2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome, hydrolase
molecule keywords 50S ribosomal protein L7Ae
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
3VI6A 5GIPC 3CG6A 3NK6A 2QEXF 5GIOC 1DT9A 3LWRC 3CCQF 3CCSF 3PAFA 1K8AH 3J7AR 3E20B 3OBWA 3AGKA 1W42A 1Q7YH 1W41A 3CCMF 1IPAA 1KC8H 1VQ7F 1VQNF 3RA5A 1GO0A 2OHWA 3CCEF 3CMAF 2CZWA 3LWOC 3FFMA 1M1KH 1W40A 3CC4F 3CCVF 1GO1A 3LWQC 3CCRF 1GZ0A 1YHQF 3SIVA 1Q86H 2LBWA 2OTLF 3N4YA 2QI2A 2ALEA 4X3MA 5IT9M 1KQSF 1VQ5F 4C4WC 2BO1A 3IR9A 1XBIA 2VGNA 1X52A 3I55F 1CN7A 3HAXD 3CXCF 3CCUF 1X7PA 3G6EF 1S72F 3NVKE 1K9MH 3CPWF 1JJ2F 1K73H 1YJNF 5A2QM 1VQLF 1VQMF 3OBYA 1VQOF 5FJ4C 3I56F 2KTUA 1QVGF 3NVIB 1X7OA 4BY9D 1VQ8F 3O85A 2AIFA 1PXWA 1Q81H 1VQ9F 2LBXA 1ZWZA 3E1YA 1YJ9F 3G71F 1YI2F 5DCVA 3CCLF 3PLAC 5FLXM 3LWPC 3CMEF 4TZZA 1W2BF 1VQ6F 3LFOA 3G4SF 1SDSA 1YITF 2HVYD 1NMUB 1T0KB 3LWVC 1VQPF 5GANK 1QVFF 1M90H 3CC2F 3J81M 1W3EX 3N4ZA 3RA6A 2FC3A 4NUTA 2WALA 1RA4A 1KD1H 3CC7F 3NK7A 3JAMM 1YIJF 1VQ4F 2JNBA 3ON1A 4X3LA 3MCAB 1Q82H 3V7QA 3J80M 3CPQA 2I6DA 4LCKA 5GINC 1E7KA 1YJWF 1N8RH 5EWRA 4BW0B 3VMFB 1VQKF 5EO3A 1CK2A 2VGMA 3NMUC 1RLGA 2OTJF 3SIUA 3HJWC 3JCMM 1NJIH 5GAPK 3OW2F 1H7MA 3CD6F 3V7EA 2OZBA 5G4UC 3CCJF 2QA4F 2KG4A 3GYQA 3WXMB 2KTVA 5G4VC
chains in the Genus database with same CATH superfamily
5GIPC 3CG6A 3FD5A 3NK6A 1DT9A 4G4ZA 3C9TA 1K8AH 5EYPB 1W55A 2G9IA 5IJ0B 5HY4A 1IPAA 2N48A 5ITZA 3F6MA 3S02A 3RA5A 3CCEF 3F0DA 4X1KA 3S03A 3FFMA 3N2KA 4TV8A 4BT5A 3JALB 1GZ0A 1YHQF 1Q86H 3B6NA 2ZVYA 4X1YA 5HY1A 3M4SA 3N4YA 3P0ZA 1ODEA 2HQSC 3JAWB 1RLUA 5FNVB 2FGYA 2BO1A 4C8EA 1XBIA 4G4WA 3IEQA 4FFBB 4LNUA 3CYPB 3JATA 4E6EA 3VOBA 5CA0B 3ZP7A 1YJNF 1VQMF 4B5CA 1H48A 3WJRA 2B33A 3I56F 2CW4A 1QVGF 1UI9A 1VQ8F 2RHJA 3MBMA 4O4JA 5JVDA 1KNJA 5IJ9A 5LA6B 3WGNA 3RYFB 3G71F 1COMA 2L26A 5DCVA 3JAKB 2HX0A 2UYPA 1QD9A 5KMGB 5EZYB 1IV4A 3GHZA 3L7QA 5LXTA 2RHOA 5EIBC 4TZZA 4I50B 3LFOA 3KE1A 4WBNA 5HY0A 2YXZA 3HKBA 1VQPF 4C82A 5GANK 1M90H 1YGYA 2Z1EA 5HXUA 3RYIA 2BTOA 3HKCA 1RA4A 5JCOA 5EIBD 3QUWA 3V3TA 5JH7B 3ON1A 4X20B 3EORA 3WGJA 2PMPA 3DDNA 4G4VA 3GTZA 3IKEA 3ZOPA 4LCKA 4ZHVA 1JY8A 1IV1A 5J2TA 2OTMA 1E7KA 2HP0A 1YJWF 3S0WA 3VOAA 2H8CA 2EWCA 4BT3A 2CVLA 2H8EA 4I55B 4DRXA 3HJWC 1H7MA 5LOVA 1DBFA 1SZQA 3CCJF 4BT7A 4U3JA 5CB4B 3RYCA 4O4HA 4O4LA 5EAZA 1FFXA 1FNJA 3WXMB 5J2UB 3VI6A 1W57A 2CHTA 4M8IA 5GIOC 3IEWA 3J7AR 3E20B 4C8IA 3S06A 1W5EA 3AGKA 3C9SA 3CCMF 1VHAA 1VQ7F 3LYBA 1VQNF 4G88A 5LP6B 1Q8RA 2HS3A 3JASA 3LWOC 4X1KB 1W40A 3CC4F 3Q8HA 4NQ3A 4TV8B 4ZHWA 3LWQC 5LYJA 1UFYA 2LBWA 1U3PA 2OTLF 3E22B 1SA0A 3I55F 2OTJF 1CN7A 4NWOB 3KIZA 3CCUF 3G6EF 3NVKE 1JFFA 1K9MH 2GLZA 1TUBA 2UZHA 2ZOVA 3M84A 5A2QM 3OBYA 4DXDA 4RQOA 1ONIA 2K1SA 3NVIB 4RHAA 2VXYA 3HKEA 5BMVB 4ZI7B 1VK3A 2AIFA 3JVHA 3FBAA 3S0YA 1PXWA 5JVDB 5CA1A 4ERHA 1ZWZA 2LCAA 2PHNA 3RYHA 1TVKB 3F0FA 4O4IA 1X25A 1FSZA 3PLAC 3K2XA 3WGMA 5FLXM 5AVMA 5HWEA 3CMEF 1VQ6F 3N2GA 5B8FA 5HY2A 2VAPA 3VYSC 1W5AA 4X1IA 3LWVC 1T0KB 2CSLA 2Z1TA 1W5FA 2IG8A 3K14A 2RB9A 4NUTA 2WALA 3UT5A 3ESJA 3CC7F 3LMEA 4ZOLA 1VQ4F 3ERNA 5GONA 2ZF8A 5IYZA 3MCAB 1Q82H 2IAFA 2I6DA 4F6RB 5C8YB 2DYYA 3OONA 4ZHQA 2QTPA 4YJ2B 4TUYA 5MN5A 4BVTA 4BW0B 2LBTA 4G4XA 4O2AB 1RLGA 4KWEA 4O2BA 4DRXB 3OW2F 5HP8A 3WPXA 2OZBA 5MN6A 2Z1FA 2UYNB 3JALA 3HTNA 3RYCB 4O4HB 4IHJA 2KTVA 1Q81H 4BT2A 2R6R1 3JAWA 5FNVA 2GVIA 3LDTA 3TD3A 2QEXF 1W581 3CCSF 1Z5VA 3PAFA 3VYUC 1W5BA 3OBWA 1JN1A 1Q7YH 1W41A 5CA0A 4HNAA 3JASB 1M1KH 3HKDA 1IV2A 3CB2A 1GO1A 3CCVF 3T80A 5LYJB 3WGLA 3SIVA 3VO8A 5LA6A 5KX5B 2H6LA 2UYJA 2QI2A 3RYFA 1R1MA 4X3MA 4BVRA 3JAKA 1VQ5F 3K12A 4C4WC 3ZO8A 5KMGA 5EZYA 4B62A 5EB1B 3WPWA 3D01A 3KJJA 1X52A 4C81A 2V9YA 4I50A 3CXCF 2HRUA 1X7PA 1NQ3A 5ITZB 2BTQB 1JJ2F 2Q1XA 4C8GA 1J7HA 2AMTA 2BTUA 1JD1A 1VQOF 3N2KB 2F9ZC 2HS4A 3D00A 4EB6A 4BY9D 3O85A 3F0EA 4X20A 2UYKA 5MN4A 1VQ9F 4ZHYB 4X1YB 3RYHB 1OAPA 3E1YA 1YJ9F 4O4IB 2VAWA 3MCQA 3P4EA 4EI9A 3LWPC 2AIZP 4LNUB 3C9UA 1W2BF 3N2GB 3JATB 1SDSA 1YITF 1W59A 2HVYD 1NMUB 4I55A 3CC2F 2NMUA 1W3EX 3N4ZA 1QAHA 5CB4A 3UT5B 3VTIC 1KD1H 3NK7A 4ZOLB 1YIJF 2Z01A 4YJ3A 4X3LA 4O4JB 5IYZB 3C8LA 4IIJA 3V7QA 5IJ9B 3J80M 2ZAUA 1H47A 3MQWA 1VQVA 4ZHQB 4B46A 3VYTC 4TV9A 3DC2A 5HXZA 4R40B 4TUYB 2KGWA 5LXTB 1YQNA 3VMFB 5LP6A 3C9RA 4WBNB 3KHNA 5EO3A 1CK2A 2VGMA 1FNKA 3F0GA 3FPIA 3CYQA 2MQEA 3HKBB 5EB0A 4EI8A 3SIUA 5JQGA 4O2BB 1NJIH 5GAPK 4I4TA 3CD6F 3V7EA 2CWJA 1U43A 3RYIB 3JARA 2QA4F 2KG4A 3S0HA 3GYQA 3HKCB 4IHJB 3P10A 2HRYA 3V4DA 3TD4A 2IQQA 2I6RA 4BT6A 3LWRC 3E22A 3CCQF 2CHSA 5EYPA 5IJ0A 3MDOA 5J2TB 1W42A 1T0AA 3IMPA 3VCZA 1KC8H 2HP0B 4HNAB 1GO0A 2OHWA 3CMAF 2CZWA 4B45A 4ZK7A 3WGKA 3I7TA 3D54A 3HKDB 3M1XA 5LOVB 2ZVZA 5BMVA 4ZI7A 3CCRF 4U3JB 1RQ7A 4O4LB 1FFXB 3BYQA 1XV2A 1TVKA 1VH8A 2ALEA 5IT9M 1XHOA 5LP6C 1KQSF 4BVSA 1QU9A 3IR9A 2Q1YA 3I3FA 2VGNA 4FFBA 1OFUA 2W8BC 2DT4A 3HAXD 4PWTA 3FD6A 4U39A 3VIUA 1S72F 4BVQA 3CPWF 1K73H 1KNKA 1VQLF 4XCQA 5FJ4C 2KTUA 4EB6B 1X7OA 2ZODA 3ELCA 2LBXA 3R0PA 3IKFA 3QHDA 4F6RA 5C8YA 1YI2F 2GZLA 3U0OA 3CCLF 2R751 4YJ2A 1SA0B 5HP7A 3WJQA 2Z1UA 3G4SF 2YYEA 4O2AA 1JFFB 1QVFF 1TUBB 1IV3A 3RE3A 3J81M 4G4YA 3RA6A 2FC3A 1RQ2A 2UYNA 2HS0A 1Z5WA 3JAMM 2VAMA 2JNBA 2HP3A 3HKEB 4YJ3B 3WJPA 5JH7A 1U40A 1GX1A 5CA1B 4IIJB 3QTYA 3K0TA 3CPQA 1CLIA 5GINC 4TV9B 2RHLA 3ZP4A 4EI7A 1N8RH 5JCOC 3HWUA 5EWRA 1VQKF 3KJKA 3TD5A 1XRGA 2RHHA 3NMUC 4X1IB 3JCMM 5JQGB 1PF5A 4I4TB 5G4UC 4BT4A 3JARB 2P6YA 5KX5A 1U3LA 5GONB 5G4VC 5J2UA
chains in the Genus database with same CATH topology
3VI6A 5GIPC 3CG6A 3NK6A 2QEXF 5GIOC 1DT9A 3LWRC 3CCQF 3CCSF 3PAFA 1K8AH 3J7AR 3E20B 3OBWA 3AGKA 1W42A 1Q7YH 1W41A 5HY4A 3CCMF 1IPAA 1KC8H 1VQ7F 1VQNF 3RA5A 1GO0A 2OHWA 3CCEF 3CMAF 2CZWA 3LWOC 3FFMA 1M1KH 1W40A 3CC4F 4NQ3A 3CCVF 1GO1A 3LWQC 3CCRF 1GZ0A 1YHQF 3SIVA 1Q86H 5HY1A 2LBWA 2OTLF 3N4YA 2QI2A 2ALEA 4X3MA 4BVRA 5IT9M 1KQSF 1VQ5F 4C4WC 2FGYA 4BVSA 2BO1A 3IR9A 1XBIA 2VGNA 1X52A 3I55F 1CN7A 3HAXD 3CXCF 3CCUF 1X7PA 3G6EF 1S72F 4BVQA 1K9MH 3CPWF 1JJ2F 3NVKE 1K73H 1YJNF 2GLZA 5A2QM 1VQLF 1VQMF 3OBYA 4XCQA 1VQOF 5FJ4C 3I56F 2F9ZC 2KTUA 3D00A 1QVGF 3NVIB 1X7OA 4BY9D 1VQ8F 3O85A 2AIFA 1PXWA 1Q81H 1VQ9F 2LBXA 1ZWZA 3E1YA 1YJ9F 3G71F 1YI2F 5DCVA 4EI9A 3CCLF 3PLAC 5FLXM 3LWPC 5HWEA 3CMEF 4TZZA 1W2BF 1VQ6F 3LFOA 3G4SF 1SDSA 1YITF 5HY2A 5HY0A 2HVYD 1NMUB 1T0KB 3LWVC 1VQPF 5GANK 1QVFF 1M90H 3CC2F 5HXUA 3J81M 1W3EX 3N4ZA 3RA6A 2FC3A 4NUTA 2WALA 1RA4A 1KD1H 3CC7F 3NK7A 3JAMM 1YIJF 1VQ4F 2JNBA 3V3TA 3ON1A 4X3LA 3MCAB 1Q82H 3V7QA 3J80M 3CPQA 2I6DA 4LCKA 5GINC 5HXZA 4EI7A 1E7KA 1YJWF 1N8RH 4BVTA 5EWRA 4BW0B 3VMFB 1VQKF 5EO3A 1CK2A 2VGMA 4EI8A 1RLGA 3NMUC 2OTJF 3SIUA 3HJWC 3JCMM 1NJIH 5GAPK 3OW2F 1H7MA 3CD6F 3V7EA 2OZBA 5G4UC 3CCJF 2QA4F 2KG4A 3GYQA 3WXMB 2KTVA 5G4VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  5GIP C;  3CG6 A;  3NK6 A;  2QEX F;  5GIO C;  1DT9 A;  3LWR C;  3CCQ F;  3CCS F;  3PAF A;  1K8A H;  3J7A R;  3E20 B;  3OBW A;  3AGK A;  1W42 A;  1Q7Y H;  1W41 A;  3CCM F;  1IPA A;  1KC8 H;  1VQ7 F;  1VQN F;  3RA5 A;  1GO0 A;  2OHW A;  3CCE F;  3CMA F;  2CZW A;  3LWO C;  3FFM A;  1M1K H;  1W40 A;  3CC4 F;  3CCV F;  1GO1 A;  3LWQ C;  3CCR F;  1GZ0 A;  1YHQ F;  3SIV A;  1Q86 H;  2LBW A;  2OTL F;  3N4Y A;  2QI2 A;  2ALE A;  4X3M A;  5IT9 M;  1KQS F;  1VQ5 F;  4C4W C;  2BO1 A;  3IR9 A;  1XBI A;  2VGN A;  1X52 A;  3I55 F;  1CN7 A;  3HAX D;  3CXC F;  3CCU F;  1X7P A;  3G6E F;  1S72 F;  3NVK E;  1K9M H;  3CPW F;  1JJ2 F;  1K73 H;  1YJN F;  5A2Q M;  1VQL F;  1VQM F;  3OBY A;  1VQO F;  5FJ4 C;  3I56 F;  2KTU A;  1QVG F;  3NVI B;  1X7O A;  4BY9 D;  1VQ8 F;  3O85 A;  2AIF A;  1PXW A;  1Q81 H;  1VQ9 F;  2LBX A;  1ZWZ A;  3E1Y A;  1YJ9 F;  3G71 F;  1YI2 F;  5DCV A;  3CCL F;  3PLA C;  5FLX M;  3LWP C;  3CME F;  4TZZ A;  1W2B F;  1VQ6 F;  3LFO A;  3G4S F;  1SDS A;  1YIT F;  2HVY D;  1NMU B;  1T0K B;  3LWV C;  1VQP F;  5GAN K;  1QVF F;  1M90 H;  3CC2 F;  3J81 M;  1W3E X;  3N4Z A;  3RA6 A;  2FC3 A;  4NUT A;  2WAL A;  1RA4 A;  1KD1 H;  3CC7 F;  3NK7 A;  3JAM M;  1YIJ F;  1VQ4 F;  2JNB A;  3ON1 A;  4X3L A;  3MCA B;  1Q82 H;  3V7Q A;  3J80 M;  3CPQ A;  2I6D A;  4LCK A;  5GIN C;  1E7K A;  1YJW F;  1N8R H;  5EWR A;  4BW0 B;  3VMF B;  1VQK F;  5EO3 A;  1CK2 A;  2VGM A;  3NMU C;  1RLG A;  2OTJ F;  3SIU A;  3HJW C;  3JCM M;  1NJI H;  5GAP K;  3OW2 F;  1H7M A;  3CD6 F;  3V7E A;  2OZB A;  5G4U C;  3CCJ F;  2QA4 F;  2KG4 A;  3GYQ A;  3WXM B;  2KTV A;  5G4V C; 
#chains in the Genus database with same CATH topology
 5GIP C;  3CG6 A;  3FD5 A;  3NK6 A;  1DT9 A;  4G4Z A;  3C9T A;  1K8A H;  5EYP B;  1W55 A;  2G9I A;  5IJ0 B;  5HY4 A;  1IPA A;  2N48 A;  5ITZ A;  3F6M A;  3S02 A;  3RA5 A;  3CCE F;  3F0D A;  4X1K A;  3S03 A;  3FFM A;  3N2K A;  4TV8 A;  4BT5 A;  3JAL B;  1GZ0 A;  1YHQ F;  1Q86 H;  3B6N A;  2ZVY A;  4X1Y A;  5HY1 A;  3M4S A;  3N4Y A;  3P0Z A;  1ODE A;  2HQS C;  3JAW B;  1RLU A;  5FNV B;  2FGY A;  2BO1 A;  4C8E A;  1XBI A;  4G4W A;  3IEQ A;  4FFB B;  4LNU A;  3CYP B;  3JAT A;  4E6E A;  3VOB A;  5CA0 B;  3ZP7 A;  1YJN F;  1VQM F;  4B5C A;  1H48 A;  3WJR A;  2B33 A;  3I56 F;  2CW4 A;  1QVG F;  1UI9 A;  1VQ8 F;  2RHJ A;  3MBM A;  4O4J A;  5JVD A;  1KNJ A;  5IJ9 A;  5LA6 B;  3WGN A;  3RYF B;  3G71 F;  1COM A;  2L26 A;  5DCV A;  3JAK B;  2HX0 A;  2UYP A;  1QD9 A;  5KMG B;  5EZY B;  1IV4 A;  3GHZ A;  3L7Q A;  5LXT A;  2RHO A;  5EIB C;  4TZZ A;  4I50 B;  3LFO A;  3KE1 A;  4WBN A;  5HY0 A;  2YXZ A;  3HKB A;  1VQP F;  4C82 A;  5GAN K;  1M90 H;  1YGY A;  2Z1E A;  5HXU A;  3RYI A;  2BTO A;  3HKC A;  1RA4 A;  5JCO A;  5EIB D;  3QUW A;  3V3T A;  5JH7 B;  3ON1 A;  4X20 B;  3EOR A;  3WGJ A;  2PMP A;  3DDN A;  4G4V A;  3GTZ A;  3IKE A;  3ZOP A;  4LCK A;  4ZHV A;  1JY8 A;  1IV1 A;  5J2T A;  2OTM A;  1E7K A;  2HP0 A;  1YJW F;  3S0W A;  3VOA A;  2H8C A;  2EWC A;  4BT3 A;  2CVL A;  2H8E A;  4I55 B;  4DRX A;  3HJW C;  1H7M A;  5LOV A;  1DBF A;  1SZQ A;  3CCJ F;  4BT7 A;  4U3J A;  5CB4 B;  3RYC A;  4O4H A;  4O4L A;  5EAZ A;  1FFX A;  1FNJ A;  3WXM B;  5J2U B;  3VI6 A;  1W57 A;  2CHT A;  4M8I A;  5GIO C;  3IEW A;  3J7A R;  3E20 B;  4C8I A;  3S06 A;  1W5E A;  3AGK A;  3C9S A;  3CCM F;  1VHA A;  1VQ7 F;  3LYB A;  1VQN F;  4G88 A;  5LP6 B;  1Q8R A;  2HS3 A;  3JAS A;  3LWO C;  4X1K B;  1W40 A;  3CC4 F;  3Q8H A;  4NQ3 A;  4TV8 B;  4ZHW A;  3LWQ C;  5LYJ A;  1UFY A;  2LBW A;  1U3P A;  2OTL F;  3E22 B;  1SA0 A;  3I55 F;  2OTJ F;  1CN7 A;  4NWO B;  3KIZ A;  3CCU F;  3G6E F;  3NVK E;  1JFF A;  1K9M H;  2GLZ A;  1TUB A;  2UZH A;  2ZOV A;  3M84 A;  5A2Q M;  3OBY A;  4DXD A;  4RQO A;  1ONI A;  2K1S A;  3NVI B;  4RHA A;  2VXY A;  3HKE A;  5BMV B;  4ZI7 B;  1VK3 A;  2AIF A;  3JVH A;  3FBA A;  3S0Y A;  1PXW A;  5JVD B;  5CA1 A;  4ERH A;  1ZWZ A;  2LCA A;  2PHN A;  3RYH A;  1TVK B;  3F0F A;  4O4I A;  1X25 A;  1FSZ A;  3PLA C;  3K2X A;  3WGM A;  5FLX M;  5AVM A;  5HWE A;  3CME F;  1VQ6 F;  3N2G A;  5B8F A;  5HY2 A;  2VAP A;  3VYS C;  1W5A A;  4X1I A;  3LWV C;  1T0K B;  2CSL A;  2Z1T A;  1W5F A;  2IG8 A;  3K14 A;  2RB9 A;  4NUT A;  2WAL A;  3UT5 A;  3ESJ A;  3CC7 F;  3LME A;  4ZOL A;  1VQ4 F;  3ERN A;  5GON A;  2ZF8 A;  5IYZ A;  3MCA B;  1Q82 H;  2IAF A;  2I6D A;  4F6R B;  5C8Y B;  2DYY A;  3OON A;  4ZHQ A;  2QTP A;  4YJ2 B;  4TUY A;  5MN5 A;  4BVT A;  4BW0 B;  2LBT A;  4G4X A;  4O2A B;  1RLG A;  4KWE A;  4O2B A;  4DRX B;  3OW2 F;  5HP8 A;  3WPX A;  2OZB A;  5MN6 A;  2Z1F A;  2UYN B;  3JAL A;  3HTN A;  3RYC B;  4O4H B;  4IHJ A;  2KTV A;  1Q81 H;  4BT2 A;  2R6R 1;  3JAW A;  5FNV A;  2GVI A;  3LDT A;  3TD3 A;  2QEX F;  1W58 1;  3CCS F;  1Z5V A;  3PAF A;  3VYU C;  1W5B A;  3OBW A;  1JN1 A;  1Q7Y H;  1W41 A;  5CA0 A;  4HNA A;  3JAS B;  1M1K H;  3HKD A;  1IV2 A;  3CB2 A;  1GO1 A;  3CCV F;  3T80 A;  5LYJ B;  3WGL A;  3SIV A;  3VO8 A;  5LA6 A;  5KX5 B;  2H6L A;  2UYJ A;  2QI2 A;  3RYF A;  1R1M A;  4X3M A;  4BVR A;  3JAK A;  1VQ5 F;  3K12 A;  4C4W C;  3ZO8 A;  5KMG A;  5EZY A;  4B62 A;  5EB1 B;  3WPW A;  3D01 A;  3KJJ A;  1X52 A;  4C81 A;  2V9Y A;  4I50 A;  3CXC F;  2HRU A;  1X7P A;  1NQ3 A;  5ITZ B;  2BTQ B;  1JJ2 F;  2Q1X A;  4C8G A;  1J7H A;  2AMT A;  2BTU A;  1JD1 A;  1VQO F;  3N2K B;  2F9Z C;  2HS4 A;  3D00 A;  4EB6 A;  4BY9 D;  3O85 A;  3F0E A;  4X20 A;  2UYK A;  5MN4 A;  1VQ9 F;  4ZHY B;  4X1Y B;  3RYH B;  1OAP A;  3E1Y A;  1YJ9 F;  4O4I B;  2VAW A;  3MCQ A;  3P4E A;  4EI9 A;  3LWP C;  2AIZ P;  4LNU B;  3C9U A;  1W2B F;  3N2G B;  3JAT B;  1SDS A;  1YIT F;  1W59 A;  2HVY D;  1NMU B;  4I55 A;  3CC2 F;  2NMU A;  1W3E X;  3N4Z A;  1QAH A;  5CB4 A;  3UT5 B;  3VTI C;  1KD1 H;  3NK7 A;  4ZOL B;  1YIJ F;  2Z01 A;  4YJ3 A;  4X3L A;  4O4J B;  5IYZ B;  3C8L A;  4IIJ A;  3V7Q A;  5IJ9 B;  3J80 M;  2ZAU A;  1H47 A;  3MQW A;  1VQV A;  4ZHQ B;  4B46 A;  3VYT C;  4TV9 A;  3DC2 A;  5HXZ A;  4R40 B;  4TUY B;  2KGW A;  5LXT B;  1YQN A;  3VMF B;  5LP6 A;  3C9R A;  4WBN B;  3KHN A;  5EO3 A;  1CK2 A;  2VGM A;  1FNK A;  3F0G A;  3FPI A;  3CYQ A;  2MQE A;  3HKB B;  5EB0 A;  4EI8 A;  3SIU A;  5JQG A;  4O2B B;  1NJI H;  5GAP K;  4I4T A;  3CD6 F;  3V7E A;  2CWJ A;  1U43 A;  3RYI B;  3JAR A;  2QA4 F;  2KG4 A;  3S0H A;  3GYQ A;  3HKC B;  4IHJ B;  3P10 A;  2HRY A;  3V4D A;  3TD4 A;  2IQQ A;  2I6R A;  4BT6 A;  3LWR C;  3E22 A;  3CCQ F;  2CHS A;  5EYP A;  5IJ0 A;  3MDO A;  5J2T B;  1W42 A;  1T0A A;  3IMP A;  3VCZ A;  1KC8 H;  2HP0 B;  4HNA B;  1GO0 A;  2OHW A;  3CMA F;  2CZW A;  4B45 A;  4ZK7 A;  3WGK A;  3I7T A;  3D54 A;  3HKD B;  3M1X A;  5LOV B;  2ZVZ A;  5BMV A;  4ZI7 A;  3CCR F;  4U3J B;  1RQ7 A;  4O4L B;  1FFX B;  3BYQ A;  1XV2 A;  1TVK A;  1VH8 A;  2ALE A;  5IT9 M;  1XHO A;  5LP6 C;  1KQS F;  4BVS A;  1QU9 A;  3IR9 A;  2Q1Y A;  3I3F A;  2VGN A;  4FFB A;  1OFU A;  2W8B C;  2DT4 A;  3HAX D;  4PWT A;  3FD6 A;  4U39 A;  3VIU A;  1S72 F;  4BVQ A;  3CPW F;  1K73 H;  1KNK A;  1VQL F;  4XCQ A;  5FJ4 C;  2KTU A;  4EB6 B;  1X7O A;  2ZOD A;  3ELC A;  2LBX A;  3R0P A;  3IKF A;  3QHD A;  4F6R A;  5C8Y A;  1YI2 F;  2GZL A;  3U0O A;  3CCL F;  2R75 1;  4YJ2 A;  1SA0 B;  5HP7 A;  3WJQ A;  2Z1U A;  3G4S F;  2YYE A;  4O2A A;  1JFF B;  1QVF F;  1TUB B;  1IV3 A;  3RE3 A;  3J81 M;  4G4Y A;  3RA6 A;  2FC3 A;  1RQ2 A;  2UYN A;  2HS0 A;  1Z5W A;  3JAM M;  2VAM A;  2JNB A;  2HP3 A;  3HKE B;  4YJ3 B;  3WJP A;  5JH7 A;  1U40 A;  1GX1 A;  5CA1 B;  4IIJ B;  3QTY A;  3K0T A;  3CPQ A;  1CLI A;  5GIN C;  4TV9 B;  2RHL A;  3ZP4 A;  4EI7 A;  1N8R H;  5JCO C;  3HWU A;  5EWR A;  1VQK F;  3KJK A;  3TD5 A;  1XRG A;  2RHH A;  3NMU C;  4X1I B;  3JCM M;  5JQG B;  1PF5 A;  4I4T B;  5G4U C;  4BT4 A;  3JAR B;  2P6Y A;  5KX5 A;  1U3L A;  5GON B;  5G4V C;  5J2U A; 
#chains in the Genus database with same CATH homology
 3VI6 A;  5GIP C;  3CG6 A;  3NK6 A;  2QEX F;  5GIO C;  1DT9 A;  3LWR C;  3CCQ F;  3CCS F;  3PAF A;  1K8A H;  3J7A R;  3E20 B;  3OBW A;  3AGK A;  1W42 A;  1Q7Y H;  1W41 A;  5HY4 A;  3CCM F;  1IPA A;  1KC8 H;  1VQ7 F;  1VQN F;  3RA5 A;  1GO0 A;  2OHW A;  3CCE F;  3CMA F;  2CZW A;  3LWO C;  3FFM A;  1M1K H;  1W40 A;  3CC4 F;  4NQ3 A;  3CCV F;  1GO1 A;  3LWQ C;  3CCR F;  1GZ0 A;  1YHQ F;  3SIV A;  1Q86 H;  5HY1 A;  2LBW A;  2OTL F;  3N4Y A;  2QI2 A;  2ALE A;  4X3M A;  4BVR A;  5IT9 M;  1KQS F;  1VQ5 F;  4C4W C;  2FGY A;  4BVS A;  2BO1 A;  3IR9 A;  1XBI A;  2VGN A;  1X52 A;  3I55 F;  1CN7 A;  3HAX D;  3CXC F;  3CCU F;  1X7P A;  3G6E F;  1S72 F;  4BVQ A;  1K9M H;  3CPW F;  1JJ2 F;  3NVK E;  1K73 H;  1YJN F;  2GLZ A;  5A2Q M;  1VQL F;  1VQM F;  3OBY A;  4XCQ A;  1VQO F;  5FJ4 C;  3I56 F;  2F9Z C;  2KTU A;  3D00 A;  1QVG F;  3NVI B;  1X7O A;  4BY9 D;  1VQ8 F;  3O85 A;  2AIF A;  1PXW A;  1Q81 H;  1VQ9 F;  2LBX A;  1ZWZ A;  3E1Y A;  1YJ9 F;  3G71 F;  1YI2 F;  5DCV A;  4EI9 A;  3CCL F;  3PLA C;  5FLX M;  3LWP C;  5HWE A;  3CME F;  4TZZ A;  1W2B F;  1VQ6 F;  3LFO A;  3G4S F;  1SDS A;  1YIT F;  5HY2 A;  5HY0 A;  2HVY D;  1NMU B;  1T0K B;  3LWV C;  1VQP F;  5GAN K;  1QVF F;  1M90 H;  3CC2 F;  5HXU A;  3J81 M;  1W3E X;  3N4Z A;  3RA6 A;  2FC3 A;  4NUT A;  2WAL A;  1RA4 A;  1KD1 H;  3CC7 F;  3NK7 A;  3JAM M;  1YIJ F;  1VQ4 F;  2JNB A;  3V3T A;  3ON1 A;  4X3L A;  3MCA B;  1Q82 H;  3V7Q A;  3J80 M;  3CPQ A;  2I6D A;  4LCK A;  5GIN C;  5HXZ A;  4EI7 A;  1E7K A;  1YJW F;  1N8R H;  4BVT A;  5EWR A;  4BW0 B;  3VMF B;  1VQK F;  5EO3 A;  1CK2 A;  2VGM A;  4EI8 A;  1RLG A;  3NMU C;  2OTJ F;  3SIU A;  3HJW C;  3JCM M;  1NJI H;  5GAP K;  3OW2 F;  1H7M A;  3CD6 F;  3V7E A;  2OZB A;  5G4U C;  3CCJ F;  2QA4 F;  2KG4 A;  3GYQ A;  3WXM B;  2KTV A;  5G4V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...