIH 2CSLA 5MN5A 5C8YA 3IMPA 1T0KB 1YJWF 2UYJA 2OZBA 1UFYA 1PXWA 3JALB 1Q8RA 5A2QM 3B6NA 5HY0A 1COMA 3CCEF 2HP0B 3LWVC 3OONA 2B33A 5IT9M 3MQWA 2HQSC 1W41A 5CA1A 3BYQA 1YGYA 4X1KA 3SIVA 3NK7A 5HXZA 3O85A 4O2AA 3LWPC 4TV9A 4B62A 3OW2F 1W55A 3NMUC 5BMVA 1UI9A 5CB4A 1VQ5F 2N48A 3RE3A 4I55A 3VMFB 3D01A 5GANK 1FNJA 4C4WC 3C9RA 4EB6B 3V4DA 4X20B 3N2GB 4YJ3A 2KGWA 5IJ9A 2CW4A 1Q81H 2RB9A 5IYZA 5EZYB 3I3FA 1VQKF 4M8IA 4C8IA 4YJ3B 3CCVF 1VQ8F 1NMUB 3TD5A 1M1KH 1R1MA 2GVIA 2CHTA 5KX5A 3FFMA 2WALA 1VH8A 1VQ9F 3K2XA 2KG4A 4O4HB 3HAXD 3JAKB 3HKEA 4C81A 4FFBA 5B8FA 2PHNA 1YIJF 3CMAF 1Z5WA 4G4ZA 2F9ZC 2HX0A 4X1IB 3GTZA 2K1SA 5LXTA 1H47A 3WPXA 3HKEB 2ZODA 5MN6A 2R6R1 3E22B 1JFFA 1X25A 3P0ZA 5GAPK 4TUYA 4BVQA 2BO1A 5GIPC 1W581 1YHQF 3G6EF 3FD6A 5LA6A 2G9IA 1S72F 2FC3A 4U3JB 4TUYB 3CPQA 3NVKE 1W5AA 4X3MA 1YITF 4EB6A 2AIZP 3S06A 1VQPF 3VCZA 2VAWA 3CCQF 4X3LA 5LP6B 3TD3A 1Q86H 1SA0B 4I4TB 5EAZA 4YJ2A 3KJJA 2QI2A 3HKDB 3RYCB 3D54A 2BTQB 5LYJA 1QU9A 1W40A 5LXTB 1JD1A 3ON1A 3UT5A 4G88A 5LP6A 1H48A 1XBIA 3F0GA 3RYCA 5KX5B 1YI2F 4IIJB 1TUBB 2VAMA 3RYFB
chains in the Genus database with same CATH topology
2GLZA 3D00A 1KQSF 3J81M 1W41A 3J7AR 4NQ3A 4BVSA 3SIVA 5DCVA 3NK7A 3AGKA 5HXZA 3O85A 1K73H 3LWPC 1K8AH 1VQ7F 1H7MA 3E20B 1KC8H 3OW2F 3SIUA 4XCQA 3J80M 3NMUC 1VQ5F 1JJ2F 4BW0B 1CK2A 1KD1H 3CD6F 4BVRA 1X7OA 1CN7A 2QEXF 3N4ZA 4EI7A 1RA4A 3VMFB 5GANK 3NVIB 4C4WC 4LCKA 1GO1A 3RA6A 3LWQC 1QVFF 1X52A 1W2BF 1VQ4F 2JNBA 3MCAB 3G71F 2HVYD 1K9MH 4BVTA 1YJ9F 5HXUA 2FGYA 3OBWA 2I6DA 1Q81H 1GO0A 4TZZA 3VI6A 1VQKF 3E1YA 2QA4F 3CCJF 1X7PA 3CCVF 1VQ8F 1NMUB 1VQ6F 2OHWA 2OTJF 1M1KH 3CG6A 2LBWA 3FFMA 2WALA 3I56F 2KTVA 1VQMF 3RA5A 1VQ9F 4BY9D 2KG4A 3HAXD 3WXMB 1VQNF 5GIOC 3G4SF 1VQOF 3CCUF 3CPWF 3NK6A 1YIJF 3CMAF 2AIFA 5FJ4C 3CXCF 1VQLF 3CC2F 2F9ZC 4EI9A 2KTUA 1Q82H 3CCLF 3LWRC 3V7EA 3IR9A 3CMEF 5GAPK 4BVQA 3JAMM 3PAFA 5FLXM 2BO1A 3CCRF 5EWRA 5GIPC 1SDSA 3V3TA 3CC7F 3N4YA 5HY4A 1YHQF 3G6EF 1Q7YH 5EO3A 3LFOA 3CC4F 1E7KA 3GYQA 2VGNA 4NUTA 1S72F 2OTLF 2FC3A 3JCMM 1W42A 3CPQA 3I55F 3NVKE 1YITF 4X3MA 1VQPF 3LWOC 1ZWZA 3HJWC 3CCQF 5G4VC 4X3LA 1W3EX 2ALEA 1Q86H 3V7QA 3OBYA 4EI8A 5HY2A 3CCSF 5HY1A 2QI2A 1QVGF 2VGMA 1NJIH 5GINC 1YJNF 1GZ0A 1DT9A 1W40A 3CCMF 3ON1A 5HWEA 1T0KB 1IPAA 1RLGA 1YJWF 1M90H 2OZBA 1PXWA 1XBIA 5A2QM 5HY0A 2CZWA 2LBXA 3CCEF 1YI2F 1N8RH 3LWVC 5G4UC 3PLAC 5IT9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS F;  3J81 M;  1W41 A;  3J7A R;  3SIV A;  5DCV A;  3NK7 A;  3AGK A;  3O85 A;  1K73 H;  3LWP C;  1K8A H;  1VQ7 F;  1H7M A;  3E20 B;  1KC8 H;  3OW2 F;  3SIU A;  3J80 M;  3NMU C;  1VQ5 F;  1JJ2 F;  4BW0 B;  1CK2 A;  1KD1 H;  3CD6 F;  1X7O A;  1CN7 A;  2QEX F;  3N4Z A;  1RA4 A;  3VMF B;  5GAN K;  3NVI B;  4C4W C;  4LCK A;  1GO1 A;  3RA6 A;  3LWQ C;  1QVF F;  1X52 A;  1W2B F;  1VQ4 F;  2JNB A;  3MCA B;  3G71 F;  2HVY D;  1K9M H;  1YJ9 F;  3OBW A;  2I6D A;  1Q81 H;  1GO0 A;  4TZZ A;  3VI6 A;  1VQK F;  3E1Y A;  2QA4 F;  3CCJ F;  1X7P A;  3CCV F;  1VQ8 F;  1NMU B;  1VQ6 F;  2OHW A;  2OTJ F;  1M1K H;  3CG6 A;  2LBW A;  3FFM A;  2WAL A;  3I56 F;  2KTV A;  1VQM F;  3RA5 A;  1VQ9 F;  4BY9 D;  2KG4 A;  3HAX D;  3WXM B;  1VQN F;  5GIO C;  3G4S F;  1VQO F;  3CCU F;  3CPW F;  3NK6 A;  1YIJ F;  3CMA F;  2AIF A;  5FJ4 C;  3CXC F;  1VQL F;  3CC2 F;  2KTU A;  1Q82 H;  3CCL F;  3LWR C;  3V7E A;  3IR9 A;  3CME F;  5GAP K;  3JAM M;  3PAF A;  5FLX M;  2BO1 A;  3CCR F;  5EWR A;  5GIP C;  1SDS A;  3CC7 F;  3N4Y A;  1Q7Y H;  1YHQ F;  3G6E F;  5EO3 A;  3LFO A;  3CC4 F;  1E7K A;  3GYQ A;  2VGN A;  4NUT A;  1S72 F;  2OTL F;  2FC3 A;  3JCM M;  1W42 A;  3CPQ A;  3I55 F;  3NVK E;  1YIT F;  4X3M A;  1VQP F;  3LWO C;  1ZWZ A;  3HJW C;  3CCQ F;  5G4V C;  4X3L A;  1W3E X;  2ALE A;  1Q86 H;  3V7Q A;  3OBY A;  3CCS F;  2QI2 A;  1QVG F;  2VGM A;  1NJI H;  5GIN C;  1YJN F;  1GZ0 A;  1DT9 A;  1W40 A;  3CCM F;  3ON1 A;  1T0K B;  1IPA A;  1RLG A;  1YJW F;  1M90 H;  2OZB A;  1PXW A;  1XBI A;  5A2Q M;  2CZW A;  2LBX A;  3CCE F;  1YI2 F;  1N8R H;  3LWV C;  5G4U C;  3PLA C;  5IT9 M; 
#chains in the Genus database with same CATH topology
 2GLZ A;  5LOV A;  2Z1T A;  4C8G A;  1W5B A;  1ODE A;  2H8E A;  3JAS A;  2RHL A;  1RLU A;  2QTP A;  3KJK A;  1KNK A;  3HWU A;  1YQN A;  4O4L A;  5JCO C;  5HP7 A;  4RHA A;  1K73 H;  1VK3 A;  3DC2 A;  3P10 A;  1H7M A;  3CYP B;  1KC8 H;  3F6M A;  4F6R B;  4G4Y A;  2Z1E A;  3K0T A;  3T80 A;  1XRG A;  3JAW B;  4BW0 B;  3M4S A;  5EB1 B;  1JY8 A;  1RA4 A;  2UYP A;  3NVI B;  3WPW A;  4C82 A;  1VQV A;  3RA6 A;  1Z5V A;  3K14 A;  5GON A;  2JNB A;  3MCA B;  4O4J A;  2HP3 A;  5JVD A;  3ZP4 A;  4WBN B;  3VOA A;  4TZZ A;  2PMP A;  2QA4 F;  4IIJ A;  1X7P A;  4TV8 B;  1TVK B;  4ERH A;  3JAL A;  2P6Y A;  4O4I B;  1SA0 A;  4I4T A;  3JAR B;  3HKC A;  4BT5 A;  2BTU A;  2R75 1;  4BY9 D;  2HS0 A;  4X1Y B;  5GIO C;  3CYQ A;  1VQO F;  3LME A;  2YYE A;  3VYT C;  3JVH A;  2AIF A;  5J2U B;  2W8B C;  3WGN A;  1VQL F;  3DDN A;  3IEW A;  4BT4 A;  3S0H A;  3S0Y A;  4TV9 B;  1Q82 H;  3V7E A;  3IR9 A;  2BTO A;  5EYP B;  3JAM M;  4WBN A;  1SDS A;  5EWR A;  2DYY A;  1XHO A;  4X20 A;  3LFO A;  3CC4 F;  4B46 A;  5JQG A;  2OTL F;  4LNU B;  3JCM M;  4X1K B;  4ZHQ B;  1U3P A;  3JAR A;  4F6R A;  4ZHV A;  3LWO C;  2UYN B;  4ZHY B;  4LNU A;  3MCQ A;  4ZHQ A;  3JAT A;  2VGM A;  5GIN C;  2GZL A;  3JAK A;  1GZ0 A;  1DT9 A;  1IPA A;  1M90 H;  2DT4 A;  4DRX B;  2CWJ A;  3EOR A;  2CZW A;  2LBX A;  5G4U C;  1W5F A;  3PLA C;  5GON B;  4X1Y A;  3J7A R;  4DRX A;  4BVS A;  2ZVZ A;  2HP0 A;  3N2G A;  5DCV A;  1FFX B;  3AGK A;  1JN1 A;  3F0D A;  3GHZ A;  2UYN A;  5IJ0 A;  4I55 B;  1K8A H;  3E20 B;  3TD4 A;  3KHN A;  1RQ2 A;  4XCQ A;  4ZHW A;  3J80 M;  3HKC B;  1JJ2 F;  5C8Y B;  1VHA A;  1X7O A;  2AMT A;  4NWO B;  5IJ0 B;  4B5C A;  3IKE A;  2QEX F;  4EI7 A;  2ZF8 A;  1SZQ A;  3ZO8 A;  3LDT A;  3WGL A;  5BMV B;  1QAH A;  2EWC A;  1NQ3 A;  5CB4 B;  5LP6 C;  4R40 B;  1W5E A;  1GO1 A;  3ZP7 A;  3P4E A;  5CA1 B;  4HNA A;  2MQE A;  2LCA A;  5IYZ B;  2LBT A;  1ONI A;  3ESJ A;  3G71 F;  5HP8 A;  3E22 A;  2ZAU A;  3HKB B;  3VIU A;  3WGK A;  3IEQ A;  5CA0 A;  2I6D A;  1GO0 A;  5ITZ B;  5JH7 A;  3VI6 A;  4G4X A;  3E1Y A;  4O4H A;  3IKF A;  3ELC A;  1U3L A;  3HKB A;  1VQ6 F;  2OTJ F;  1U40 A;  5JCO A;  3LYB A;  3CG6 A;  3I56 F;  2KTV A;  3QTY A;  3RA5 A;  1VQM F;  3WXM B;  1VQN F;  3G4S F;  2I6R A;  4RQO A;  3CPW F;  3MDO A;  4HNA B;  5FJ4 C;  3CXC F;  4O4L B;  5EB0 A;  5LA6 B;  4EI9 A;  3CCL F;  3LWR C;  2ZOV A;  1PF5 A;  3CME F;  5IJ9 B;  3VOB A;  4O2B B;  5FLX M;  3CCR F;  5FNV A;  1IV2 A;  3V3T A;  5J2T A;  3S03 A;  5HY4 A;  1TUB A;  4E6E A;  4X1I A;  5EO3 A;  5ITZ A;  5JH7 B;  4ZI7 B;  1E7K A;  2NMU A;  3GYQ A;  4KWE A;  1FFX A;  3VO8 A;  2VGN A;  4NUT A;  1KNJ A;  1W57 A;  3QHD A;  1W42 A;  3I55 F;  2V9Y A;  3ZOP A;  5J2T B;  5LYJ B;  4B45 A;  3KE1 A;  1TVK A;  4G4W A;  5G4V C;  1W3E X;  3V7Q A;  2L26 A;  4EI8 A;  4I50 A;  5EIB D;  3CCS F;  2Z01 A;  3CB2 A;  1QVG F;  2IQQ A;  1YJN F;  4G4V A;  4BT3 A;  3CCM F;  2VXY A;  3RYF A;  5HWE A;  5LOV B;  1RLG A;  2Z1U A;  2CHS A;  5J2U A;  1JFF B;  1FSZ A;  3L7Q A;  1OAP A;  3K12 A;  1RQ7 A;  2UZH A;  1N8R H;  3ERN A;  3N2K A;  3RYI B;  2H8C A;  4TV8 A;  3D00 A;  4PWT A;  1KQS F;  3J81 M;  4O4I A;  4FFB B;  4NQ3 A;  3F0F A;  5CA0 B;  3S0W A;  2ZVY A;  3FD5 A;  3WGM A;  3WJP A;  1J7H A;  1VQ7 F;  3WJQ A;  2VAP A;  2H6L A;  3C9S A;  4O2B A;  2HRY A;  1IV3 A;  2YXZ A;  3SIU A;  5FNV B;  1FNK A;  1CK2 A;  1KD1 H;  3CD6 F;  4BVR A;  1CLI A;  1T0A A;  5EYP A;  1CN7 A;  3JAT B;  3N4Z A;  4U3J A;  3VTI C;  5AVM A;  2Z1F A;  3Q8H A;  4LCK A;  3M1X A;  3QUW A;  4YJ2 B;  3LWQ C;  1QVF F;  1OFU A;  3HKD A;  1X52 A;  3FPI A;  1W2B F;  1QD9 A;  1VQ4 F;  1DBF A;  2RHO A;  2RHH A;  2HVY D;  1K9M H;  4BVT A;  4ZI7 A;  1YJ9 F;  5HXU A;  2FGY A;  2IG8 A;  2HRU A;  3OBW A;  2RHJ A;  3C9T A;  2CVL A;  4IHJ B;  3CCJ F;  5JQG B;  3RYI A;  5JVD B;  2HS4 A;  2OHW A;  2LBW A;  3R0P A;  4I50 B;  3WGJ A;  3JAS B;  4IHJ A;  3M84 A;  3FBA A;  3CCU F;  3UT5 B;  3S02 A;  3HTN A;  3NK6 A;  1W59 A;  5MN4 A;  3VYU C;  4ZK7 A;  3CC2 F;  3I7T A;  3MBM A;  4BT7 A;  3F0E A;  2KTU A;  4C8E A;  3JAW A;  3N2K B;  2Q1X A;  5EIB C;  3WJR A;  3PAF A;  1IV1 A;  4BT6 A;  3CC7 F;  3N4Y A;  1Q7Y H;  2IAF A;  2OTM A;  4ZOL A;  1U43 A;  4DXD A;  5KMG A;  4U39 A;  2HS3 A;  3C9U A;  1IV4 A;  3RYH B;  5EZY A;  1GX1 A;  1ZWZ A;  3HJW C;  4O2A B;  4ZOL B;  3KIZ A;  5KMG B;  2ALE A;  4O4J B;  3C8L A;  2UYK A;  2Q1Y A;  3OBY A;  5HY2 A;  3VYS C;  3RYH A;  5HY1 A;  1XV2 A;  4BT2 A;  3U0O A;  1NJI H;  2CSL A;  5MN5 A;  5C8Y A;  3IMP A;  1T0K B;  1YJW F;  2UYJ A;  2OZB A;  1UFY A;  1PXW A;  3JAL B;  1Q8R A;  5A2Q M;  3B6N A;  5HY0 A;  1COM A;  3CCE F;  2HP0 B;  3LWV C;  3OON A;  2B33 A;  5IT9 M;  3MQW A;  2HQS C;  1W41 A;  5CA1 A;  3BYQ A;  1YGY A;  4X1K A;  3SIV A;  3NK7 A;  5HXZ A;  3O85 A;  4O2A A;  3LWP C;  4TV9 A;  4B62 A;  3OW2 F;  1W55 A;  3NMU C;  5BMV A;  1UI9 A;  5CB4 A;  1VQ5 F;  2N48 A;  3RE3 A;  4I55 A;  3VMF B;  3D01 A;  5GAN K;  1FNJ A;  4C4W C;  3C9R A;  4EB6 B;  3V4D A;  4X20 B;  3N2G B;  4YJ3 A;  2KGW A;  5IJ9 A;  2CW4 A;  1Q81 H;  2RB9 A;  5IYZ A;  5EZY B;  3I3F A;  1VQK F;  4M8I A;  4C8I A;  4YJ3 B;  3CCV F;  1VQ8 F;  1NMU B;  3TD5 A;  1M1K H;  1R1M A;  2GVI A;  2CHT A;  5KX5 A;  3FFM A;  2WAL A;  1VH8 A;  1VQ9 F;  3K2X A;  2KG4 A;  4O4H B;  3HAX D;  3JAK B;  3HKE A;  4C81 A;  4FFB A;  5B8F A;  2PHN A;  1YIJ F;  3CMA F;  1Z5W A;  4G4Z A;  2F9Z C;  2HX0 A;  4X1I B;  3GTZ A;  2K1S A;  5LXT A;  1H47 A;  3WPX A;  3HKE B;  2ZOD A;  5MN6 A;  2R6R 1;  3E22 B;  1JFF A;  1X25 A;  3P0Z A;  5GAP K;  4TUY A;  4BVQ A;  2BO1 A;  5GIP C;  1W58 1;  1YHQ F;  3G6E F;  3FD6 A;  5LA6 A;  2G9I A;  1S72 F;  2FC3 A;  4U3J B;  4TUY B;  3CPQ A;  3NVK E;  1W5A A;  4X3M A;  1YIT F;  4EB6 A;  2AIZ P;  3S06 A;  1VQP F;  3VCZ A;  2VAW A;  3CCQ F;  4X3L A;  5LP6 B;  3TD3 A;  1Q86 H;  1SA0 B;  4I4T B;  5EAZ A;  4YJ2 A;  3KJJ A;  2QI2 A;  3HKD B;  3RYC B;  3D54 A;  2BTQ B;  5LYJ A;  1QU9 A;  1W40 A;  5LXT B;  1JD1 A;  3ON1 A;  3UT5 A;  4G88 A;  5LP6 A;  1H48 A;  1XBI A;  3F0G A;  3RYC A;  5KX5 B;  1YI2 F;  4IIJ B;  1TUB B;  2VAM A;  3RYF B; 
#chains in the Genus database with same CATH homology
 2GLZ A;  3D00 A;  1KQS F;  3J81 M;  1W41 A;  3J7A R;  4NQ3 A;  4BVS A;  3SIV A;  5DCV A;  3NK7 A;  3AGK A;  5HXZ A;  3O85 A;  1K73 H;  3LWP C;  1K8A H;  1VQ7 F;  1H7M A;  3E20 B;  1KC8 H;  3OW2 F;  3SIU A;  4XCQ A;  3J80 M;  3NMU C;  1VQ5 F;  1JJ2 F;  4BW0 B;  1CK2 A;  1KD1 H;  3CD6 F;  4BVR A;  1X7O A;  1CN7 A;  2QEX F;  3N4Z A;  4EI7 A;  1RA4 A;  3VMF B;  5GAN K;  3NVI B;  4C4W C;  4LCK A;  1GO1 A;  3RA6 A;  3LWQ C;  1QVF F;  1X52 A;  1W2B F;  1VQ4 F;  2JNB A;  3MCA B;  3G71 F;  2HVY D;  1K9M H;  4BVT A;  1YJ9 F;  5HXU A;  2FGY A;  3OBW A;  2I6D A;  1Q81 H;  1GO0 A;  4TZZ A;  3VI6 A;  1VQK F;  3E1Y A;  2QA4 F;  3CCJ F;  1X7P A;  3CCV F;  1VQ8 F;  1NMU B;  1VQ6 F;  2OHW A;  2OTJ F;  1M1K H;  3CG6 A;  2LBW A;  3FFM A;  2WAL A;  3I56 F;  2KTV A;  1VQM F;  3RA5 A;  1VQ9 F;  4BY9 D;  2KG4 A;  3HAX D;  3WXM B;  1VQN F;  5GIO C;  3G4S F;  1VQO F;  3CCU F;  3CPW F;  3NK6 A;  1YIJ F;  3CMA F;  2AIF A;  5FJ4 C;  3CXC F;  1VQL F;  3CC2 F;  2F9Z C;  4EI9 A;  2KTU A;  1Q82 H;  3CCL F;  3LWR C;  3V7E A;  3IR9 A;  3CME F;  5GAP K;  4BVQ A;  3JAM M;  3PAF A;  5FLX M;  2BO1 A;  3CCR F;  5EWR A;  5GIP C;  1SDS A;  3V3T A;  3CC7 F;  3N4Y A;  5HY4 A;  1YHQ F;  3G6E F;  1Q7Y H;  5EO3 A;  3LFO A;  3CC4 F;  1E7K A;  3GYQ A;  2VGN A;  4NUT A;  1S72 F;  2OTL F;  2FC3 A;  3JCM M;  1W42 A;  3CPQ A;  3I55 F;  3NVK E;  1YIT F;  4X3M A;  1VQP F;  3LWO C;  1ZWZ A;  3HJW C;  3CCQ F;  5G4V C;  4X3L A;  1W3E X;  2ALE A;  1Q86 H;  3V7Q A;  3OBY A;  4EI8 A;  5HY2 A;  3CCS F;  5HY1 A;  2QI2 A;  1QVG F;  2VGM A;  1NJI H;  5GIN C;  1YJN F;  1GZ0 A;  1DT9 A;  1W40 A;  3CCM F;  3ON1 A;  5HWE A;  1T0K B;  1IPA A;  1RLG A;  1YJW F;  1M90 H;  2OZB A;  1PXW A;  1XBI A;  5A2Q M;  5HY0 A;  2CZW A;  2LBX A;  3CCE F;  1YI2 F;  1N8R H;  3LWV C;  5G4U C;  3PLA C;  5IT9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...