2CZWA

Crystal structure analysis of protein component ph1496p of p.horikoshii ribonuclease p
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A fifth protein subunit Ph1496p elevates the optimum temperature for the ribonuclease P activity from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosome, hydrolase
molecule keywords 50S ribosomal protein L7Ae
total genus 39
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2czwA00
5GIOC 3FFMA 1YJNF 1VQ7F 5G4UC 1VQ6F 1YI2F 2OZBA 3OBYA 5FLXM 5GAPK 1T0KB 1S72F 4TZZA 1W40A 3CCVF 3PAFA 1IPAA 3CPQA 3I56F 1GO0A 1VQLF 3JAMM 3LWOC 3CC2F 5DCVA 1W3EX 2JNBA 1Q86H 4C4WC 1QVFF 1VQKF 3OBWA 1SDSA 2I6DA 3G4SF 3JCMM 3J80M 3G71F 3CCJF 1DT9A 3N4ZA 2VGMA 3CC7F 1K9MH 2KG4A 1YIJF 1KQSF 5FJ4C 3RA6A 1VQOF 3IR9A 3WXMB 3GYQA 3HAXD 3VMFB 2ALEA 1RLGA 2QI2A 1VQPF 3CD6F 2AIFA 1X7PA 1YJ9F 3V7EA 3RA5A 1M90H 3HJWC 1JJ2F 1K73H 3CCUF 2OTLF 1VQ4F 2KTUA 5GINC 1VQMF 1CN7A 1M1KH 5G4VC 1QVGF 3E20B 3OW2F 2CZWA 1W2BF 3E1YA 1E7KA 3LWRC 3NK6A 2OHWA 5GANK 1CK2A 3I55F 3SIVA 2BO1A 3CG6A 3N4YA 5GIPC 3CCRF 3CCLF 2QA4F 3G6EF 1K8AH 1VQNF 3SIUA 2VGNA 1RA4A 3CPWF 2LBXA 1W41A 1Q81H 3O85A 2LBWA 1X7OA 1YITF 3CMEF 1H7MA 3CCEF 2FC3A 1GZ0A 2WALA 1VQ9F 3J81M 1N8RH 1VQ8F 1XBIA 3CXCF 2OTJF 4X3LA 3CCMF 1YJWF 5A2QM 4NUTA 3CC4F 3NVIB 3VI6A 1Q7YH 4LCKA 3CCQF 1KD1H 3V7QA 3LWVC 4BW0B 5EWRA 1VQ5F 3PLAC 1X52A 3J7AR 1ZWZA 3NVKE 5EO3A 1GO1A 4X3MA 3AGKA 1YHQF 3CCSF 1W42A 3LFOA 3LWPC 3NK7A 1KC8H 4BY9D 5IT9M 3NMUC 1NMUB 1PXWA 3ON1A 2QEXF 2HVYD 1Q82H 3MCAB 3LWQC 3CMAF 2KTVA 1NJIH
chains in the Genus database with same CATH superfamily
5LYJA 5EB1B 4X1KB 4O2BB 3N2GB 4WBNB 1RQ7A 1VQ7F 5G4UC 3JATA 4G4YA 3OONA 1YI2F 3OBYA 2Z1EA 3K2XA 4LNUA 1W40A 1W55A 2HP3A 3ERNA 3FD6A 4ZHYB 5BMVA 3RYCB 4X1IB 3LWOC 3M4SA 1COMA 3CC2F 3S02A 4ERHA 5KMGB 1QVFF 3OBWA 2ZOVA 2EWCA 4ZOLA 5JCOA 4X20A 4BT4A 1R1MA 1DT9A 3KJJA 4B5CA 2HQSC 4I50B 4IIJA 4DXDA 1VQOF 2LBTA 4EI7A 2UYNA 3V4DA 2K1SA 3CD6F 1X7PA 2GVIA 4X1YA 3Q8HA 3RA5A 1M90H 2R751 1W59A 1VQ4F 4BT2A 3GTZA 5HY1A 1VQMF 1OFUA 3F6MA 1CN7A 1X25A 4E6EA 5EYPA 3K12A 5CA1B 1ONIA 3NK6A 5J2UA 2OHWA 2R6R1 1UI9A 4BT7A 1OAPA 1K8AH 3WGJA 4IHJA 1VQNF 4RHAA 4C8GA 3HKCB 1RA4A 1TVKA 1W41A 4O4JA 1X7OA 4BVRA 2F9ZC 1SA0B 3CMEF 1H7MA 2FC3A 2WALA 4X1IA 4ZHVA 4I55B 2VAWA 4F6RB 4ZHWA 1VQ8F 3CXCF 1VK3A 3JALB 5A2QM 4NUTA 4BT3A 4U39A 3F0GA 3NVIB 1Q7YH 4C81A 4F6RA 1KD1H 2NMUA 3RYIA 1Z5WA 4BW0B 4X1KA 1VQ5F 5HXZA 5MN6A 1W5FA 3QUWA 1VQVA 1VHAA 3JASB 1GO1A 4X3MA 1U40A 3IKFA 4EI8A 3I7TA 2UZHA 5JQGA 3CCSF 3QHDA 5EYPB 3VYTC 3F0FA 1IV4A 1JY8A 5HY4A 3NK7A 5HY2A 2H8EA 4BY9D 5IT9M 5JH7A 2CW4A 2UYJA 3NMUC 1NJIH 1UFYA 2QTPA 4PWTA 3LDTA 4RQOA 3FFMA 5AVMA 1YJNF 1W581 2RB9A 3JAKB 2OZBA 3U0OA 4O4IB 3FBAA 3C9TA 3CCVF 1YQNA 1U3PA 2RHJA 1VH8A 5EB0A 4C82A 3JAMM 5C8YA 3C9RA 2HP0A 3VOAA 4ZOLB 3F0EA 5DCVA 3CB2A 2H6LA 3WPXA 1SDSA 4TUYA 5ITZA 1W57A 3K0TA 3JCMM 3S0WA 3RYIB 5BMVB 5FJ4C 3MBMA 1FFXB 4BVSA 4LNUB 1FFXA 3F0DA 2UYKA 1RLGA 1SA0A 3FPIA 3MQWA 4O2AA 3V7EA 4YJ2B 4C8IA 2YXZA 1JJ2F 1DBFA 1K73H 3CCUF 5LOVB 2KTUA 5FNVB 3ZP7A 5G4VC 1QVGF 3OW2F 3LWRC 3LYBA 2G9IA 3KJKA 1W5EA 2BO1A 1U3LA 3CG6A 3N4YA 4C8EA 3WPWA 3G6EF 2IG8A 4U3JA 2DT4A 3O85A 5C8YB 3CCEF 2OTMA 4KWEA 3J81M 3VCZA 5IYZA 1JFFA 1JN1A 3RYHB 2OTJF 2HS0A 5EAZA 3P10A 3VI6A 3D54A 1H48A 2V9YA 3HKEA 1XV2A 5EIBD 4FFBA 4B62A 3V7QA 4DRXA 5JQGB 4G4ZA 3CYPB 3J7AR 3NVKE 5EO3A 5KMGA 4M8IA 1J7HA 1W5AA 3TD5A 2P6YA 5J2TA 3LFOA 2ZVZA 4NWOB 5HWEA 5LXTA 3RYCA 5HY0A 3D00A 4EB6A 4TV9B 3VO8A 5LOVA 2W8BC 3RYFA 3S06A 3ON1A 1Q82H 3UT5B 3MCAB 4O2BA 3CMAF 1T0AA 2CHSA 1X52A 1Z5VA 2Z01A 4O2AB 5GIOC 3HKCA 2VXYA 3EORA 3B6NA 4ZI7B 1FNJA 5FLXM 5IJ0A 1T0KB 1S72F 4TZZA 2YYEA 4G4VA 1IV3A 3PAFA 3S0HA 3CPQA 3I56F 3M84A 5CB4B 3MCQA 1GO0A 3LMEA 1QU9A 3HWUA 1XHOA 1RQ2A 4O4JB 3JARA 1W3EX 2ZVYA 3CYQA 5EIBC 4C4WC 3JAWB 3DDNA 1VQKF 1KNJA 1U43A 2I6DA 3HKDB 3J80M 2PMPA 3CCJF 3P4EA 4FFBB 2AIZP 3CC7F 1K9MH 4ZHQA 1YIJF 1KQSF 2AMTA 3DC2A 3QTYA 3RA6A 4IIJB 3HKBA 3WXMB 1W5BA 3KHNA 1VQPF 4X20B 3IEWA 5KX5A 3WJQA 1YJ9F 5KX5B 2Z1TA 5JVDA 2FGYA 2UYNB 2OTLF 3ZP4A 5EZYA 1KNKA 3E20B 3E22A 1XRGA 1W2BF 3E1YA 1E7KA 1Q8RA 5HP7A 3I55F 5FNVA 5IJ0B 2MQEA 3SIVA 3CCLF 4ZI7A 5GIPC 3CCRF 2QA4F 2KGWA 3WGMA 4HNAB 4BT5A 4WBNA 2VGNA 3SIUA 3N2GA 2LBXA 3JARB 1SZQA 2LBWA 3WGKA 4BVQA 2H8CA 4NQ3A 1YITF 3WJRA 1VQ9F 1XBIA 3CCMF 4R40B 4EB6B 1YJWF 5IJ9A 2HX0A 5IJ9B 3WJPA 3VIUA 3CC4F 4LCKA 3BYQA 3CCQF 3JATB 1QD9A 1YGYA 3LWVC 2ZAUA 4YJ3B 5CA0B 4G88A 5EWRA 3PLAC 1ZWZA 1TUBB 2CVLA 4HNAA 2BTQB 3VOBA 3AGKA 1NQ3A 3VYUC 4TV9A 1YHQF 2HP0B 1W42A 5J2UB 5CA1A 4B46A 4I4TB 4DRXB 5LP6B 2GLZA 3HTNA 3ZOPA 3L7QA 2L26A 2I6RA 5J2TB 4TV8A 2Z1UA 4B45A 1JFFB 3TD4A 2GZLA 2IQQA 1PXWA 2QEXF 1FSZA 1CLIA 3LWQC 5JVDB 4G4WA 4O4LA 3S03A 4X3LA 4X1YB 4O4LB 3M1XA 3KIZA 4G4XA 2PHNA 3T80A 3IEQA 1VQ6F 3R0PA 3HKBB 5GAPK 2CWJA 2LCAA 3WGLA 4ZHQB 1IPAA 2ZF8A 2HS3A 2Z1FA 2CHTA 1VQLF 1JD1A 3HKDA 3ESJA 3C8LA 3N2KA 2JNBA 5GONB 1Q86H 3JASA 1TUBA 1ODEA 4O4HA 3VTIC 3JVHA 3G4SF 3G71F 2Q1XA 3WGNA 3I3FA 2VGMA 3N4ZA 2HS4A 5MN5A 2KG4A 3ZO8A 3JALA 3IR9A 5B8FA 3GYQA 3RE3A 3VYSC 4I55A 3HAXD 3C9UA 2CSLA 3C9SA 3ELCA 3VMFB 5HXUA 2ALEA 2RHHA 2QI2A 2AIFA 5LYJB 4YJ2A 4O4HB 4TUYB 3V3TA 1TVKB 3HJWC 3UT5A 2HRUA 5LA6B 5GONA 5MN4A 3RYFB 4IHJB 3IKEA 2BTUA 5GINC 1FNKA 1M1KH 1GX1A 2IAFA 2CZWA 3E22B 3IMPA 5LXTB 2UYPA 4O4IA 1CK2A 5GANK 5EZYB 4BT6A 1PF5A 4BVTA 5ITZB 3GHZA 3CPWF 3N2KB 5LP6C 1Q81H 5JCOC 4EI9A 1GZ0A 5HP8A 2RHLA 1N8RH 5JH7B 3HKEB 3P0ZA 4TV8B 3FD5A 2VAMA 3RYHA 1QAHA 3JAKA 5IYZB 4I50A 3KE1A 2RHOA 3TD3A 3K14A 4U3JB 1RLUA 3S0YA 2N48A 3JAWA 4ZK7A 3MDOA 3D01A 2Q1YA 4YJ3A 5CA0A 2ZODA 3LWPC 5CB4A 1IV2A 2BTOA 2HRYA 4I4TA 5LP6A 2DYYA 4XCQA 1KC8H 2B33A 1NMUB 5LA6A 1H47A 2HVYD 2VAPA 1IV1A 2KTVA
chains in the Genus database with same CATH topology
5GIOC 3FFMA 1YJNF 1VQ7F 5G4UC 1VQ6F 1YI2F 2OZBA 3OBYA 5FLXM 5GAPK 1T0KB 1S72F 4TZZA 1W40A 3CCVF 3PAFA 1IPAA 3CPQA 3I56F 1GO0A 1VQLF 3JAMM 3LWOC 3CC2F 5DCVA 1W3EX 2JNBA 1Q86H 4C4WC 1QVFF 1VQKF 3OBWA 1SDSA 2I6DA 3G4SF 3JCMM 3J80M 3G71F 3CCJF 1DT9A 3N4ZA 2VGMA 3CC7F 1K9MH 2KG4A 1YIJF 1KQSF 5FJ4C 3RA6A 4BVSA 1VQOF 3IR9A 3WXMB 3GYQA 4EI7A 3HAXD 5HXUA 3VMFB 2ALEA 1RLGA 2QI2A 1VQPF 3CD6F 2AIFA 1X7PA 1YJ9F 3V7EA 3RA5A 3V3TA 1M90H 3HJWC 1JJ2F 2FGYA 1K73H 3CCUF 2OTLF 1VQ4F 2KTUA 5HY1A 5GINC 1VQMF 1CN7A 1M1KH 5G4VC 1QVGF 3E20B 3OW2F 2CZWA 1W2BF 3E1YA 1E7KA 3LWRC 3NK6A 2OHWA 5GANK 1CK2A 3I55F 4BVTA 3SIVA 2BO1A 3CG6A 3N4YA 5GIPC 3CCRF 3CCLF 2QA4F 3G6EF 1K8AH 1VQNF 3SIUA 2VGNA 1RA4A 3CPWF 2LBXA 1W41A 1Q81H 2LBWA 3O85A 1X7OA 4BVQA 2F9ZC 4BVRA 4NQ3A 1YITF 3CMEF 1H7MA 4EI9A 3CCEF 2FC3A 1GZ0A 2WALA 1VQ9F 3J81M 1N8RH 1VQ8F 1XBIA 3CXCF 2OTJF 4X3LA 3CCMF 1YJWF 5A2QM 4NUTA 3CC4F 3NVIB 3VI6A 1Q7YH 4LCKA 3CCQF 1KD1H 3V7QA 3LWVC 4BW0B 5EWRA 1VQ5F 5HXZA 3PLAC 1X52A 3J7AR 1ZWZA 3NVKE 5EO3A 1GO1A 4X3MA 3AGKA 4EI8A 1YHQF 3CCSF 1W42A 3LFOA 5HWEA 3LWPC 2GLZA 5HY4A 3D00A 3NK7A 5HY0A 4XCQA 5HY2A 1KC8H 4BY9D 5IT9M 3NMUC 1NMUB 1PXWA 3ON1A 2QEXF 2HVYD 1Q82H 3MCAB 3LWQC 3CMAF 2KTVA 1NJIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GIO C;  3FFM A;  1YJN F;  1VQ7 F;  5G4U C;  1VQ6 F;  1YI2 F;  2OZB A;  3OBY A;  5FLX M;  5GAP K;  1T0K B;  1S72 F;  4TZZ A;  1W40 A;  3CCV F;  3PAF A;  1IPA A;  3CPQ A;  3I56 F;  1GO0 A;  1VQL F;  3JAM M;  3LWO C;  3CC2 F;  5DCV A;  1W3E X;  2JNB A;  1Q86 H;  4C4W C;  1QVF F;  1VQK F;  3OBW A;  1SDS A;  2I6D A;  3G4S F;  3JCM M;  3J80 M;  3G71 F;  3CCJ F;  1DT9 A;  3N4Z A;  2VGM A;  3CC7 F;  1K9M H;  2KG4 A;  1YIJ F;  1KQS F;  5FJ4 C;  3RA6 A;  1VQO F;  3IR9 A;  3WXM B;  3GYQ A;  3HAX D;  3VMF B;  2ALE A;  1RLG A;  2QI2 A;  1VQP F;  3CD6 F;  2AIF A;  1X7P A;  1YJ9 F;  3V7E A;  3RA5 A;  1M90 H;  3HJW C;  1JJ2 F;  1K73 H;  3CCU F;  2OTL F;  1VQ4 F;  2KTU A;  5GIN C;  1VQM F;  1CN7 A;  1M1K H;  5G4V C;  1QVG F;  3E20 B;  3OW2 F;  2CZW A;  1W2B F;  3E1Y A;  1E7K A;  3LWR C;  3NK6 A;  2OHW A;  5GAN K;  1CK2 A;  3I55 F;  3SIV A;  2BO1 A;  3CG6 A;  3N4Y A;  5GIP C;  3CCR F;  3CCL F;  2QA4 F;  3G6E F;  1K8A H;  1VQN F;  3SIU A;  2VGN A;  1RA4 A;  3CPW F;  2LBX A;  1W41 A;  1Q81 H;  3O85 A;  2LBW A;  1X7O A;  1YIT F;  3CME F;  1H7M A;  3CCE F;  2FC3 A;  1GZ0 A;  2WAL A;  1VQ9 F;  3J81 M;  1N8R H;  1VQ8 F;  1XBI A;  3CXC F;  2OTJ F;  4X3L A;  3CCM F;  1YJW F;  5A2Q M;  4NUT A;  3CC4 F;  3NVI B;  3VI6 A;  1Q7Y H;  4LCK A;  3CCQ F;  1KD1 H;  3V7Q A;  3LWV C;  4BW0 B;  5EWR A;  1VQ5 F;  3PLA C;  1X52 A;  3J7A R;  1ZWZ A;  3NVK E;  5EO3 A;  1GO1 A;  4X3M A;  3AGK A;  1YHQ F;  3CCS F;  1W42 A;  3LFO A;  3LWP C;  3NK7 A;  1KC8 H;  4BY9 D;  5IT9 M;  3NMU C;  1NMU B;  1PXW A;  3ON1 A;  2QEX F;  2HVY D;  1Q82 H;  3MCA B;  3LWQ C;  3CMA F;  2KTV A;  1NJI H; 
#chains in the Genus database with same CATH topology
 5LYJ A;  5EB1 B;  4X1K B;  4O2B B;  3N2G B;  4WBN B;  1RQ7 A;  1VQ7 F;  5G4U C;  3JAT A;  4G4Y A;  3OON A;  1YI2 F;  3OBY A;  2Z1E A;  3K2X A;  4LNU A;  1W40 A;  1W55 A;  2HP3 A;  3ERN A;  3FD6 A;  4ZHY B;  5BMV A;  3RYC B;  4X1I B;  3LWO C;  3M4S A;  1COM A;  3CC2 F;  3S02 A;  4ERH A;  5KMG B;  1QVF F;  3OBW A;  2ZOV A;  2EWC A;  4ZOL A;  5JCO A;  4X20 A;  4BT4 A;  1R1M A;  1DT9 A;  3KJJ A;  4B5C A;  2HQS C;  4I50 B;  4IIJ A;  4DXD A;  1VQO F;  2LBT A;  4EI7 A;  2UYN A;  3V4D A;  2K1S A;  3CD6 F;  1X7P A;  2GVI A;  4X1Y A;  3Q8H A;  3RA5 A;  1M90 H;  2R75 1;  1W59 A;  1VQ4 F;  4BT2 A;  3GTZ A;  5HY1 A;  1VQM F;  1OFU A;  3F6M A;  1CN7 A;  1X25 A;  4E6E A;  5EYP A;  3K12 A;  5CA1 B;  1ONI A;  3NK6 A;  5J2U A;  2OHW A;  2R6R 1;  1UI9 A;  4BT7 A;  1OAP A;  1K8A H;  3WGJ A;  4IHJ A;  1VQN F;  4RHA A;  4C8G A;  3HKC B;  1RA4 A;  1TVK A;  1W41 A;  4O4J A;  1X7O A;  4BVR A;  2F9Z C;  1SA0 B;  3CME F;  1H7M A;  2FC3 A;  2WAL A;  4X1I A;  4ZHV A;  4I55 B;  2VAW A;  4F6R B;  4ZHW A;  1VQ8 F;  3CXC F;  1VK3 A;  3JAL B;  5A2Q M;  4NUT A;  4BT3 A;  4U39 A;  3F0G A;  3NVI B;  1Q7Y H;  4C81 A;  4F6R A;  1KD1 H;  2NMU A;  3RYI A;  1Z5W A;  4BW0 B;  4X1K A;  1VQ5 F;  5HXZ A;  5MN6 A;  1W5F A;  3QUW A;  1VQV A;  1VHA A;  3JAS B;  1GO1 A;  4X3M A;  1U40 A;  3IKF A;  4EI8 A;  3I7T A;  2UZH A;  5JQG A;  3CCS F;  3QHD A;  5EYP B;  3VYT C;  3F0F A;  1IV4 A;  1JY8 A;  5HY4 A;  3NK7 A;  5HY2 A;  2H8E A;  4BY9 D;  5IT9 M;  5JH7 A;  2CW4 A;  2UYJ A;  3NMU C;  1NJI H;  1UFY A;  2QTP A;  4PWT A;  3LDT A;  4RQO A;  3FFM A;  5AVM A;  1YJN F;  1W58 1;  2RB9 A;  3JAK B;  2OZB A;  3U0O A;  4O4I B;  3FBA A;  3C9T A;  3CCV F;  1YQN A;  1U3P A;  2RHJ A;  1VH8 A;  5EB0 A;  4C82 A;  3JAM M;  5C8Y A;  3C9R A;  2HP0 A;  3VOA A;  4ZOL B;  3F0E A;  5DCV A;  3CB2 A;  2H6L A;  3WPX A;  1SDS A;  4TUY A;  5ITZ A;  1W57 A;  3K0T A;  3JCM M;  3S0W A;  3RYI B;  5BMV B;  5FJ4 C;  3MBM A;  1FFX B;  4BVS A;  4LNU B;  1FFX A;  3F0D A;  2UYK A;  1RLG A;  1SA0 A;  3FPI A;  3MQW A;  4O2A A;  3V7E A;  4YJ2 B;  4C8I A;  2YXZ A;  1JJ2 F;  1DBF A;  1K73 H;  3CCU F;  5LOV B;  2KTU A;  5FNV B;  3ZP7 A;  5G4V C;  1QVG F;  3OW2 F;  3LWR C;  3LYB A;  2G9I A;  3KJK A;  1W5E A;  2BO1 A;  1U3L A;  3CG6 A;  3N4Y A;  4C8E A;  3WPW A;  3G6E F;  2IG8 A;  4U3J A;  2DT4 A;  3O85 A;  5C8Y B;  3CCE F;  2OTM A;  4KWE A;  3J81 M;  3VCZ A;  5IYZ A;  1JFF A;  1JN1 A;  3RYH B;  2OTJ F;  2HS0 A;  5EAZ A;  3P10 A;  3VI6 A;  3D54 A;  1H48 A;  2V9Y A;  3HKE A;  1XV2 A;  5EIB D;  4FFB A;  4B62 A;  3V7Q A;  4DRX A;  5JQG B;  4G4Z A;  3CYP B;  3J7A R;  3NVK E;  5EO3 A;  5KMG A;  4M8I A;  1J7H A;  1W5A A;  3TD5 A;  2P6Y A;  5J2T A;  3LFO A;  2ZVZ A;  4NWO B;  5HWE A;  5LXT A;  3RYC A;  5HY0 A;  3D00 A;  4EB6 A;  4TV9 B;  3VO8 A;  5LOV A;  2W8B C;  3RYF A;  3S06 A;  3ON1 A;  1Q82 H;  3UT5 B;  3MCA B;  4O2B A;  3CMA F;  1T0A A;  2CHS A;  1X52 A;  1Z5V A;  2Z01 A;  4O2A B;  5GIO C;  3HKC A;  2VXY A;  3EOR A;  3B6N A;  4ZI7 B;  1FNJ A;  5FLX M;  5IJ0 A;  1T0K B;  1S72 F;  4TZZ A;  2YYE A;  4G4V A;  1IV3 A;  3PAF A;  3S0H A;  3CPQ A;  3I56 F;  3M84 A;  5CB4 B;  3MCQ A;  1GO0 A;  3LME A;  1QU9 A;  3HWU A;  1XHO A;  1RQ2 A;  4O4J B;  3JAR A;  1W3E X;  2ZVY A;  3CYQ A;  5EIB C;  4C4W C;  3JAW B;  3DDN A;  1VQK F;  1KNJ A;  1U43 A;  2I6D A;  3HKD B;  3J80 M;  2PMP A;  3CCJ F;  3P4E A;  4FFB B;  2AIZ P;  3CC7 F;  1K9M H;  4ZHQ A;  1YIJ F;  1KQS F;  2AMT A;  3DC2 A;  3QTY A;  3RA6 A;  4IIJ B;  3HKB A;  3WXM B;  1W5B A;  3KHN A;  1VQP F;  4X20 B;  3IEW A;  5KX5 A;  3WJQ A;  1YJ9 F;  5KX5 B;  2Z1T A;  5JVD A;  2FGY A;  2UYN B;  2OTL F;  3ZP4 A;  5EZY A;  1KNK A;  3E20 B;  3E22 A;  1XRG A;  1W2B F;  3E1Y A;  1E7K A;  1Q8R A;  5HP7 A;  3I55 F;  5FNV A;  5IJ0 B;  2MQE A;  3SIV A;  3CCL F;  4ZI7 A;  5GIP C;  3CCR F;  2QA4 F;  2KGW A;  3WGM A;  4HNA B;  4BT5 A;  4WBN A;  2VGN A;  3SIU A;  3N2G A;  2LBX A;  3JAR B;  1SZQ A;  2LBW A;  3WGK A;  4BVQ A;  2H8C A;  4NQ3 A;  1YIT F;  3WJR A;  1VQ9 F;  1XBI A;  3CCM F;  4R40 B;  4EB6 B;  1YJW F;  5IJ9 A;  2HX0 A;  5IJ9 B;  3WJP A;  3VIU A;  3CC4 F;  4LCK A;  3BYQ A;  3CCQ F;  3JAT B;  1QD9 A;  1YGY A;  3LWV C;  2ZAU A;  4YJ3 B;  5CA0 B;  4G88 A;  5EWR A;  3PLA C;  1ZWZ A;  1TUB B;  2CVL A;  4HNA A;  2BTQ B;  3VOB A;  3AGK A;  1NQ3 A;  3VYU C;  4TV9 A;  1YHQ F;  2HP0 B;  1W42 A;  5J2U B;  5CA1 A;  4B46 A;  4I4T B;  4DRX B;  5LP6 B;  2GLZ A;  3HTN A;  3ZOP A;  3L7Q A;  2L26 A;  2I6R A;  5J2T B;  4TV8 A;  2Z1U A;  4B45 A;  1JFF B;  3TD4 A;  2GZL A;  2IQQ A;  1PXW A;  2QEX F;  1FSZ A;  1CLI A;  3LWQ C;  5JVD B;  4G4W A;  4O4L A;  3S03 A;  4X3L A;  4X1Y B;  4O4L B;  3M1X A;  3KIZ A;  4G4X A;  2PHN A;  3T80 A;  3IEQ A;  1VQ6 F;  3R0P A;  3HKB B;  5GAP K;  2CWJ A;  2LCA A;  3WGL A;  4ZHQ B;  1IPA A;  2ZF8 A;  2HS3 A;  2Z1F A;  2CHT A;  1VQL F;  1JD1 A;  3HKD A;  3ESJ A;  3C8L A;  3N2K A;  2JNB A;  5GON B;  1Q86 H;  3JAS A;  1TUB A;  1ODE A;  4O4H A;  3VTI C;  3JVH A;  3G4S F;  3G71 F;  2Q1X A;  3WGN A;  3I3F A;  2VGM A;  3N4Z A;  2HS4 A;  5MN5 A;  2KG4 A;  3ZO8 A;  3JAL A;  3IR9 A;  5B8F A;  3GYQ A;  3RE3 A;  3VYS C;  4I55 A;  3HAX D;  3C9U A;  2CSL A;  3C9S A;  3ELC A;  3VMF B;  5HXU A;  2ALE A;  2RHH A;  2QI2 A;  2AIF A;  5LYJ B;  4YJ2 A;  4O4H B;  4TUY B;  3V3T A;  1TVK B;  3HJW C;  3UT5 A;  2HRU A;  5LA6 B;  5GON A;  5MN4 A;  3RYF B;  4IHJ B;  3IKE A;  2BTU A;  5GIN C;  1FNK A;  1M1K H;  1GX1 A;  2IAF A;  2CZW A;  3E22 B;  3IMP A;  5LXT B;  2UYP A;  4O4I A;  1CK2 A;  5GAN K;  5EZY B;  4BT6 A;  1PF5 A;  4BVT A;  5ITZ B;  3GHZ A;  3CPW F;  3N2K B;  5LP6 C;  1Q81 H;  5JCO C;  4EI9 A;  1GZ0 A;  5HP8 A;  2RHL A;  1N8R H;  5JH7 B;  3HKE B;  3P0Z A;  4TV8 B;  3FD5 A;  2VAM A;  3RYH A;  1QAH A;  3JAK A;  5IYZ B;  4I50 A;  3KE1 A;  2RHO A;  3TD3 A;  3K14 A;  4U3J B;  1RLU A;  3S0Y A;  2N48 A;  3JAW A;  4ZK7 A;  3MDO A;  3D01 A;  2Q1Y A;  4YJ3 A;  5CA0 A;  2ZOD A;  3LWP C;  5CB4 A;  1IV2 A;  2BTO A;  2HRY A;  4I4T A;  5LP6 A;  2DYY A;  4XCQ A;  1KC8 H;  2B33 A;  1NMU B;  5LA6 A;  1H47 A;  2HVY D;  2VAP A;  1IV1 A;  2KTV A; 
#chains in the Genus database with same CATH homology
 5GIO C;  3FFM A;  1YJN F;  1VQ7 F;  5G4U C;  1VQ6 F;  1YI2 F;  2OZB A;  3OBY A;  5FLX M;  5GAP K;  1T0K B;  1S72 F;  4TZZ A;  1W40 A;  3CCV F;  3PAF A;  1IPA A;  3CPQ A;  3I56 F;  1GO0 A;  1VQL F;  3JAM M;  3LWO C;  3CC2 F;  5DCV A;  1W3E X;  2JNB A;  1Q86 H;  4C4W C;  1QVF F;  1VQK F;  3OBW A;  1SDS A;  2I6D A;  3G4S F;  3JCM M;  3J80 M;  3G71 F;  3CCJ F;  1DT9 A;  3N4Z A;  2VGM A;  3CC7 F;  1K9M H;  2KG4 A;  1YIJ F;  1KQS F;  5FJ4 C;  3RA6 A;  4BVS A;  1VQO F;  3IR9 A;  3WXM B;  3GYQ A;  4EI7 A;  3HAX D;  5HXU A;  3VMF B;  2ALE A;  1RLG A;  2QI2 A;  1VQP F;  3CD6 F;  2AIF A;  1X7P A;  1YJ9 F;  3V7E A;  3RA5 A;  3V3T A;  1M90 H;  3HJW C;  1JJ2 F;  2FGY A;  1K73 H;  3CCU F;  2OTL F;  1VQ4 F;  2KTU A;  5HY1 A;  5GIN C;  1VQM F;  1CN7 A;  1M1K H;  5G4V C;  1QVG F;  3E20 B;  3OW2 F;  2CZW A;  1W2B F;  3E1Y A;  1E7K A;  3LWR C;  3NK6 A;  2OHW A;  5GAN K;  1CK2 A;  3I55 F;  4BVT A;  3SIV A;  2BO1 A;  3CG6 A;  3N4Y A;  5GIP C;  3CCR F;  3CCL F;  2QA4 F;  3G6E F;  1K8A H;  1VQN F;  3SIU A;  2VGN A;  1RA4 A;  3CPW F;  2LBX A;  1W41 A;  1Q81 H;  2LBW A;  3O85 A;  1X7O A;  4BVQ A;  2F9Z C;  4BVR A;  4NQ3 A;  1YIT F;  3CME F;  1H7M A;  4EI9 A;  3CCE F;  2FC3 A;  1GZ0 A;  2WAL A;  1VQ9 F;  3J81 M;  1N8R H;  1VQ8 F;  1XBI A;  3CXC F;  2OTJ F;  4X3L A;  3CCM F;  1YJW F;  5A2Q M;  4NUT A;  3CC4 F;  3NVI B;  3VI6 A;  1Q7Y H;  4LCK A;  3CCQ F;  1KD1 H;  3V7Q A;  3LWV C;  4BW0 B;  5EWR A;  1VQ5 F;  5HXZ A;  3PLA C;  1X52 A;  3J7A R;  1ZWZ A;  3NVK E;  5EO3 A;  1GO1 A;  4X3M A;  3AGK A;  4EI8 A;  1YHQ F;  3CCS F;  1W42 A;  3LFO A;  5HWE A;  3LWP C;  2GLZ A;  5HY4 A;  3D00 A;  3NK7 A;  5HY0 A;  4XCQ A;  5HY2 A;  1KC8 H;  4BY9 D;  5IT9 M;  3NMU C;  1NMU B;  1PXW A;  3ON1 A;  2QEX F;  2HVY D;  1Q82 H;  3MCA B;  3LWQ C;  3CMA F;  2KTV A;  1NJI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...