The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
271
|
structure length |
246
|
Chain Sequence |
VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGRVVISLGRTQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Component of sodium-driven polar flagellar motor
|
publication title |
Insights into the stator assembly of the Vibrio flagellar motor from the crystal structure of MotY
pubmed doi rcsb |
source organism |
Vibrio alginolyticus
|
molecule tags |
Structural protein
|
total genus |
49
|
structure length |
246
|
sequence length |
271
|
ec nomenclature | |
pdb deposition date | 2007-12-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00691 | OmpA | OmpA family |
A | PF18393 | MotY_N | MotY N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | OmpA-like domain |