2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosome, hydrolase
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
3OW2F 3HAXD 2KG4A 3J80M 5FLXM 1VQPF 3CCEF 4BY9D 3LFOA 3MCAB 3G71F 2I6DA 1KC8H 1X7OA 1Q7YH 1W42A 1YHQF 1M90H 1VQ5F 1E7KA 1ZWZA 1X7PA 3CCJF 2CZWA 2OZBA 3CPWF 4X3LA 2HVYD 1PXWA 1VQ8F 2KTVA 3PAFA 1K9MH 3FFMA 1Q81H 2QEXF 2OHWA 3OBWA 3JCMM 1IPAA 3PLAC 3NK7A 3RA5A 3NK6A 5GINC 3E1YA 1YJNF 3SIUA 1YIJF 1X52A 1VQNF 1W3EX 1RA4A 5GIPC 3J81M 3ON1A 3VI6A 2QI2A 1GO1A 3LWVC 1YI2F 3G4SF 1VQMF 1Q82H 1YJ9F 1N8RH 3CC4F 3CMEF 1W40A 1GZ0A 3CG6A 3IR9A 3CCUF 1QVGF 3J7AR 2VGNA 3CCSF 3O85A 3WXMB 1GO0A 3HJWC 1K8AH 2QA4F 2ALEA 1VQ7F 3V7EA 3SIVA 2AIFA 3NVKE 5GANK 1NMUB 5EWRA 3CCVF 3I55F 1VQKF 5GAPK 2JNBA 4BW0B 2BO1A 3CMAF 1VQ4F 5EO3A 3LWRC 1CN7A 3GYQA 5G4VC 4NUTA 3CXCF 5DCVA 1H7MA 5FJ4C 3CCLF 4C4WC 1VQOF 1SDSA 5IT9M 3LWQC 2LBXA 1NJIH 1RLGA 1QVFF 3NVIB 4LCKA 3CCRF 5G4UC 3CC2F 1K73H 3NMUC 3JAMM 2KTUA 3CPQA 1YJWF 2LBWA 2FC3A 2VGMA 1W2BF 1T0KB 1W41A 1S72F 3V7QA 1KD1H 1VQ6F 2WALA 3OBYA 3CCMF 3E20B 1KQSF 3CC7F 1M1KH 1YITF 1VQLF 3G6EF 3CD6F 1CK2A 3LWPC 1VQ9F 3VMFB 3N4YA 5A2QM 1DT9A 4TZZA 3N4ZA 3CCQF 1Q86H 5GIOC 2OTJF 1JJ2F 1XBIA 3RA6A 3AGKA 3LWOC 4X3MA 2OTLF 3I56F
chains in the Genus database with same CATH superfamily
2R751 3VYTC 4ZHWA 2G9IA 3CCEF 4BY9D 5IJ9B 3MCAB 3KHNA 2RB9A 4TV9A 1Z5WA 1X7OA 5EB1B 3WJQA 5AVMA 1QU9A 1E7KA 1ZWZA 2VXYA 3I3FA 4DRXB 3DC2A 3CPWF 3FPIA 1W5AA 5CB4A 5CA1A 1VQ8F 5JQGA 1OAPA 1RQ7A 3VCZA 2QEXF 2OHWA 2HS3A 4C81A 5HWEA 2PMPA 1IPAA 1U3PA 1VQVA 3RA5A 3R0PA 4X1KB 3BYQA 3E1YA 2N48A 2ZVZA 4ZK7A 1X52A 4YJ3B 3J81M 3VI6A 3VTIC 3LWVC 3HJWC 4TUYA 2EWCA 2CVLA 1VQMF 4EI8A 3RYFB 4X20B 2LBTA 3JAWB 1W59A 2BTOA 2VGNA 3CCSF 3O85A 4G4VA 3S02A 3MBMA 4BVSA 3TD5A 1GO0A 5KX5A 4F6RB 1VQ7F 2L26A 4EI7A 4O2BB 4EB6B 2R6R1 3CCVF 3M84A 4B45A 5GAPK 4BW0B 1FNKA 4B46A 2YXZA 4M8IA 4NQ3A 4O4LA 1VH8A 4FFBB 1TVKA 4G4WA 3FD5A 5JH7A 3IKFA 5EYPB 1SDSA 3S0HA 1QVFF 4LCKA 3M4SA 3CCRF 4ZOLB 2BTUA 3OONA 3NMUC 4C8GA 4B62A 1FFXA 4TV8B 3IKEA 3FBAA 4EI9A 2GVIA 1YJWF 3WGLA 2FC3A 2DT4A 1COMA 2VGMA 4I4TB 1ONIA 3WPXA 1W2BF 4O4JB 5B8FA 3WGJA 3ZOPA 3UT5B 1KD1H 2WALA 2P6YA 3JVHA 4NWOB 5IJ9A 3TD4A 5EIBD 4BT5A 3LWPC 5IYZB 2CW4A 2IAFA 3CCQF 2CHTA 4DRXA 4WBNA 1J7HA 4YJ2A 2Z1FA 3MCQA 3LWOC 3K12A 1W5EA 1TUBA 2F9ZC 3VIUA 4X1KA 3RE3A 3HAXD 2KG4A 2RHJA 3J80M 4O4IB 2KGWA 3P10A 3WJPA 4PWTA 4BT2A 1W5FA 3CYPB 2I6DA 1OFUA 4YJ3A 1Q7YH 1W55A 3RYIB 1YHQF 4G4XA 3HTNA 4BT6A 4X20A 2Z1EA 3JAWA 1X7PA 3CCJF 2CZWA 5LOVB 1XRGA 3HKDA 3RYCB 4HNAB 5FNVA 1Q81H 3VOBA 4F6RA 1IV4A 2IQQA 2B33A 2Q1YA 3JALB 4EB6A 3PLAC 4KWEA 2DYYA 1GX1A 3VOAA 4X1YB 3RYHA 3JARB 1YJNF 2OTMA 2K1SA 1VQNF 1JN1A 1VK3A 1RA4A 5BMVB 3QTYA 1GO1A 4I50B 1YJ9F 2FGYA 5EYPA 4O2AB 3CC4F 3B6NA 1IV1A 3IR9A 1QVGF 4ZHVA 3LMEA 1JY8A 1YGYA 3WXMB 2ALEA 3V7EA 2HS4A 2H8EA 5JCOA 5HXZA 1NMUB 3NVKE 2MQEA 4I4TA 3CMAF 4O4JA 3E22B 3UT5A 3V4DA 4BT3A 1RQ2A 1CN7A 3LWRC 3GYQA 4LNUB 4NUTA 3CXCF 3WGMA 4O4HB 5FJ4C 3CCLF 2YYEA 4C4WC 5IYZA 5LYJA 3VO8A 1NQ3A 4I55B 1NJIH 1RLGA 5GONB 3KJJA 3CB2A 5KMGB 4BVTA 3N2GB 1K73H 3HKBB 2HP3A 1U3LA 3JAMM 2Z1UA 2KTUA 4IIJA 5J2UA 1PF5A 1U40A 2UYPA 2PHNA 3JATB 3QHDA 4ZHYB 1T0KB 1YQNA 4G4ZA 3V7QA 1S72F 1VQ6F 3OBYA 3D00A 3E20B 2HP0A 3L7QA 1KQSF 3WPWA 3ESJA 2ZODA 3G6EF 2IG8A 2UYNB 3RYIA 1CK2A 3VYUC 5LP6B 4B5CA 2UZHA 1DT9A 3N4ZA 5LOVA 3RYCA 4HNAA 5GIOC 2OTJF 5CA0A 4X3MA 1SA0B 3JALA 3D01A 1RLUA 3JASA 4X1YA 1XHOA 3KJKA 3ZO8A 3EORA 5LP6C 1VQPF 1QAHA 4U39A 3K2XA 3G71F 1KC8H 1W42A 5BMVA 1M90H 1VQ5F 1UFYA 3HWUA 3VYSC 5LXTB 3ZP7A 4O2AA 3S0WA 5CB4B 2HVYD 5C8YB 4E6EA 3FFMA 2I6RA 3OBWA 3NK7A 2W8BC 5MN4A 5GINC 3C9SA 3E22A 4LNUA 3IMPA 4O4HA 5GIPC 2VAPA 2RHLA 1Q82H 3GTZA 3G4SF 2HRYA 3FD6A 5ITZB 3MQWA 1W40A 1GZ0A 3CG6A 3RYFA 4ZHQB 5GONA 3CCUF 3N2KB 5KMGA 3N2GA 2NMUA 3HKBA 1K8AH 3WGNA 2QA4F 2HS0A 2ZVYA 3U0OA 3SIVA 2AIFA 1UI9A 5EWRA 4O2BA 1JFFB 3I55F 1VQKF 4DXDA 2BO1A 2BTQB 3IEWA 5HY0A 5EO3A 5G4VC 5J2TB 1W57A 1X25A 5DCVA 1TVKB 3M1XA 5JH7B 2ZAUA 2UYKA 4FFBA 1VHAA 5HP7A 1VQOF 3P0ZA 5LP6A 3LWQC 1H47A 1U43A 3CYQA 3GHZA 5EIBC 5MN6A 2RHOA 2CWJA 4ZOLA 5EB0A 4U3JB 3F6MA 4TV8A 2LBWA 5HY1A 4C82A 1SA0A 2H6LA 1FSZA 4IHJB 5IJ0B 1M1KH 2CSLA 1VQLF 3ERNA 3K14A 3ELCA 3N4YA 1Z5VA 5LXTA 4WBNB 4TZZA 4RHAA 4X1IB 4YJ2B 5HY4A 5C8YA 3F0FA 1XBIA 3RA6A 3AGKA 1CLIA 1TUBB 5EZYB 3F0DA 3I56F 4C8EA 3DDNA 2RHHA 3OW2F 5JVDB 2AMTA 3QUWA 4G4YA 4RQOA 5FLXM 4R40B 1R1MA 3KE1A 4G88A 4C8IA 3C9TA 3HKEB 2QTPA 3JAKB 3LFOA 4O4IA 5EAZA 4ZI7B 2AIZP 2Z01A 3WJRA 3F0EA 3IEQA 1FNJA 1Q8RA 5ITZA 3HKDB 2UYJA 5FNVB 2OZBA 4ZHQA 4X3LA 5MN5A 1PXWA 1XV2A 2Q1XA 3N2KA 2VAMA 3HKCB 2KTVA 3MDOA 3PAFA 1K9MH 5LA6B 3TD3A 3JCMM 3NK6A 1JFFA 3V3TA 2ZF8A 3RYHB 4BT7A 1DBFA 1JD1A 1IV3A 3SIUA 5J2TA 1YIJF 3S06A 4TV9B 3JARA 2V9YA 1W3EX 1KNJA 3S03A 1QD9A 3ON1A 2QI2A 1YI2F 1T0AA 1N8RH 4I50A 3CMEF 2HRUA 3J7AR 3P4EA 3KIZA 1W581 3C9UA 5CA1B 5JQGB 2H8CA 4ERHA 5HY2A 1KNKA 4U3JA 2ZOVA 5GANK 4BVRA 1SZQA 2HQSC 2JNBA 2VAWA 1VQ4F 1H48A 1IV2A 3C8LA 4IHJA 5IJ0A 4BVQA 1H7MA 1ODEA 5LYJB 3C9RA 4TUYB 5JCOC 5IT9M 2LBXA 3NVIB 3D54A 4I55A 4X1IA 5G4UC 3CC2F 5KX5B 3LYBA 3LDTA 4IIJB 5J2UB 4XCQA 2GZLA 3CPQA 5EZYA 2GLZA 2Z1TA 1W41A 2HP0B 3Q8HA 5JVDA 3JATA 3CCMF 3K0TA 4O4LB 3CC7F 3F0GA 3HKEA 3JAKA 4ZI7A 1YITF 3S0YA 2LCAA 3CD6F 1VQ9F 2UYNA 3VMFB 2HX0A 4BT4A 5A2QM 5HXUA 3I7TA 1Q86H 3HKCA 1FFXB 1JJ2F 5CA0B 3ZP4A 3WGKA 5LA6A 2CHSA 3JASB 2OTLF 3T80A 1W5BA 5HP8A
chains in the Genus database with same CATH topology
3OW2F 3HAXD 2KG4A 3J80M 5FLXM 1VQPF 3CCEF 4BY9D 3LFOA 3MCAB 3G71F 2I6DA 1KC8H 1X7OA 1Q7YH 1W42A 1YHQF 1M90H 1VQ5F 1E7KA 1ZWZA 1X7PA 3CCJF 2CZWA 2OZBA 3CPWF 4X3LA 2HVYD 1PXWA 1VQ8F 2KTVA 3PAFA 1K9MH 3FFMA 1Q81H 2QEXF 2OHWA 3OBWA 3JCMM 5HWEA 1IPAA 3PLAC 3NK7A 3RA5A 3NK6A 5GINC 3V3TA 3E1YA 1YJNF 3SIUA 1YIJF 1X52A 1VQNF 1W3EX 1RA4A 5GIPC 3J81M 3ON1A 3VI6A 2QI2A 1GO1A 3LWVC 1YI2F 3G4SF 1VQMF 1Q82H 1YJ9F 2FGYA 4EI8A 1N8RH 3CC4F 3CMEF 1W40A 1GZ0A 3CG6A 3IR9A 3CCUF 1QVGF 3J7AR 2VGNA 3CCSF 3O85A 4BVSA 3WXMB 1GO0A 3HJWC 1K8AH 5HY2A 2QA4F 2ALEA 1VQ7F 3V7EA 4EI7A 3SIVA 2AIFA 5HXZA 5GANK 3NVKE 1NMUB 5EWRA 3CCVF 4BVRA 3I55F 1VQKF 5GAPK 2JNBA 4BW0B 2BO1A 3CMAF 1VQ4F 5HY0A 5EO3A 3LWRC 1CN7A 3GYQA 5G4VC 4NQ3A 4NUTA 3CXCF 4BVQA 1H7MA 5DCVA 5FJ4C 3CCLF 4C4WC 1VQOF 1SDSA 5IT9M 3LWQC 2LBXA 1NJIH 1RLGA 1QVFF 3NVIB 4LCKA 3CCRF 4BVTA 5G4UC 3CC2F 1K73H 3NMUC 4EI9A 3JAMM 4XCQA 2KTUA 3CPQA 1YJWF 2LBWA 2FC3A 5HY1A 2GLZA 2VGMA 1W2BF 1T0KB 1W41A 1S72F 3V7QA 1KD1H 1VQ6F 2WALA 3OBYA 3CCMF 3D00A 3E20B 1KQSF 3CC7F 1M1KH 1YITF 1VQLF 3G6EF 3CD6F 1CK2A 3LWPC 1VQ9F 3VMFB 3N4YA 5A2QM 5HXUA 1DT9A 4TZZA 3N4ZA 3CCQF 1Q86H 5GIOC 2OTJF 1JJ2F 5HY4A 1XBIA 3RA6A 3AGKA 3LWOC 4X3MA 2OTLF 3I56F 2F9ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 F;  3HAX D;  2KG4 A;  3J80 M;  5FLX M;  1VQP F;  3CCE F;  4BY9 D;  3LFO A;  3MCA B;  3G71 F;  2I6D A;  1KC8 H;  1X7O A;  1Q7Y H;  1W42 A;  1YHQ F;  1M90 H;  1VQ5 F;  1E7K A;  1ZWZ A;  1X7P A;  3CCJ F;  2CZW A;  2OZB A;  3CPW F;  4X3L A;  2HVY D;  1PXW A;  1VQ8 F;  2KTV A;  3PAF A;  1K9M H;  3FFM A;  1Q81 H;  2QEX F;  2OHW A;  3OBW A;  3JCM M;  1IPA A;  3PLA C;  3NK7 A;  3RA5 A;  3NK6 A;  5GIN C;  3E1Y A;  1YJN F;  3SIU A;  1YIJ F;  1X52 A;  1VQN F;  1W3E X;  1RA4 A;  5GIP C;  3J81 M;  3ON1 A;  3VI6 A;  2QI2 A;  1GO1 A;  3LWV C;  1YI2 F;  3G4S F;  1VQM F;  1Q82 H;  1YJ9 F;  1N8R H;  3CC4 F;  3CME F;  1W40 A;  1GZ0 A;  3CG6 A;  3IR9 A;  3CCU F;  1QVG F;  3J7A R;  2VGN A;  3CCS F;  3O85 A;  3WXM B;  1GO0 A;  3HJW C;  1K8A H;  2QA4 F;  2ALE A;  1VQ7 F;  3V7E A;  3SIV A;  2AIF A;  3NVK E;  5GAN K;  1NMU B;  5EWR A;  3CCV F;  3I55 F;  1VQK F;  5GAP K;  2JNB A;  4BW0 B;  2BO1 A;  3CMA F;  1VQ4 F;  5EO3 A;  3LWR C;  1CN7 A;  3GYQ A;  5G4V C;  4NUT A;  3CXC F;  5DCV A;  1H7M A;  5FJ4 C;  3CCL F;  4C4W C;  1VQO F;  1SDS A;  5IT9 M;  3LWQ C;  2LBX A;  1NJI H;  1RLG A;  1QVF F;  3NVI B;  4LCK A;  3CCR F;  5G4U C;  3CC2 F;  1K73 H;  3NMU C;  3JAM M;  2KTU A;  3CPQ A;  1YJW F;  2LBW A;  2FC3 A;  2VGM A;  1W2B F;  1T0K B;  1W41 A;  1S72 F;  3V7Q A;  1KD1 H;  1VQ6 F;  2WAL A;  3OBY A;  3CCM F;  3E20 B;  1KQS F;  3CC7 F;  1M1K H;  1YIT F;  1VQL F;  3G6E F;  3CD6 F;  1CK2 A;  3LWP C;  1VQ9 F;  3VMF B;  3N4Y A;  5A2Q M;  1DT9 A;  4TZZ A;  3N4Z A;  3CCQ F;  1Q86 H;  5GIO C;  2OTJ F;  1JJ2 F;  1XBI A;  3RA6 A;  3AGK A;  3LWO C;  4X3M A;  2OTL F;  3I56 F; 
#chains in the Genus database with same CATH topology
 2R75 1;  3VYT C;  4ZHW A;  2G9I A;  3CCE F;  4BY9 D;  5IJ9 B;  3MCA B;  3KHN A;  2RB9 A;  4TV9 A;  1Z5W A;  1X7O A;  5EB1 B;  3WJQ A;  5AVM A;  1QU9 A;  1E7K A;  1ZWZ A;  2VXY A;  3I3F A;  4DRX B;  3DC2 A;  3CPW F;  3FPI A;  1W5A A;  5CB4 A;  5CA1 A;  1VQ8 F;  5JQG A;  1OAP A;  1RQ7 A;  3VCZ A;  2QEX F;  2OHW A;  2HS3 A;  4C81 A;  5HWE A;  2PMP A;  1IPA A;  1U3P A;  1VQV A;  3RA5 A;  3R0P A;  4X1K B;  3BYQ A;  3E1Y A;  2N48 A;  2ZVZ A;  4ZK7 A;  1X52 A;  4YJ3 B;  3J81 M;  3VI6 A;  3VTI C;  3LWV C;  3HJW C;  4TUY A;  2EWC A;  2CVL A;  1VQM F;  4EI8 A;  3RYF B;  4X20 B;  2LBT A;  3JAW B;  1W59 A;  2BTO A;  2VGN A;  3CCS F;  3O85 A;  4G4V A;  3S02 A;  3MBM A;  4BVS A;  3TD5 A;  1GO0 A;  5KX5 A;  4F6R B;  1VQ7 F;  2L26 A;  4EI7 A;  4O2B B;  4EB6 B;  2R6R 1;  3CCV F;  3M84 A;  4B45 A;  5GAP K;  4BW0 B;  1FNK A;  4B46 A;  2YXZ A;  4M8I A;  4NQ3 A;  4O4L A;  1VH8 A;  4FFB B;  1TVK A;  4G4W A;  3FD5 A;  5JH7 A;  3IKF A;  5EYP B;  1SDS A;  3S0H A;  1QVF F;  4LCK A;  3M4S A;  3CCR F;  4ZOL B;  2BTU A;  3OON A;  3NMU C;  4C8G A;  4B62 A;  1FFX A;  4TV8 B;  3IKE A;  3FBA A;  4EI9 A;  2GVI A;  1YJW F;  3WGL A;  2FC3 A;  2DT4 A;  1COM A;  2VGM A;  4I4T B;  1ONI A;  3WPX A;  1W2B F;  4O4J B;  5B8F A;  3WGJ A;  3ZOP A;  3UT5 B;  1KD1 H;  2WAL A;  2P6Y A;  3JVH A;  4NWO B;  5IJ9 A;  3TD4 A;  5EIB D;  4BT5 A;  3LWP C;  5IYZ B;  2CW4 A;  2IAF A;  3CCQ F;  2CHT A;  4DRX A;  4WBN A;  1J7H A;  4YJ2 A;  2Z1F A;  3MCQ A;  3LWO C;  3K12 A;  1W5E A;  1TUB A;  2F9Z C;  3VIU A;  4X1K A;  3RE3 A;  3HAX D;  2KG4 A;  2RHJ A;  3J80 M;  4O4I B;  2KGW A;  3P10 A;  3WJP A;  4PWT A;  4BT2 A;  1W5F A;  3CYP B;  2I6D A;  1OFU A;  4YJ3 A;  1Q7Y H;  1W55 A;  3RYI B;  1YHQ F;  4G4X A;  3HTN A;  4BT6 A;  4X20 A;  2Z1E A;  3JAW A;  1X7P A;  3CCJ F;  2CZW A;  5LOV B;  1XRG A;  3HKD A;  3RYC B;  4HNA B;  5FNV A;  1Q81 H;  3VOB A;  4F6R A;  1IV4 A;  2IQQ A;  2B33 A;  2Q1Y A;  3JAL B;  4EB6 A;  3PLA C;  4KWE A;  2DYY A;  1GX1 A;  3VOA A;  4X1Y B;  3RYH A;  3JAR B;  1YJN F;  2OTM A;  2K1S A;  1VQN F;  1JN1 A;  1VK3 A;  1RA4 A;  5BMV B;  3QTY A;  1GO1 A;  4I50 B;  1YJ9 F;  2FGY A;  5EYP A;  4O2A B;  3CC4 F;  3B6N A;  1IV1 A;  3IR9 A;  1QVG F;  4ZHV A;  3LME A;  1JY8 A;  1YGY A;  3WXM B;  2ALE A;  3V7E A;  2HS4 A;  2H8E A;  5JCO A;  5HXZ A;  1NMU B;  3NVK E;  2MQE A;  4I4T A;  3CMA F;  4O4J A;  3E22 B;  3UT5 A;  3V4D A;  4BT3 A;  1RQ2 A;  1CN7 A;  3LWR C;  3GYQ A;  4LNU B;  4NUT A;  3CXC F;  3WGM A;  4O4H B;  5FJ4 C;  3CCL F;  2YYE A;  4C4W C;  5IYZ A;  5LYJ A;  3VO8 A;  1NQ3 A;  4I55 B;  1NJI H;  1RLG A;  5GON B;  3KJJ A;  3CB2 A;  5KMG B;  4BVT A;  3N2G B;  1K73 H;  3HKB B;  2HP3 A;  1U3L A;  3JAM M;  2Z1U A;  2KTU A;  4IIJ A;  5J2U A;  1PF5 A;  1U40 A;  2UYP A;  2PHN A;  3JAT B;  3QHD A;  4ZHY B;  1T0K B;  1YQN A;  4G4Z A;  3V7Q A;  1S72 F;  1VQ6 F;  3OBY A;  3D00 A;  3E20 B;  2HP0 A;  3L7Q A;  1KQS F;  3WPW A;  3ESJ A;  2ZOD A;  3G6E F;  2IG8 A;  2UYN B;  3RYI A;  1CK2 A;  3VYU C;  5LP6 B;  4B5C A;  2UZH A;  1DT9 A;  3N4Z A;  5LOV A;  3RYC A;  4HNA A;  5GIO C;  2OTJ F;  5CA0 A;  4X3M A;  1SA0 B;  3JAL A;  3D01 A;  1RLU A;  3JAS A;  4X1Y A;  1XHO A;  3KJK A;  3ZO8 A;  3EOR A;  5LP6 C;  1VQP F;  1QAH A;  4U39 A;  3K2X A;  3G71 F;  1KC8 H;  1W42 A;  5BMV A;  1M90 H;  1VQ5 F;  1UFY A;  3HWU A;  3VYS C;  5LXT B;  3ZP7 A;  4O2A A;  3S0W A;  5CB4 B;  2HVY D;  5C8Y B;  4E6E A;  3FFM A;  2I6R A;  3OBW A;  3NK7 A;  2W8B C;  5MN4 A;  5GIN C;  3C9S A;  3E22 A;  4LNU A;  3IMP A;  4O4H A;  5GIP C;  2VAP A;  2RHL A;  1Q82 H;  3GTZ A;  3G4S F;  2HRY A;  3FD6 A;  5ITZ B;  3MQW A;  1W40 A;  1GZ0 A;  3CG6 A;  3RYF A;  4ZHQ B;  5GON A;  3CCU F;  3N2K B;  5KMG A;  3N2G A;  2NMU A;  3HKB A;  1K8A H;  3WGN A;  2QA4 F;  2HS0 A;  2ZVY A;  3U0O A;  3SIV A;  2AIF A;  1UI9 A;  5EWR A;  4O2B A;  1JFF B;  3I55 F;  1VQK F;  4DXD A;  2BO1 A;  2BTQ B;  3IEW A;  5HY0 A;  5EO3 A;  5G4V C;  5J2T B;  1W57 A;  1X25 A;  5DCV A;  1TVK B;  3M1X A;  5JH7 B;  2ZAU A;  2UYK A;  4FFB A;  1VHA A;  5HP7 A;  1VQO F;  3P0Z A;  5LP6 A;  3LWQ C;  1H47 A;  1U43 A;  3CYQ A;  3GHZ A;  5EIB C;  5MN6 A;  2RHO A;  2CWJ A;  4ZOL A;  5EB0 A;  4U3J B;  3F6M A;  4TV8 A;  2LBW A;  5HY1 A;  4C82 A;  1SA0 A;  2H6L A;  1FSZ A;  4IHJ B;  5IJ0 B;  1M1K H;  2CSL A;  1VQL F;  3ERN A;  3K14 A;  3ELC A;  3N4Y A;  1Z5V A;  5LXT A;  4WBN B;  4TZZ A;  4RHA A;  4X1I B;  4YJ2 B;  5HY4 A;  5C8Y A;  3F0F A;  1XBI A;  3RA6 A;  3AGK A;  1CLI A;  1TUB B;  5EZY B;  3F0D A;  3I56 F;  4C8E A;  3DDN A;  2RHH A;  3OW2 F;  5JVD B;  2AMT A;  3QUW A;  4G4Y A;  4RQO A;  5FLX M;  4R40 B;  1R1M A;  3KE1 A;  4G88 A;  4C8I A;  3C9T A;  3HKE B;  2QTP A;  3JAK B;  3LFO A;  4O4I A;  5EAZ A;  4ZI7 B;  2AIZ P;  2Z01 A;  3WJR A;  3F0E A;  3IEQ A;  1FNJ A;  1Q8R A;  5ITZ A;  3HKD B;  2UYJ A;  5FNV B;  2OZB A;  4ZHQ A;  4X3L A;  5MN5 A;  1PXW A;  1XV2 A;  2Q1X A;  3N2K A;  2VAM A;  3HKC B;  2KTV A;  3MDO A;  3PAF A;  1K9M H;  5LA6 B;  3TD3 A;  3JCM M;  3NK6 A;  1JFF A;  3V3T A;  2ZF8 A;  3RYH B;  4BT7 A;  1DBF A;  1JD1 A;  1IV3 A;  3SIU A;  5J2T A;  1YIJ F;  3S06 A;  4TV9 B;  3JAR A;  2V9Y A;  1W3E X;  1KNJ A;  3S03 A;  1QD9 A;  3ON1 A;  2QI2 A;  1YI2 F;  1T0A A;  1N8R H;  4I50 A;  3CME F;  2HRU A;  3J7A R;  3P4E A;  3KIZ A;  1W58 1;  3C9U A;  5CA1 B;  5JQG B;  2H8C A;  4ERH A;  5HY2 A;  1KNK A;  4U3J A;  2ZOV A;  5GAN K;  4BVR A;  1SZQ A;  2HQS C;  2JNB A;  2VAW A;  1VQ4 F;  1H48 A;  1IV2 A;  3C8L A;  4IHJ A;  5IJ0 A;  4BVQ A;  1H7M A;  1ODE A;  5LYJ B;  3C9R A;  4TUY B;  5JCO C;  5IT9 M;  2LBX A;  3NVI B;  3D54 A;  4I55 A;  4X1I A;  5G4U C;  3CC2 F;  5KX5 B;  3LYB A;  3LDT A;  4IIJ B;  5J2U B;  4XCQ A;  2GZL A;  3CPQ A;  5EZY A;  2GLZ A;  2Z1T A;  1W41 A;  2HP0 B;  3Q8H A;  5JVD A;  3JAT A;  3CCM F;  3K0T A;  4O4L B;  3CC7 F;  3F0G A;  3HKE A;  3JAK A;  4ZI7 A;  1YIT F;  3S0Y A;  2LCA A;  3CD6 F;  1VQ9 F;  2UYN A;  3VMF B;  2HX0 A;  4BT4 A;  5A2Q M;  5HXU A;  3I7T A;  1Q86 H;  3HKC A;  1FFX B;  1JJ2 F;  5CA0 B;  3ZP4 A;  3WGK A;  5LA6 A;  2CHS A;  3JAS B;  2OTL F;  3T80 A;  1W5B A;  5HP8 A; 
#chains in the Genus database with same CATH homology
 3OW2 F;  3HAX D;  2KG4 A;  3J80 M;  5FLX M;  1VQP F;  3CCE F;  4BY9 D;  3LFO A;  3MCA B;  3G71 F;  2I6D A;  1KC8 H;  1X7O A;  1Q7Y H;  1W42 A;  1YHQ F;  1M90 H;  1VQ5 F;  1E7K A;  1ZWZ A;  1X7P A;  3CCJ F;  2CZW A;  2OZB A;  3CPW F;  4X3L A;  2HVY D;  1PXW A;  1VQ8 F;  2KTV A;  3PAF A;  1K9M H;  3FFM A;  1Q81 H;  2QEX F;  2OHW A;  3OBW A;  3JCM M;  5HWE A;  1IPA A;  3PLA C;  3NK7 A;  3RA5 A;  3NK6 A;  5GIN C;  3V3T A;  3E1Y A;  1YJN F;  3SIU A;  1YIJ F;  1X52 A;  1VQN F;  1W3E X;  1RA4 A;  5GIP C;  3J81 M;  3ON1 A;  3VI6 A;  2QI2 A;  1GO1 A;  3LWV C;  1YI2 F;  3G4S F;  1VQM F;  1Q82 H;  1YJ9 F;  2FGY A;  4EI8 A;  1N8R H;  3CC4 F;  3CME F;  1W40 A;  1GZ0 A;  3CG6 A;  3IR9 A;  3CCU F;  1QVG F;  3J7A R;  2VGN A;  3CCS F;  3O85 A;  4BVS A;  3WXM B;  1GO0 A;  3HJW C;  1K8A H;  5HY2 A;  2QA4 F;  2ALE A;  1VQ7 F;  3V7E A;  4EI7 A;  3SIV A;  2AIF A;  5HXZ A;  5GAN K;  3NVK E;  1NMU B;  5EWR A;  3CCV F;  4BVR A;  3I55 F;  1VQK F;  5GAP K;  2JNB A;  4BW0 B;  2BO1 A;  3CMA F;  1VQ4 F;  5HY0 A;  5EO3 A;  3LWR C;  1CN7 A;  3GYQ A;  5G4V C;  4NQ3 A;  4NUT A;  3CXC F;  4BVQ A;  1H7M A;  5DCV A;  5FJ4 C;  3CCL F;  4C4W C;  1VQO F;  1SDS A;  5IT9 M;  3LWQ C;  2LBX A;  1NJI H;  1RLG A;  1QVF F;  3NVI B;  4LCK A;  3CCR F;  4BVT A;  5G4U C;  3CC2 F;  1K73 H;  3NMU C;  4EI9 A;  3JAM M;  4XCQ A;  2KTU A;  3CPQ A;  1YJW F;  2LBW A;  2FC3 A;  5HY1 A;  2GLZ A;  2VGM A;  1W2B F;  1T0K B;  1W41 A;  1S72 F;  3V7Q A;  1KD1 H;  1VQ6 F;  2WAL A;  3OBY A;  3CCM F;  3D00 A;  3E20 B;  1KQS F;  3CC7 F;  1M1K H;  1YIT F;  1VQL F;  3G6E F;  3CD6 F;  1CK2 A;  3LWP C;  1VQ9 F;  3VMF B;  3N4Y A;  5A2Q M;  5HXU A;  1DT9 A;  4TZZ A;  3N4Z A;  3CCQ F;  1Q86 H;  5GIO C;  2OTJ F;  1JJ2 F;  5HY4 A;  1XBI A;  3RA6 A;  3AGK A;  3LWO C;  4X3M A;  2OTL F;  3I56 F;  2F9Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...