2ZF8A

Crystal structure of moty
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
271
structure length
246
Chain Sequence
VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGRVVISLGRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the stator assembly of the Vibrio flagellar motor from the crystal structure of MotY
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Structural protein
molecule keywords Component of sodium-driven polar flagellar motor
total genus 49
structure length 246
sequence length 271
ec nomenclature
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
A PF18393 MotY_N MotY N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2540 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zf8A01
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zf8A02
4ZHYB 3CYQA 5EAZA 4G4WA 2N48A 2MQEA 2W8BC 4G4YA 3S02A 3TD3A 4B62A 2AIZP 3WPXA 3S0WA 2HQSC 2KGWA 3S0HA 3TD5A 4ERHA 3S06A 2ZF8A 3S03A 2LBTA 1OAPA 2L26A 4PWTA 3LDTA 2ZOVA 3CYPB 2K1SA 2ZVYA 3KHNA 1R1MA 2LCAA 4G4VA 3IMPA 4G4XA 3OONA 5EB0A 4G4ZA 3TD4A 4G88A 4B5CA 4ZHWA 3S0YA 5EB1B 3WPWA 4ZHVA 2ZVZA 4RHAA 4R40B
chains in the Genus database with same CATH superfamily
2GIYA 1TJHH 4PJ7F 3JV4B 3BN9D 2VXQL 3NZUA 1OCOB 3SKOB 2HG5B 4OI8A 1EJ6A 2OSLA 5DJXA 4LSVL 3RYMA 5CO1A 1RZFH 3DGCR 3UAJC 1R5VB 3HPJB 4QYAA 4HX1B 4WJ5B 3GI9H 3VB9A 1B0GB 3M07A 4CJ1A 2X4UB 5E94A 4J3TA 5JO5A 4ZTPL 4JFPB 2J8OA 3ZUNC 3U6XS 4UYPA 3IJYB 5C3TA 1KNOA 4BK4A 3VDAA 1U8LA 3B2MA 3DURA 3QRBA 3S8GB 1UTDA 3RWDB 5CCHE 3LKPA 3FT3B 2UVFA 3G6JF 5IQOA 4YDLC 2HRUA 4FXGA 5DJYB 3LS5H 3EJSA 3NSYA 3D39D 1RUAL 3FO9B 1SBSH 4HUXA 4RGNB 4XP5H 5D7LA 1RJLA 3CB2A 5I1AA 2E7MA 3SJVA 2M1KA 4UZUA 1J1OL 3D2UB 4WO4C 1DR9A 32C2A 1N5AB 3MRJA 5E8DH 4GLRI 3TIDB 5DRNB 2UZPA 4ZPVA 4MNHB 1PZ2A 5EG6C 3H9SD 5B3JF 4PJFA 2HRPL 2I60H 4PJHE 4D9LL 2VXSL 4NLHA 3NTCL 1WQVT 1JF1A 4PJIA 4TVPH 5AW0B 4OLWL 4J3OH 4KC3B 3PXHA 1HILB 3DX8B 2X4RB 3HJ0A 5I6XC 1CXKA 1VQPF 1I7UB 4Y16A 2NT0A 4M6AA 1PNCA 2E6JA 1KXQA 5F89B 5D55A 5IFAL 4NQCB 2NR6A 4F7TB 1X5KA 2QPSA 1MREL 1JZDC 2VUYA 4R96B 4WW1A 3I75B 3DIFB 5E03A 2X9YA 25C8L 1TO4A 3FU9A 2FJUB 2TRYA 2DLFH 4U1GC 4B9CA 3W57A 5T33H 3KH3A 1IL1A 3ET9F 4DJMA 2LBXA 4M29A 2HMID 2Z92B 4OF0A 1R9FA 2AV1B 4KXAA 5EYPA 2VDPL 3SE9H 2AXGB 3QIUD 3F62A 2VGMA 1A65A 2Q20A 5EIIB 2CGZA 3U6RB 1BAWA 1U92B 1FGNL 3NK4A 3MLVH 5MEPB 3C2AH 1MRDL 2GTZA 1WWCA 2WXFA 4X7CC 1HDMB 4PQXA 4OD1L 4IU3B 3FO1B 2LW3A 2OMNA 5INCA 5DC4B 1EEYB 5AKVA 1U8QA 1EBAA 1BV8A 1S7VB 2VR5A 3WNPA 4DP0X 3MRNA 1NGZB 2CKBB 2N7BA 3CBRA 4LSRL 3FZUC 1KYFA 1X7QB 2HT3C 1CZ8L 2FT6A 2X09A 4G7YL 5KBLA 4PV8B 2OMYA 5T1KA 2OZ4L 3ZTJH 1PGRB 1Q94A 2IDQA 1CDCA 5C86A 3RB7A 1FYTB 3EH3B 7CGTA 2BIHA 2YXZA 1KCKA 4O02A 4Z0BH 4KUCF 5FIEA 2UYLB 2AK1H 5FGCB 1OF2B 1QP1A 1OARL 5AVTB 1E7VA 1I75A 1DJGA 3HI6H 1VACA 1RIVH 1J10A 3QI9C 4X8GA 1KUMA 2L7JA 3E8UL 4OCSL 4YIQA 3GSVA 3ZDXE 3QZOA 1U8NB 3M86A 2R23A 4OF3A 4Z7VE 4L3AA 2XYCA 1GW6A 4M6MH 1A7PH 1CGVA 4LCWA 4BUQA 5IVZB 3SKMB 2L0DA 3CSYA 1Z7JA 4R90H 3HHSB 2OQJA 3D54A 1PIFA 3RVXD 4WK0B 4KDWA 1VADA 3MYJB 4NZUL 4W9IC 4E5XG 4LESA 4S1RH 5DJCA 1KCRH 4XE5B 1KB9K 1DQDH 1BG9A 3BFWA 3F6IA 3SE8L 2GJ6D 2BY2A 2LCAA 3PAZA 2JB5L 4KXCA 2X1PA 4AQ1A 3KL5A 3DI3B 2NY4D 3HE7D 1LEIB 2DBLH 2UY7A 5CINL 4UM9D 2AW2A 3N43B 3C6SA 5ITZB 4MMXA 4ZMLA 4OAWA 3O0LA 1S9WA 2C7FA 4FL4B 1YEHH 2H6PB 1MLBA 2VJ0A 3GSUA 1QYGL 4LP5A 3IJ7A 4Q89A 4R4FL 3T4YB 3RWIB 3JV5A 3V5KB 2JSFA 4MA3A 3QVAA 3P4EA 4FNPA 4Z7NB 3QNXB 4HMEA 1KIUA 1RHHA 4Y4KA 5HYJA 3BAYA 2BO1A 3K6FA 1KDJA 4FOMA 4GRLA 5JPNA 4NQSA 3EOBA 1CG9B 5DGRA 2NCMA 5H8DA 3FQUA 4YHPA 1NFIB 5FK9A 3W38A 5EZOL 4ZTOH 1M71A 3MV8D 4V2CB 3CFBA 3E3QC 2J5WA 4W6YB 4XZ4A 1T6WA 4ZTEA 2A9NL 5AWNH 3PWLB 4X1IB 3KAAA 4RDBA 1VGEH 4HCIA 3WIFA 3GSOB 5D1XE 5BUAA 1L5GA 4ENED 4M5TA 5IR1B 4A7UA 5DXWA 2CNZA 4HWBH 1UGNA 5GS2H 5AW1B 3MLSH 5IBLC 1E9PA 3HAEG 5A3IC 5C0RH 5IMOA 2EO1A 2CHSA 3PDOA 1JK9A 1I31A 1MWOA 2CZNA 5FYJD 5GSVB 2GK0B 4TNVF 4Y9GA 3ZKMD 3RWHA 4JO2L 2Z4QA 3EFOA 2JWYA 3QG6B 3QH3A 5J1AA 1J9CT 4DZ8B 4HT1L 2P5EB 3O6FC 3S36H 5FWRA 3OSVA 1MCCA 1OAYL 2YR3A 4HXAL 1J1XL 3IK2A 3U7YH 3MBMA 3T3PE 1DVUA 1AHWA 1B4JL 1FC2D 3BKCH 2F15A 4P5TB 3VG0H 2RQ8A 1FFXB 3CUPA 3CMGA 1XBIA 5D1QD 5EWIH 3VFPA 1IX2A 5AD0A 3EOBB 3G5XB 3LRMA 3QS2A 2BINA 3MJ9H 4RWHA 2G60H 3WG7B 2XWRA 2PWGA 2X70B 3HC4L 3OX8A 5C0IA 1CIDA 3EXJA 2BH0A 2PW1B 4R26H 4GRWH 4JPIB 4F7CB 5AD0B 4I87A 5IMMA 3FO0H 1AQDA 3A4EA 3LAFA 1JL8A 1F0LA 1LE9A 1CL7I 4AXWB 2BNQB 1BF2A 4FNLL 2NY0D 3ECBB 4FFVD 4K7PL 1P4IH 3BQUA 3P0YL 3BMVA 2YHGA 3SE4A 1G84A 1EDHA 1NCDL 4QRPB 4YLBA 2QMJA 4F8NA 2IXQA 5CF3A 1S5HB 1T22B 3O8XC 4EUPG 2KH2B 5KJRL 1ZXQA 4DQAA 4QTIH 5ABDE 1F4YL 2WWNA 4A55A 5LBVA 3V4VB 3T0EA 2BVPB 1YNKH 2QPUA 4HKJA 1HOEA 2R0WH 5DF0A 3LZPA 3B3IB 1X4XA 5L2JA 4AGPA 2OQJB 4EUPB 4GSDH 1QBML 3F85A 2GTWB 5D1XA 1TTCA 3LKOB 5E8EA 4NXKA 3DVGB 3GSVB 1J9RA 3WGMA 3MROB 5T3ZD 3DV4B 3KR3L 3L8QA 1E8XA 5C6TH 5CZXD 1FO0L 2XETA 3MRCA 3VI4B 1CL7H 5JOPD 5E8OA 4L3CB 4AJ0A 3M84A 4J8RA 2J88H 2VMFA 3IMWA 1HJBC 3GIVA 1A1MA 3UZVA 2FWSA 2LR4A 1HX0A 4MAZA 3GLAA 2W95A 3UG4A 3WGLA 4WV1B 1R1MA 5F7UA 4BQBA 2IANE 3VH8G 5F3HA 3OM3B 4JPVH 1XIWC 1A14H 4OB5H 5CGMA 4H25A 1JIBA 5C0ND 1LK3H 2ARJA 3LX9A 4FLSA 3S3DB 3V10A 5I73B 1JGUL 2KLTA 2E59A 1CD1A 5GS1C 1EPFA 3VRJB 4YS4A 4G4YA 1ED3A 3WBDA 4AC4A 4OT1H 2PW2B 4ZW8A 1K4DA 4XNMA 2Q0ZX 2H45A 1BOGB 5EC2B 4XOEA 5I0YA 1G94A 2FC3A 5MEOA 4HYTB 1WITA 4WTZG 4PJ9C 4Z5RA 4NNXA 3F0GA 4O2AA 2Y24A 4YXKH 1BGXH 4N2FA 4O00A 1IAOB 3RHWF 4M7KL 4GG6E 3MLYH 1H3GA 1MFNA 1VIWA 2GK0A 1YNTA 3MCYA 3KJKA 3VAEA 1BVKB 4RA0C 1XMWA 4I89A 3RYCB 5ESQA 1IPAA 3ZE0F 3U7AA 2UV3A 3LKNA 4FFWC 1ZLWH 3OXRB 4EVNA 3F7LA 3LXBA 5EBMA 1CGUA 2IAMB 3FRUA 3ML8A 3PLYA 1OF2A 3FU7B 2VRKA 3MV11 4BT2A 1ZLVK 3PFQA 3BISA 4AQ8A 2VSMB 2FLRT 4HXAH 1EO7A 5GS0H 1D7DA 1R33A 3QUZB 3VXUA 3SY0B 2NX5B 5IWLC 3V7EA 2Z6FA 4L18A 1ONQA 1CDYA 4YHPB 3BRFA 2Y1VA 1GJUA 1H8NA 4UTAL 3VI3E 3TASA 3B1UA 3P3SA 3KEDA 4LPCA 3IJHA 3IF1A 3QEQA 3OKEB 1LWJA 1YEDA 1SYVA 3V9EA 4D8OA 1UXSA 4ONOA 2EIDA 3Q5OA 1RQ7A 4P2RE 2CK2A 5DI8A 3MLZH 3R8BB 5IKCA 3NPZB 1U2HA 2OS7A 4HIIB 5EPMB 4LE8A 1J8SA 1HQ4B 5FS5A 2GT9B 4HAKA 2JJTC 1FNEA 2NPLX 2J20A 3JWNH 3O6KL 1W55A 5JDSA 1D5XA 3WNNA 2JH2A 1AGCB 3VO8A 4E41D 3WU1A 2UWEF 4W9KC 1K72A 3ETSA 4QWWD 5JO5B 3S37H 1IM3A 4UV4H 4F92B 1M6OB 4OUUA 2BVYA 2V2WB 2Z7ZA 1MF2L 2UYKA 4CW1A 4LO9A 3BT0A 3NH7H 3OKKB 5HGAB 2WIIA 5HD8C 2BRRH 2OL3L 4FYSA 4KQ3H 2IAFA 4HSQA 2VABA 5LAPA 3FUJA 3DDNA 3QK0A 3HG1E 5HPMB 4K9EH 3WMPA 4TYUA 5IB2A 1FZMB 2V7NA 3EW3B 1X7SA 4UQDA 1NAML 1BBDL 2VDMB 2XTJE 3ILDA 1GHFL 5TK4A 5IHUH 1OTUD 4ODSL 2IFFH 3Q06A 4PI0A 1GZQB 1OALA 3CFDA 4LCYB 4ORZC 3P3YA 4MNHA 4LBAA 2X9XA 4NC2B 3GRWL 2HX8A 4QCIA 3NCBB 4TZZA 3HLAB 4MA7L 3SGEH 1NC4B 4Z8FH 3DHJA 2JQZA 4EKXA 4EKJA 3K46A 2B9BA 4F8QA 3HKBA 4XP1L 2GBVA 1WAPA 5DCCA 1Y1UA 3P40A 3V0AC 4NWUL 2OJZH 1RJYA 3C60D 1UHVA 1UQSA 3ZT7A 3SPVA 1CXIA 1W3EX 3P2BA 1QSFD 1ANUA 5SWSD 2JJVA 3OAUH 1MCOH 3DTUB 1KDIA 1Q9OB 3T2NL 4PJGE 4BZ1H 5ALCL 1BAFH 2W8CA 3VFSB 1A7NH 3ARGD 5AKRA 2V5TA 3FD6A 1ILUA 2EO7A 5H37A 1DVFC 4X8JB 3OGCB 5F7FA 3SO5A 2WXPA 3KPNB 3QFJA 5T1DL 1L0QA 1MFEL 3ETTA 4TQEH 2OSLB 4H2AA 2G3ZA 2G9HB 2IIJA 4WFHD 4D8PA 1Q0YH 3LDTA 5L8LB 2NY4B 3VRLF 2AEPH 5LNDA 1PZUB 3ARSA 4P3CH 5D70H 3MX0B 5EUOF 1CDHA 5DMIH 4NJ9L 2PTTB 3BAIA 4AYFA 4S1SL 4PAZA 3QJHB 1WK0A 3TS8A 4PJHF 3RWJB 1HILA 2DYYA 1IKNA 2YPLD 4AGLA 4FXLA 2XHNA 2F68X 4L3EE 4ZD3H 5T5FL 4LLUA 3ZBMA 1THCA 1SLWA 4QHMA 1JDCA 2JJUA 3LQAC 3H42H 2X3BA 2X1QA 2EVJA 3CC7F 4AZ8B 1G7IA 2XJLA 1YEIL 3SEPA 4HLEA 2WGNB 1YEGH 1I85A 3HZMB 3UYOD 4S2SA 2B1AL 2Z1PA 5DQDL 3Q8CA 1LO2L 1LP9E 4RFOL 4ZPVB 3KMDA 3CFKB 5JORA 4G9FD 2ENJA 5I1EH 1CGWA 5K1VA 4L8DB 2BVOB 4QYOA 2GVIA 2YN3A 3RYHB 2AJYH 1X9LA 2GCYA 1X5HA 4I0PC 5FECB 2DKSA 1N4XH 1SDDB 4PYHA 5MHSD 4Z7NF 4ZAKB 1KF9B 4WHYG 5ANMB 4HBCL 4I13B 1TETH 4D3CH 4DO6A 2V3FA 5GJTL 3BEVB 2WZ5A 4KO6A 3ZX1A 3D18B 2VDRH 4MDJA 5JA9A 1FL6B 2XWCA 4N24A 2K1SA 1SNRA 1I9RH 3QUYB 4B50A 4KKZA 3SE6A 2A9AA 3UC0L 2IWFA 3FUFA 3ARFD 2Z1FA 3X3FL 3VFUA 1I3GL 5IEKB 2VXVH 3WFHA 4ALAL 2JFCA 4I55B 1AG0A 2Q87A 5JHBA 3DARA 4U1LA 1ZLDA 5C0AE 5BRZD 4YO0A 1I1RA 3FU6A 1FIEA 4XB7A 3EGSB 4N6RA 5C09D 1GMIA 3C6LB 4ETQB 4N0FB 1LXMA 3AWFA 5IB2B 5JXEA 1ETZA 4R8WH 2PR4H 3CXDL 5ETUB 2AQ2A 4HGMA 1IGMH 4OFYD 3RA7L 2IFFL 3L3OA 4I4WA 3FTVA 1NAKL 3EGDB 1KGWA 4FFYH 3UMTA 4AITA 4M8QB 2NY0C 3IETA 4JKPH 4XCCL 1Q1JL 3HNSL 3CZNA 4PTTB 1O6SA 3VXSD 3TTSA 1E4XL 2VYRE 2EEFA 3FS9A 2QKIA 4QXWA 1XMEB 3CJJA 4BD4A 3PLAC 2BNUA 5F0PB 3ML9A 4MDJB 2YS4A 4U3JA 3GZPA 5E8DL 3NEEA 1KTRL 2O5XH 4KDVA 4TLUA 3LEVH 5FECA 3HI5L 3IRPX 5FOJA 2EO9A 1UOKA 4MDIA 1KELH 1CLOL 4M1DH 2QADB 4GW5B 1KEML 3FT2B 2JKJA 3NMEA 4IMLA 3AM8A 4XVTL 1H15B 5GGTA 3Q7JA 3LSOB 2Y7OA 5IYZB 3ESOA 2P49B 4XXWA 1XGZA 1ZEAH 3NCYS 1JE6A 2JELL 3RY6A 5DMJB 1PYWA 4Q74A 4PLKC 5EEYA 5D70L 3ZKSD 3DECA 1GA2A 4NQEA 4DKFH 4NZFA 4XP5L 1EQWA 3OQ3B 4ZQTA 2VH5L 4Q9CA 4L9DA 1E28A 5D1ZC 4YSCA 3ZP4A 3LPOA 5MENB 2VOTA 4KHTH 1XCQA 3OGOE 5SWZA 5FF6A 3HFMH 4JX0A 5EWIL 3MGTA 3AROA 2YUWA 1KULA 2FIKA 3LHPH 4M8RA 5CP7B 5F0LB 3LKRB 4NRXA 1XTMA 2NY7L 1JV2B 4U1SB 1M90H 2WINB 4GP4B 3L7EA 2FZ3A 1W40A 3S02A 4X4KA 3D25B 3R19A 5B1KA 4HCRH 5D7LD 4YFLI 4HDIA 1IM3D 4JKKA 1M9SA 1XSJA 3B2UD 5IJBC 1BZDA 3B8YA 3ARFC 2QR0B 4MJ6B 3UX9B 1I7RB 3QUMB 3OGCA 3SBWC 2DQDH 3Q1SL 4NC0B 4LHUD 4NZTL 4YHML 1LE5B 2X4TA 4EQ2A 4GKLA 3BPNB 3BPLB 3GSXB 4N0UB 3O2DH 5ALBL 1CXEA 1YY9D 1IU1A 1JGIA 1F90H 4BELD 3V4PH 1BQHG 1FUNA 2GYSA 3K8MA 5C0JA 5FUZL 3WUWB 3UBGA 3D69B 5B8CB 1S78C 1MY7A 5BJTB 1WFTA 1D7CA 5C9JB 3BVNA 3BH9A 1EHLH 4JFXB 4OLUH 1JK8A 2BZDA 3CZKA 2RH0A 5FO7A 3JV6B 3WJJC 4O4YL 3JWDH 1F2XK 3FQTA 4OCWL 5A3ID 4E68A 2RAMA 3LTVA 1MJUH 1X5ZA 2FGWL 1CURA 2MNJB 2O5YL 4N8VG 3U2SA 3JWDC 2B2XL 3MV7A 1T20B 5FXCH 1BPLB 4OIIH 2Y23A 3QHFL 1M1XB 4RSVA 3SBWA 3B9VA 4L0PB 1U2CA 3V55A 43CAB 3UO1L 2XKUA 3NG5A 3O0RH 5B3SB 3Q0HA 5F88A 5C09A 4PG9A 2UZIH 4PRPE 3VFRA 3FO2A 2COQA 2Z91B 5HXUA 2DI7A 1DO5A 2PP7A 1BIIB 3RVUD 5EFIA 4LAQL 5GISL 4WFFD 4YNYB 3S8WA 4X98A 3ARFB 2WINA 2CIIB 3I9AA 5E5MA 2Y5QA 4GBXA 4KDTA 2YPLA 3S97C 4XI5C 5GAPK 3ZDZF 4JHWL 1MCLA 1Y6KR 4M4RB 3SCMD 2C3WA 1BXUA 2XXGA 3B7UX 5CM1A 5TE4H 4JN1L 5DHVA 1WC7B 5D7IA 4K71B 1A3LL 1KNKA 4O2CA 2CUIA 2KZKA 3H7LA 2J73A 2HZHA 3JZ7A 3NCFB 4NIYE 1VEPA 3M17B 1KYOK 4NJAH 5FYLE 4YPJA 3W0WB 1BQHB 5IOPA 1NPUA 1QBBA 1V3JA 1I8KA 1ODAA 1GZPB 2GVYA 2JJSC 5DRWB 1FZJA 3VSQA 4R5XA 3W56A 1SEQH 3CVBA 3HE7B 5DYOB 4PJ5B 1FI8C 1UXSB 5BVJA 3MNVB 4K73A 1YPZA 1FRGL 2CLVB 2ED7A 1IV4A 1MOEA 2EYTA 3RIKA 3MA9L 1V7ML 3ESMA 4KRMB 2M8XA 2WZPD 4ANVA 2Y6TE 1QI4A 1DLFH 4KKPA 5KSUA 4ZO7A 5F9OL 4R4FH 4OV6F 5JIDA 4YHYB 1CO1A 2DOCA 1YC8A 4BKLA 4J3BA 4WF7A 3HFML 1E4XI 3V6OA 3SDAA 5JHLA 3K6SA 3J8F7 3QIWC 2BVQB 4F8OA 3SOBL 4EVNB 1MAML 4Z7IA 4P4KC 1KCVL 2XPYA 4Q9BA 4FLQA 4PJFF 1OD7A 3HBZA 3UAJD 4JDZB 2IGFH 4KI5F 4OM1H 2HT3D 5DMGD 5GS3A 4NNPH 3ULVD 4OV5A 3KLDA 4ZW5A 5HHOD 5E9DA 1BQLH 2R27A 2SEBB 3ISYA 2CCVA 3O11B 2WSDA 1THAA 4WO0A 1NA8A 3LN4A 4ZFZB 2F2HA 3QUKB 5JPNC 3Q8BA 4NCC2 3WFZA 3FHAA 2YUXA 2X53A 3STLB 2GFBB 3TEWA 1ADQL 2EECA 1ZGLB 5JA8B 2R2CA 4MJ2A 2CXKA 5EEXA 4HGWB 3LKQB 4BHUI 1BREA 4JCWA 4XNMB 3P02A 4G4XA 2K3TA 1A4BA 4ELME 4ZX3A 2QA4F 5CJBA 3NJHA 2EDHA 1F2QA 1ED3B 4L5FH 1FSKC 2QQLL 4NQSB 4UTCA 1LP9A 2F6AA 4PJFE 4UDTA 4AC2A 2J1YA 3OB0H 1K5NA 3L3JB 3SGDH 4G6ML 2AQ1A 5BJTA 4M8VA 1UZ8A 4NKIL 1ITCA 1KENL 4X0NA 1KJ2H 2DM4A 2KBGA 1WBXB 1GO1A 3K0YA 1OGAA 2H2SC 1XH1A 3O6LH 1A1MB 1NBYB 5B1JA 4QRQA 2Q1XA 1U21A 3D08A 3LZQA 3GSNB 2B9AA 4L37A 3QXWA 1Z66A 4N87A 1DCLA 4JM2C 5E9DE 4J3OG 4LLVA 3GS7A 2CWJA 2N1KA 5JHMA 2DTMH 2P3YA 1DE4B 2PWDA 1PAZA 4Z7NE 4JK0D 2XWTB 4XBEH 3PWPE 2FX8H 4OKVA 1T1YB 5B1BB 5EZJA 5BV7B 2GBTA 1YN7A 3S48A 1IEBA 1D6VH 2BSDA 2PKDA 2R1WB 2D3VA 4M6NH 4YDIL 1IQDA 1NUNB 2EACA 1I9JL 2EZ0D 4YEEA 1FA4A 2EXWD 4PBDA 2JK5A 1GIGL 3KPRA 5I19L 1YMMD 3QQDA 1TVHA 3CDGA 3CCLF 3ARDA 3ZYOA 2QQNH 1OB1B 4X1KB 3QQ3A 2GQHA 1E28B 3PP4L 4UBDC 1ACYH 2CRZA 1ZT1B 3RTQC 4LB8A 4ABUA 4PYGA 4PJ9A 1OPOA 4GIOA 2CHDA 4XN2A 2DQTH 2O6EA 4UI2A 1WUNT 2D3LA 1CS6A 1BVZA 1IEAA 4JFWA 2EP6A 4DCQB 2Y7SA 4XB3A 3GBEA 2MCAA 3MHZA 2AEPL 1LO3H 4I48A 2BERA 5I1DA 2YD4A 4HIXL 4WUUB 1IGIH 2BJML 5JVDA 3DXAE 1PZBA 4E36A 2AHIA 3TBYA 3H54A 3QQ4A 4OF8A 5D1ZA 4HAFA 1KLFB 1LWRA 3MGOB 4N5EC 2XNAA 2HFEB 2WZ6A 1HI6B 1PF5A 1LQSR 1J1PL 4HFUL 2K45A 2ZOKB 3Q3GB 5LN8A 2R7EB 2FHCA 4FFYL 1UCBL 5I74B 2QKIB 4GKZA 3L7FB 5T3XL 2XWXA 3QEHA 2VLJB 2V5MA 4KKLC 3E1F1 3QDAA 4QXTB 4X99A 4XT1C 4D9QE 2VKXA 3AAZA 4OZIB 4OB5L 4AYID 4XCFH 1OGAD 3MGAA 4U6XB 1JYNA 3HZ3A 1T5XA 4JO1L 4FKEA 2YARA 4KKRA 2K4WA 2UZYA 3WFEL 1PKQA 1IAIL 1MDAA 3ARVA 2GG1A 4BXSV 4JRXD 1I8LA 1F6LL 5ICXB 1QATA 1PX4A 3S35X 3AREC 5DJ6A 2D2CC 1OP5K 2ZP9A 3MZTA 1BMWA 2IH8A 4GG8B 2CHXA 4Y5YA 2KDYA 2F54B 2ZUQB 4GS7B 3BP4B 1AI1H 3UJIH 1VF5C 25C8H 1W5EA 2PO6D 1FZOA 3AC0A 1UVQB 2NY1B 4W4NA 3I9GH 4F3FB 2AJSH 1D5ZB 1NIDA 3MRFB 4UTBA 4B9KC 1NKGA 5I8KH 1U8CA 3UT5B 1UXWA 1JWUB 4ZO6A 1A1NA 4XXDA 4M61A 4HG4K 1H0DB 3HKEA 4M8IA 5IIEB 3PGCA 5J9PA 5IMLB 2YMXH 4JPKL 1A6VL 1HQRA 2DIEA 1FO0A 4N0YL 3BJLA 5ES4B 2A74C 2XWDA 5I30L 3H85A 1M3JA 2Z0UA 4N22A 1N3NA 5E5LA 4X3MA 2HFFA 5ACZB 5MI0C 1PS3A 1RK1A 4MNQE 5EPMA 1T5KA 2BHYA 4UIMB 3ZK0A 5KVDL 1NCOA 2FLBT 1NGYB 1FL5A 1A47A 3NAAH 4AQEA 2ZG1A 1MCHA 3TEYA 2XA3A 2ZXDA 4MXQC 3S06A 5F9WC 1R3LA 4WI2A 4YSTA 1CICB 1YEKH 3ASWA 1IGTA 1NMAL 4DK3A 5HYJE 3H9ZA 1MN4A 4R3SA 4B5EA 1ZLEA 2D7NA 2XV6B 1M7XA 4LMQE 2D3JA 1K6QH 5LDUA 3NFPB 3CCUF 2OL3B 2ADGA 2HLAA 3QFDA 5LGHH 4TVSa 4E9TA 5EZIL 1LM8V 4FXKA 4HWUA 3DNKA 2HP4A 1L6XA 3GXNA 3QFGA 1EHKB 3ESNA 1MRCL 4DHLA 1D2OA 4B62A 1AZNA 3FRUB 3K81A 4LLMA 2R8SL 3GB7B 1CE1L 4PJGF 1P0SE 3TF4A 3NCXA 2DYSB 4PI2A 1GGCL 4IJ3C 1R4XA 4P4RB 1QLRA 3WJLC 4D9RD 1Z9NA 3VD3A 1QW9A 5IHZB 3PNWA 3LKSB 3S35H 1XR8B 3NEOA 5I9QC 3TT1H 1VCBC 4H0HB 3P73B 3ZHFA 1Q86H 4AV0A 3EF7A 1B9KA 2BX5A 4E41A 3QCTH 1KTDB 3FQRA 1BD2E 5KVEE 3G6EF 1XVSA 1MVYA 1R3LB 1PLGL 1NMCC 1ERNA 2HJLA 2R7EA 3BW9A 2R0KH 5AW5B 4ZNEA 3EBHA 4FFYA 3IBEA 4DKEH 4A7SA 4L2LA 1ZLVH 1HJCA 3FN0H 5SWSB 2J6EL 2CDEA 2QSVA 3DETC 3LH9A 3W37A 3VFVA 4ODXB 1W2BF 4MRCA 3VGFA 2WQ8A 4QRRB 3F00A 2WBJB 2ZT9C 1UCBH 3WKMH 4C55A 5C6PB 2CALA 1HS6A 1EA9C 5LBSA 4FNTA 4JY5L 1VKXA 3FT1A 5LGYA 4HC1H 2CAKA 2AKRB 2R1XB 3RVUC 1IFHL 3JUYA 2YFOA 3ARXA 3DHPA 3V0JA 2J71A 5GHWL 3SD5A 5F1NA 2F7IA 1FAIL 3PQYE 4JVWA 4DPCX 4JDTH 3CXHK 3HI1B 2Q3ZA 4PJCA 2VMCA 2CO7B 4WTXA 2V7NB 3UERA 4ORGA 5AVQB 4XPTH 2W9EL 1TSHA 1WD9A 4FCHA 2HP0B 3LIUA 3GQFA 3OJ2C 3NTCH 3PHQB 1AZBA 4WU7A 4BY9D 4Z7QE 1CICC 1F4HA 5DJ6B 2R1YA 4ELKA 3DUHA 1R5WA 5E23A 4G11A 4X7SL 1T1ZA 5C0DA 4S1SH 4R3SB 3VCLB 1S8DA 5CBEB 5FKAA 3N04A 3NP4A 4WY7L 3ZL4L 1XV8A 1S9VB 3CHXA 3V6FA 4FQHA 4ZMNA 4K55A 3GBNH 1OAPA 3QULA 5A2CA 1N5AA 2H0JA 4ZD3L 5ILTH 1KFAH 3UPRA 4JRYD 1QHPA 4HP5A 3HNVH 5HI4D 3FMGL 3GUTA 4PRIB 1T0PB 1FL5B 4MS8D 3FPXA 4ZS6C 3AGVA 1N8ZB 1W0VB 2XTLA 3O0RL 1VK3A 2GJRA 3II1A 2BNQA 1JPTH 1VERA 2IALA 2AABL 5IT2L 4ZAKD 4HXBH 4LNUA 4G6JL 1INDL 4G8GA 4QXGL 1JZ4A 2Z1KA 3T1WA 1NLDL 1JNLL 2HVKB 2WNGA 2X10A 3S0PA 1CFTA 4LU5H 4NRZB 2W0LA 2FHBA 4FZ8H 2OTPA 1LP9B 4BBWA 5IB1B 3QJXA 4E2OA 3K1KC 1V8HA 3V7QA 2OMWB 2ZUQC 3EYFA 4GS7C 3VXRA 3UT5A 3UJJH 4PP2B 4WUUE 5BCAA 4P5TA 1IARB 4HGKC 6CGTA 3WKYA 5A6MA 3DMMD 1SXZA 1CLZH 5B7MA 1FN4B 1ZPLA 1RUPL 2DT4A 1JGDB 4PRDA 5AALA 2QQLH 2C9UA 4NUMA 2EXSA 2X6CA 5FEBA 4JG0L 4YC2B 1MCPL 4LL4A 5C3LD 4OV5B 2CBPA 1NDTA 3HFFA 1LP9F 4FL4C 3DOIA 1C12B 4BFEA 4OI9A 4OQTA 3MNZA 2NTFB 4PS4H 4P06A 1Q0EA 1YJWF 2V9TA 4L8SC 2E7LC 4AENA 3FUEA 5EZYB 2WTOA 3O4OC 5KBKA 1DQQA 1Z9MA 4ZOEA 5HVGB 4JM4L 3V9CA 4NRYB 1MCDA 5TFSH 3C5SA 4PJGA 4MXVE 1V05A 2ZXBA 1KCSH 1S7XB 2O5ZL 3HBQA 2AMUA 3O3EA 1ACZA 4OLXL 1RPKA 2CJTA 3RRQA 3CFMA 4NN5C 2P80D 3K4DA 1X7PA 4M7LL 4JPVL 1H6FA 3DC0A 3EJCA 1KTJA 4HWZA 5FHBL 4CDGC 3E22A 3SQBB 3D50A 2K1MA 2Q5BA 1QUPA 1J48A 4JREB 3I3EA 4ODBD 5FO9A 3U7WH 1QEWB 3QZLA 4F7MA 1B0IA 3Q2NA 4E9RA 5E99H 4M9PA 5GRWA 1XF5B 2NZ1A 4YBLC 1QA9B 3APNA 2EVHA 3SE9L 3INUH 1UZ8B 3UBHA 2QELA 4F91B 4TV9A 1ZMYA 3IDGB 4KAQH 4NWTH 3DYOA 1OPGL 3WO4C 1KXTA 5IROA 2BWQA 1WAAF 1P7KB 4LNRB 2E9BA 4QJ5B 3ARED 2XV0A 1DQLH 2IQAB 3OJDB 4F9PC 4JLRA 3HAEA 4JFEA 4YDJB 2YPKB 3IDMA 3CCSF 1MXGA 2BSBA 3FQXB 1N0LB 1MW2A 2UZXB 1RFDL 2O26U 5KUMA 2Y07H 4BGLA 3OF6D 5HI3D 1TT6A 1HSAB 3QZNA 1CGSH 3O2VL 3UJTL 4QPEA 1M57B 4EDXB 4F27A 2BOLA 2YKLL 4P2AA 1BSIA 3GBDA 3QCVH 4UQIM 5EU6D 3QYCA 3P54A 2WKLA 1Z2KA 5I66B 1BEYH 4A2FA 2F1EA 1W0WA 4HKXA 3LRLA 4MAUL 1AO7A 5EC1A 3TZVA 4C54A 2VQ1B 3OAZH 1OCWL 4FQ2L 1KCUH 5FUCE 4UINH 3DPBB 3F7PC 3LQZA 2X2YA 3CC5B 3GSNA 2R9HD 3KYOA 3I6GA 4KJPD 5C0EA 2FATH 1S7UB 4BKLB 5AOLA 1H3XA 3QI9B 4KZEL 2FQEA 3LNEA 2XQ0A 3BMWA 4M6ML 2Z0BA 3P77A 5E08H 3UDWC 3BWUF 2JKRM 4HS8H 1NPNA 5EO1B 1F3DJ 1SXSA 5DD6B 3SKNA 5IW3A 3A23A 5SWZE 5DUPL 1T03L 3BN9C 3ZTNH 1CTOA 1DCEA 5HGBB 3BZDA 3UIYA 1VHPA 4WK2B 3E8VA 3H4HA 5I8KL 3TEUA 2EZ0C 2WXJA 3O4LD 4M7ZB 4R5VA 2EXWC 3PY9A 1FNFA 1IBFA 5FA3B 2VDNH 5I6LA 1QOKA 4X6EA 1MWAL 4HK0A 1RLWA 5DUBB 1NFDB 4O2FA 1JDAA 3H53A 3B37A 1RAMA 4AE1A 1EZVX 5I2IA 3QHDA 2IDFA 4Y89A 4G6KL 2E5EA 2ZAHA 1PMYA 4FMKA 1LD9A 3QNZA 1J86A 2AANA 1U91A 1LVEA 1SY6L 3FK3A 4G59C 2D7MA 2GSGB 3P0GB 4ZUWB 5TE4L 1OTSD 2OYPA 3U0PB 5DD5H 4AEHH 2QGCA 3T0AA 3APDA 4L4JA 2APSA 3LZNA 1UOVA 4ODSH 1KGCD 4NAMA 1NICA 3HB3B 4W9DC 4X5RA 2QI2A 4NGHH 3PQYB 3QQNA 5F88B 1TQCC 5T3XH 5I2IB 5IV2B 3I2CL 4HPOL 4RQQA 4TV3A 3TVMD 4N2DA 2QLYA 3DETD 1YNTF 2CPCA 4X4XB 5L88L 3QXDB 3ZDZB 3EXLA 1FL3A 4B9YA 4BQ8A 4JHAL 3X13B 5FHBH 1A2YA 1HL8A 3IU3A 4K7PX 4RRPG 3V0HA 3V5DA 3U6XA 5ELIA 4KRNA 4LP8A 2RR3A 3EO9H 1D5IL 1F56A 5BW7C 2VZOA 5CJ8A 4F5CE 2QADD 1DLHA 3PU7A 5CCKH 3C5JB 3MRQA 1P84J 1ZLUK 4IEFB 3L9BA 4U4IA 4U3JB 1E27A 3O3DA 2UWEB 1FWXA 4YHYC 1RURH 4JB9L 5E1GA 1JDDA 2BTUA 3N9GL 9CGTA 1LK2B 3BGFC 4WW2A 4O4JB 4O2EA 3IXTA 3C8KB 4GMTH 4GRWE 4EN3B 2YPLB 2DV6A 4Q4IA 4MVBD 3RDTD 4PBWD 2VERA 2B7DT 1L7TL 3SKOA 3C9RA 4NPJA 1NDMA 3QAQA 4FJZA 2NNXA 4HT1H 3TO4B 4F7EB 3U30C 1BIIA 2I6DA 3GMOA 4HLZG 4PJ8C 5D8JL 2WQXA 3L9EA 4CMMB 4IBZA 1JYWA 4U1SA 2AS5M 2FNWA 1BQSA 1E6OH 2CUAA 4K3HA 3NMUC 1QU9A 4LEOB 3NJJA 4YHOH 4O02B 4YX2H 4LASL 3ARYA 2LQRA 4F93B 1XQ4A 2UZXA 2CJUH 3ARGB 2LAGB 3CNKA 3V0EA 4YFDB 3TESA 3EJJX 1ZHLA 4BT6A 2FJFB 1OP9A 5DJ2B 3E3QE 5MENE 2VXSH 4PWJA 3UBFA 4NI3A 4OGYH 2BRQA 1RL1A 3MOBL 3LZFL 3MRQB 4JFXA 2A9MH 4KKQA 3VG9B 4MJ4A 3UTQA 3T6VA 2RB9A 1TZIB 3BHBB 4YXKL 3VQ2C 1IAMA 2Q7YB 2IEPA 3WFBH 5KYYB 3MCKB 3GSXA 2O72A 4TNGA 2ZXCA 4JN2A 4ANKA 2F8OA 2VDLB 4H1LA 4JPWH 1F41A 4Z3FA 4O4HB 5GIPC 1W72H 1R3HA 1U3HB 3PHOA 1KEGL 2DDQL 3NPSB 2NZ9C 4WEUD 1T1WA 2ISDA 1ZVHA 2GKIA 4XO3A 1KYAA 5JORB 4XHJC 2LHAA 1KPUB 4LSPH 5TPWH 5K39B 5A2JH 3F7YB 5C0CE 1LK3L 3RHWK 4PR5A 3O8XA 4MA8L 4RDQG 2V17L 1I9EA 3GBLA 5IEHB 1VQKF 3GPEA 3IETB 1N67A 2R69L 4NT6B 4M8QA 2F53B 3LN9A 2IPUG 2ZKXA 4IIJA 4OW6A 3D09A 4U3CA 2GSGA 1OGSA 1CD9B 1UD3A 3VMNA 4MCZB 3RTLA 1NCBH 5HGHB 4YSAA 5HI4C 4N2AA 1UYWL 4PGEA 3PE9A 4XAWH 4YHIB 5KTEL 4HU8A 3ZL2A 1KXVA 4X6DE 3RKDC 2NNFA 5DFVD 3HZKA 4U05A 3SKJL 1LEGB 1RJCA 3FBKA 2PYFB 1UWXH 2QV4A 2P5PA 5DD0H 5DFWH 2GSIB 4EXPX 5C8YB 3PYCA 4X5PA 4JZOA 2WBKA 4IOFD 1LILA 3HKFA 2WOYA 1J0YA 1KT2B 1D6EB 2ZONA 4RMSA 2HSIA 2GI0A 4EB6B 3D01A 5AVVB 1F97A 3MCAB 3A6CH 3TBSA 4X80L 1PY4A 2IPKA 4N4YB 2NSQA 4N3TA 3V4VH 5IJKA 4JUSA 1OVZA 5F0JB 4DP5X 5D72H 3C75A 3LN5B 4QHNA 1X5JA 1MG2C 4FFTA 2J44A 4I18A 5CA0A 1JHKH 3I6KB 2VDPB 3S37L 1C08B 1J8HE 4PFEA 3P77B 1MCBA 3A67H 3UTSA 1MNUH 4PS4L 1MVFA 4ZG1A 4XMLH 3DROA 1GYCA 4K94H 4ZBJA 3HC3H 2IPKB 5ESVA 3V4LA 3TBTB 5KBDA 4FYQA 4LL1A 1E4KC 4Q6IA 3V6FB 4NENA 4PHXA 5ECJE 1X3DA 3RP1A 4LHQB 1WHPA 1W72A 4HEMA 3ETBF 5D5MA 1VGEL 3X3GH 1TDQA 1GGIH 3SGDI 3ELCA 3QORB 3FCTA 4OJFH 4OTXH 3ABLB 5MERA 5AB9A 2IH3A 4GO9A 1YITF 3LPGA 3OZ9L 3VFMB 4Q2ZB 3K80A 1XBRA 2V37A 3SDCB 1CWVA 1I9IH 1VCAA 5JXED 1UXLA 2WIIB 2H1XA 3LB6C 3FQXA 4N2OA 1PX3A 4NBYB 1UZ6E 2MH4A 4HIEA 4WJKB 3S96A 2ZCHL 2NCEA 4P4KD 2RD0A 5I24A 1KJVA 2BP8B 1RIUH 1EERB 1RLGA 1LWHA 2A74B 3WLBA 1PEZA 2G9HA 3UJIL 2XRAH 1BIHA 3W11D 5ID0B 2VQ4A 1F90L 4MJ5A 5TGBA 4L4VE 4HJUA 3O81A 5G55A 5T1LA 3GJEB 5FUZH 3ZRFC 4HG4J 1VKXB 4HHAB 1RK0A 4ICWA 3T5WA 3PHOB 5GJSL 1TYJA 1AACA 3VFSA 1IC7L 2B1OA 3QRLA 4HIIA 5IJVB 3UCQA 2DWSA 2X2IA 3MUZ1 5C97A 1OT1A 1KD1H 1BFSA 1TZIA 3BHBA 4JFOB 3BAJA 4Z7WE 1J5OH 3MR9A 4KRLB 1G6RL 4H8WH 3TPKA 3V8OA 1UZ6F 1W0YT 3ZGIA 3P0YH 1LJMA 4LHJB 2DWXA 4F7PA 1J7HA 2ZKHH 4XCNB 4HBCH 3CDFA 5EU4B 4G71B 1TVDA 4XNXH 1ONQB 4AJWA 1TNNA 3GSRB 4N1EA 4NQCE 5IHZA 3FYIB 2NQDA 2I9TB 1CBJA 3S5ZA 3PCYA 1R3KB 1HL4A 3KD4A 1WA0X 3BQUD 3BFOA 3Q43A 3QO1B 2ZQKA 4OCXH 4QI3A 2WXNA 5GSRA 3GNML 1N8RH 3BSGA 4D7PA 1QO3A 1Q0YL 5ESQB 3IAPA 2ZPKL 5AB1A 4XH2A 3UC2A 4KTEH 2ZUXA 3IAQA 2FWLB 3JALB 2VDRB 2HLAB 5E2UH 5GRVL 3ZQXA 4CKVX 4X6DA 2X5PA 1XZWA 5HHVL 4L1SA 4DW2H 4IJTA 3NRQA 2W1NA 3SJVE 4HJ1A 1VRSA 4YN3A 5IB1A 1MI5E 1YYLL 1L9PA 2FYYA 3F5WA 4XP6H 1YECH 3RBSA 3W0WD 3P30L 5D93B 1XH3A 4GT7A 3EDKA 4GO6B 1JI2A 3NABL 3DV6A 4Y4FC 3STBA 4ISVB 2IPTH 3HE6B 3MRMB 3JWOH 4PJ7B 1IV2A 2Y36H 2YAHA 4G4WA 1O0VA 4JRXA 4M43H 4H8WC 4EI6A 2VMEA 4UB0L 2DYPA 2DYPD 3ZP7A 1H5BB 3UMNA 1DBAL 4PRIA 1BZEA 2Y1AA 1OZUA 4GKNA 2YSSA 1D5RA 3L4UA 1VQVA 4IOFC 3GPSA 4OT1L 3O9WD 1SA0A 1UFGA 4P07A 2D7TL 1OV8A 4QCIB 5IIEA 3UZEC 1I1CA 3LQAL 4KJYA 1P4UA 3QAZC 4QO1B 3RL2B 2CJ3A 3PL6A 5G4OA 4JDEB 3GZQA 3ATFA 4GAYB 4CL7A 1BEXA 4BGDA 2CQVA 3UO8B 4FHKA 5K1JA 2R1YB 4ELKB 5K9QI 4GKSB 5BV7L 3AABA 5K59F 3FOLA 3L5WB 5HPMA 3LEXA 3QW9A 4Z7UE 3MCG1 1YHPA 4LVHB 3ULUC 2DM2A 2CCLA 1MCQA 4NB7A 1H6EA 1OW0C 2ZAIA 3CYPB 1DVFD 1PAMA 1R34A 3TURA 1YHQF 1INQB 3UAEA 3BAKA 3LDBB 3LH2H 3H9YA 4U1MA 1RPQA 15C8L 5IY5B 4GAYA 3SY6A 1KY7A 3S2AA 3IRZA 2ZP0T 2NSXA 3LHPL 3TPUB 3T0EB 3V4VA 2BSSB 2EIZA 4M56A 4WV1C 2VLME 2V6HA 2ZAGA 1KELL 3B9DA 5HJDA 5IB5A 1PEWA 5ID1A 1MEXH 2YYEA 4D3CL 1NQBA 2RB8A 2BSCA 1MCIA 2WYZA 4G1EA 5L2KD 2GT9A 3MDJA 4MBRA 5IMKB 4QRRE 4FABH 3ES6A 2YLKA 1BZ9B 4ZMTA 3AY2A 2ZE0A 4TSAH 5KUKA 4ODXA 4DT2A 2CR6A 3THMH 3X1FA 3REWA 3SDXF 3ZMRA 4HWEH 1BWWA 5DQ9A 1P5UC 4FP8H 1WUZA 4EIZC 2Y5EA 4AX3A 4JFQA 1YMMB 1ZVSA 4X6CA 3BT2L 4G3YL 3NZHH 3WHXA 1X9QA 2RGSA 3DOSA 2HS0A 1AR1C 2WN3A 3FFCD 5GS2D 4RRPM 5F7NC 1T2JA 5D6DA 3FPYA 1UURA 2OMTA 1VFOA 4X7FC 1AY1H 5J8OA 4Z7OB 5LBSL 4DGUA 5EIBD 2C9AA 1R0AH 1SHSA 3PRZA 1DVXA 1CLOH 4JS7A 3NIFE 3BSZL 3SSGA 5FFOA 3VOAA 3PGDB 4HS3A 3TH4T 3VI4E 4Y9CA 5HPOA 2XT1B 4ZX4A 3BSHA 5IB4A 4CNIA 4KNQA 5IMOB 2FHFA 2QEJA 2VC2L 2D0GA 4PY8J 4N86A 2J4WH 3DSNB 3Q2VA 4TUJB 3S37X 1OARH 2FB4L 3W9DB 5DR5L 4KI1A 4F37K 4Y88A 3VMFB 4NHCH 4KVCH 1TF4A 1XF1A 5F97E 4EDXA 5K9JL 1AYRA 1MI5B 2DJSA 4GAJH 1W5FA 3DKHA 1YEJL 4FFZL 1K5WA 5E2VH 3HCVA 1IJ9A 3QDMD 4P59L 4GPVA 1UACL 3ZHDA 1TTRA 1S7QA 1VA9A 3CHRA 4ZRGA 1N59B 1MJJB 4C59B 2ADJB 3L48A 5ICYB 3WKQA 1FVEB 1HHIA 3OR6A 4ELMB 1DBBL 1M2VB 3ZOAA 1J9QA 3OHXA 4ALAC 5L8JB 4S1RL 3I7TA 4BWTA 3RUGE 2KZBA 2OJZL 3D3VB 5HJ3A 4H88L 5IFJA 5AVYB 5L0QB 3V7AE 1ETJA 1DUYB 2APVA 1VGKA 4IMKA 1XV2A 4LOEA 5DC9B 2Z31D 3EBAA 1TTAA 3LY6A 5AENA 1OK8A 5I76B 3AGKA 5JIHA 3N2KA 3TO4C 1AFVH 2WIMA 3UEQA 5LXTB 1H3PL 2YD0A 2WXMA 4GB9A 3KNBA 2BNRB 3PGFH 4G4VA 3RYIA 1P84K 4L8SA 1K3IA 5MN4A 1MW1A 1J87A 2F1BA 5ESAB 1U8PA 1MAKA 2DICA 2BY3A 5I28A 5L4JA 1FRGH 3LXCA 5KEZA 4NO3A 1BEYL 1FZOB 1RZIA 1S5IH 3NCJL 4K3GA 3DVNB 4G6FB 3U25A 3LS4H 5KSAD 2QSCL 4XOAA 4OZGA 3BP4A 3UL4A 5DMIL 1Q72L 5E8EB 3CSYB 3R4DA 1OPGH 2FECI 2I32A 4NC1E 1HK6A 4X0KB 4OM0L 3FHQA 3HC2A 4TQIA 1RP8A 2VKWA 1UB6A 3V2AR 3WJRA 2B2XH 2GC7C 3I02A 1URIA 3NSXA 2EDRA 3W5MA 3UG3A 1WSST 3RGVA 5HVFB 1OE1A 3I9GL 4NOFA 5AW4B 1H7MA 1FCGA 1WDAA 1T2QL 5DEGB 5C8JB 4H26A 5FYKD 2LLGA 4B6ZA 4QHKJ 3RWCA 1JGDA 1AO7E 3UGXA 2J2ZB 1QMUA 4OLYH 4IHJA 3JZYA 1D5MA 1XH0A 4OCRH 4AXWA 4UTBH 5AVXB 4AY0A 4H0IA 2XIBA 2B15A 2BFVH 4ZOAA 4WI8A 1QFWH 3MRKB 4WENB 1HZHH 3DBXB 3FW6A 1LQBC 2Z7UA 3DUUA 2WLYA 4BK5A 1XB6A 2EUWA 4A2GA 1E5YA 1WS7A 4L1TA 3U48A 4PJIE 3T8VA 4JBSA 2UWEE 1NIAA 2ADIA 2VDRL 4YHNA 4YJ3B 3REWB 3TZVC 3ZOPA 1BM7A 5E1AB 4OLZH 1W41A 5DHMC 3DRTB 1BJMA 4NQDD 4R4BB 1J9SA 1IVTA 1AXTH 1IEAB 3MN8A 4FQQA 4X6DF 5AOZA 1CIUA 1SJVA 1W2KT 3IU4L 2I27N 3HMWL 1N9PA 5HHNA 5C07D 3O9WA 3FUMA 1K3ZA 3QUMH 4QF1A 3HA0A 4U1JA 3G5VA 3Q2WA 3GTVA 4YGAB 1GRWA 4PW4A 1P7BA 3SDDB 1Q0XH 3MJ6A 3MLTA 4QRTB 5EN3A 2VAPA 2NY2C 3JAKA 3KW7A 5F9JA 3R06A 5E6UB 2OZ4A 5GS0D 2NOYA 1UM5L 3MYJA 4I8DA 1BECA 3GRBA 4EI5B 2XKNB 4LKXA 4BH8A 1E40A 2CKNA 2ZKWA 2QDWA 3SKMA 3TCTA 5IW1A 1MIEL 4Y1AA 5CJXA 3VI6A 1JTTA 4LCWE 2X38A 3PL6C 5KVFE 1TNMA 3O2DA 4D0BB 3OKDA 5C0FA 2ALWA 2Z7WA 5EZJB 3X11A 4DEPC 4LSDA 4NAQA 4MMYA 2VXQH 4FTVB 2HVJA 3F65A 3RLSA 2W81C 1QBMH 1E4WL 5E9AA 1G7MB 4R0LB 3FB6B 4ZMWA 4MB3A 1EIBA 5EU5A 2DB8A 1GIGH 2EIKB 2WBJD 1YVLA 3Q6GH 3ZZ1A 4JANB 1U3HA 5LWYH 1YY8B 2ZF9A 3ARUA 4YHLH 1LEKA 1CFQA 2DMGA 3AWEA 5LXTA 1BLNB 4A1RA 4TV8B 4UQEA 1NC4D 1A9VA 4UQCA 1AOHA 1RURL 1VGKB 2FEEI 2H6PA 5HGDB 2EVGA 5D7LB 4HPYH 4RGND 1JK8B 3TD3A 2A6KB 1I1AD 5CEZH 2FO8A 3HS0C 3BWZA 5EEWA 4GMTL 3AT0A 1XB3A 3KWVA 2RCSL 3HE6A 3RTQD 3S3SA 2C3XA 4NQ3A 1R5IA 3BGFB 3C60A 1T6VN 3AJ7A 6FABH 3EADA 4MD5A 2Y22A 1QVOA 2X4TB 1QTSA 3HCVB 4QRPE 3QEUB 3IJSB 4UMGA 4WWKA 1CI5A 2V2XB 3KCPB 1BLIA 3NCJH 2PCPB 4PLJC 4RH4A 3JT0A 5CINH 3QZWA 4EI0A 5JCOA 2IF7A 4JAMB 4PWFA 4RWYL 2AJ3A 3VGAC 1X44A 4JUTA 1QLRB 2NQCA 5DJ0B 1T6BX 2YAEA 2E7CA 1SQ2N 3LRHA 4YIQB 4WO4B 3VD4A 1E90A 4G43A 5C08E 1XGQB 3VFWB 4B45A 3BPLC 3STZA 4JDVA 1IKFH 1TG8A 4KKCC 4ZOLB 4AOFA 2MCPH 2NMUA 3SDAB 3MBWB 2IADA 2X4PA 1FC1A 3EJTA 4F2MA 1S9KC 5I16A 2NY5L 3QPXL 4HCGA 4LSQL 4IYKA 2PETA 1DL7H 1CZ8H 4YDMA 1QRKA 5I1KH 5KANG 1CT8A 4IHOA 2E6PA 4Z7WA 4RA3A 2OMYB 5T1KB 4NQEB 2NXZB 2YGVA 1RH8A 3OKOA 4IEFA 4NZTH 4YHMH 3UADA 1AHWC 3J7HA 4QKTA 4KROB 5D7KD 5HYSA 1H15A 3ASOB 1LMKA 2WTRB 2DQHL 3O4LA 3TTYA 1CFNA 5DQJB 2XBDA 3QQ9D 4JFHD 1FH2A 3WSQH 3LZLA 2XQBH 1HHKA 1I8UA 2C1OA 1JG9A 4LRNL 4AI7A 4JPKH 4Z7OE 2ED8A 4X6BA 1DQML 5GGRB 1GVIA 1YPZF 4ACTA 2WJ7A 3TCXA 5FGBC 5I75C 4AGMA 2L3BA 2OTUB 3AXIA 2BWDA 2Z93A 4OCWH 5D2NC 3VXUE 2BIMA 3VU2A 2BNUB 4U1NB 3DWTA 1TVKA 3OD3A 1BMGA 4PGZA 3VI3B 5CR1A 5ISZD 1OCCB 5BQ7A 2P6YA 1Y6NR 4FI6A 3CQPA 4JKNA 3VXPB 4M61B 3WMSA 3D33A 1V3KA 3D30A 4IOSA 1NH6A 2B1HH 3O2DL 1PDKA 3FUHA 2PF6A 4JFEE 3NJKA 4Y16D 3UTTB 3U0PA 1S3RA 2HG5A 3V4PL 3MLRH 4KNTA 3BDBA 5E8PA 3VX1A 2HKFL 3OPZL 4MBOA 1IUZA 4S1QL 4Y8DC 1KLGA 4LKCB 2UXGA 4R7NA 2QPEB 5EU7C 1SF3A 1ZCRA 3DSFH 1MSPA 1I4FB 1OFUA 4W9EC 2ARWA 3H3KA 3OHMB 2J8UA 3C2SA 3OMNB 4GYBA 2GAZB 4Q97A 1FDLL 2R2HB 3JT2A 1P69B 2VLJD 1URZA 2Q8BH 2PCFB 2NDGA 2XVGA 4L0YA 4KK8C 1UM4L 2VC2B 5L9DL 2VIRA 1BBDH 5CWSA 3PPEA 3BUDA 3FU5A 3TH3T 5HY9B 2KYIA 3HZYA 3N50A 2Y2YA 2QHRH 3L4VA 4FXGC 1RK7A 5HGBA 1P7HL 5AB2A 3MV9A 3V5HA 5F6HJ 4Z7VB 4U6VL 5BV7H 2W65B 5E2TH 2ETWA 2F0CA 3JBG7 1DTUA 2KPNA 4MA7H 4L29B 5FFGA 1QWNA 4BFKA 2VN6A 2BHUA 2APTA 3AS1A 3IMUA 2MKWA 4H44C 2RCSH 5DK2A 3MCQA 1ZAGA 4NERA 3AWGA 3KR3H 3GZKA 1RLBA 4R97B 1DFBH 3MA9H 4WDIA 4MB1A 4G8EB 1IAIH 3GXDA 2YQGA 3KLAB 5H2BA 1R5VA 3HPJA 4EMZA 2PPFA 4A6YH 3RFZC 1SN0A 5JQGB 5FA4B 3OAWA 5LXGH 1KSRA 5F9AC 4Y2OA 1TZHA 4H5SB 2EUVA 2BP0B 2F7OA 3GINA 5GGQH 2KKQA 1N6QL 2GSIA 3AS0A 2OXGA 3NFSH 4TMPA 3WEXA 5IHBA 1GPOH 1JV2A 3F12A 2G60L 5EOTA 4HK3N 3ZTCC 1P1ZA 3ZMNA 4IOSD 3QQDB 1DDHA 1E9OB 4MXQD 3S0HA 4UT6A 4KK5C 2BC4B 1MJ8H 2ATPA 2D9CA 2NY5H 3VYPA 3P3UA 1UEYA 1FHNA 2OTWA 3LRKA 1YMHB 4E42B 1M1SA 2F18A 2ILLA 1V5JA 3L54A 3D52A 3H55A 3HVNA 3N2GB 4OZGE 4RESB 2JXMB 2VITB 5DRZB 1F1GA 2PPEA 3RAJL 4PG2C 3HG1B 4UNUA 1O6VA 1PY0A 3RX7A 3IBOA 4MMZA 2ED6A 2VDQB 4JFOA 1F18A 1H3WM 2OYKA 3U4EB 5C0GA 2B1AH 1F4WL 5DHYA 5EIBC 3JCMM 3LHAA 2DWTA 4XP9L 5DWPA 3H9SE 3BXNB 3GBNL 3EFFB 4PJDE 1MHHB 4OIBA 2V9YA 2ICEB 1K9TA 1U40A 5F7EL 4AEIL 1J05A 1TO5A 1P6WA 3A4FA 3EYUH 5LBGA 2PNDA 5HDQH 3KPQB 4P2OC 3EYSL 3TWCH 2JXMA 1NLBL 2VITA 2V5YA 3QDMA 1JGLL 4PGJA 2ATAA 2XZQH 1A6AB 3L6FB 5GZOA 4EZLA 4FE9A 3Q5TA 3ECQA 4XBPB 2E7HA 2YQ3A 3MFFA 4BH7A 2OMXB 3RKPA 5CLZA 2FO4A 1CLYL 3G6JA 1DBBH 1YJDC 2R0WL 3IJEB 3GI8L 3HI6L 4OIFA 2BSTA 4QOKE 4WY7H 1N70A 1DANU 2FSEB 2HCZX 3AG1B 2OMVB 1WO2A 5FDWB 1M7DB 1KENH 2DLTA 3LYBA 1OLZA 3MXVH 4C57C 4PRDB 2FO4B 1HXMB 5TE7L 2DWDB 4FTVD 4JG0H 1ZV2A 2X4QB 3NRFA 4ZSOA 5AW6B 1TOXA 1FFOB 4Z6AT 5IEKA 3HHRB 2BCKA 3DJZA 2D03H 4OUOA 3ZSTA 4HQQH 3RGBA 2WWKO 1VH8A 1BGXL 3MQWA 3K12A 2LFEA 3BKML 4HEPA 4U6VH 3T8MA 5BO0D 4BIKA 3FAWA 1QWHA 4KWUA 4XO8A 5ABZA 4AK1A 2YUZA 5C71A 2Q1YA 5TFSL 2HFGH 5C0CB 4RAVA 5CEZE 1DQDL 3ERNA 1MFCL 1JYVA 2EICA 2Y7NA 4G8GD 3RDTB 3KZ8A 1FAIH 4JZJA 3KBHE 4H8PA 4PGCA 4QYOB 4RCAA 5CU5A 5IHUL 3KH4A 3UACA 2K8QA 1I3UA 3OMZA 1BQHA 3FQ1A 3BLBA 5IOPB 4L8BB 5D93C 5FW8A 4I4TB 3X12B 3T0EE 1VQ9F 1CC3A 4WFGE 3OAYH 4GG6B 1G6RA 2J8UB 3QPQC 3TBCA 4ZXBB 3VI3F 3QS3A 4MA1C 5FUOL 1YIJF 3VW3H 3WFEH 1JCVA 1OAKH 4X7SH 3FQWB 1M3IA 4NZRL 1VAHA 3U4AA 5EOTB 4ZTOL 3CHPA 5I1HL 2ESVD 2QMKA 1C9SA 3WEXB 2C7UB 1CU4L 1F45A 5B1AB 4CSTA 5CILL 1WFOA 2XN1A 4XZUA 4Z7UA 1XF2B 1QI5A 1YNTB 4N2LA 5JQIB 4P5TC 2HN7B 2Y72A 4D8PB 2E27H 4JAMA 5JW5B 5HYIA 3S36L 5K33A 3UYPB 2AABH 1ZA3A 2JCWA 4OLVH 4X8JA 5D2NA 1NBVL 5JOFA 3S6CA 3DI2B 4O4YH 4PJEB 4HALA 1T20A 2VZTA 5HI3C 4O4HA 3B6SB 2XSKA 5SX5K 2JMRA 5EO9A 1HFUA 5E6IB 3MCKA 3H4FA 4N0YH 3F7VB 3WTVA 2UZHA 1C5CL 4N6QA 1TMCB 2H3NA 4JJ5B 1U3PA 4F9LA 2HJLB 4RISH 4GP5B 5I0XA 1S9XB 1KGXA 5A1AA 2P5WE 1TLKA 5HGDA 3NAAL 2XFXB 3D69A 5B8CA 2W38A 3PAVA 3DTXB 3P73A 1NC4A 4P8QA 1YEKL 1XAKA 3PNWB 3HC0B 5E7BA 4AL8H 1RY7B 3UZVB 4LCYA 5F9WB 3BP5A 4JANA 4JO5A 3WJMA 3IXAB 3FTXA 5JHDA 3FCBA 2D3NA 4N90E 3LQZB 4X5WA 5FYJU 1NJ9A 4XN1A 1R3JB 5DTFA 2VQTA 3VD0A 5GRZA 4O2BB 3ARPA 2V3EA 4HDIB 1W6LA 2BNRE 3CFUA 3O6MH 5FM8A 2ORBL 4IKIA 2ODHA 5HYQA 2WYIA 5HGAA 5C70A 4LVNC 3U36B 3ALPA 4BCYA 2AI0H 3ABMB 3T8XA 2Q86B 1WS8A 2B20A 1I1FB 3B7YA 1AHMA 3EHBB 5CD5D 4U6HA 1HSAA 5EOCL 3GI9L 4FFWD 1YQVL 4NP4H 2BVPA 1QVOB 4NQUA 3WN5A 4DGYH 3A6CL 4LF3A 4ZS7L 4ZT1A 1ULVA 1FNJA 3ECUA 5HHQB 1XGPA 1BVNP 2A4EA 5B4MD 5GGRA 3FRPA 3EJUA 5EUOE 2W0PA 3HRPA 3IDGA 2EE0A 5DJAB 4N26A 4UUJB 3WDIA 3VRLE 1HNGA 1IIIA 2WB7A 5J89A 1J1OH 1CQYA 5F6HI 1AS8A 3RTQB 3WO4B 2PW1A 1ZANL 1AKJD 4W9CC 1O7DE 3RWGA 3QUZC 2P5WA 5JYMA 1I1AB 3D39A 5AYTA 1Q8MA 2X6MA 2R51A 2DLHA 4P5TD 4TNWK 1XAUA 2OX5B 4FRWA 1J0ZA 1EX0A 3FB6A 1DQKA 1HYRC 1JTOA 2C5DC 3AM8C 2PP8A 2WXLA 1RVFH 3QDJD 1JXGA 4P05A 3TN0D 1NIFA 2BVEA 5DMKB 2WO3B 4X4MA 3ZE2F 3S34H 3AQYA 3RJDA 4HH9A 4M93C 5DUPH 1T03H 4YLQT 5GGTL 5L2KA 4OFYA 1O6SB 5DS8B 1IC5L 1OM9A 1N68A 3QXAA 1Q9KA 4KQ4H 4JDTL 5G5DA 1Z9LA 5T3ZE 3NVQA 3RL1B 5TF0A 3HKZA 1GXEA 3VD7A 2ADFL 4AM0Q 3TBWB 1OSPL 4ODUB 4CVUA 2OMBA 1UH3A 1Z5LA 1GC1H 1KLUB 5D96C 2FATL 1E9PB 1NMBH 4JQIH 4G82A 3QO0B 1XCWA 2A6DB 3IDXH 4YR6B 3I6LD 5IR1A 1UT1A 3SN6N 3VXNA 1NM4A 5I8OL 2IAND 3FOMB 3G5VB 4OZHF 4KUZL 4PUBH 4LCUA 2X0WA 3U9WA 4HETA 6PCYA 3DVNA 4IDLA 3WIIH 1IT9H 1GOGA 1EEZA 3KS0J 4KUCD 2EIMB 4LFHD 2ERJB 1G9MC 5TTRA 3TBVB 5I75B 3CHSA 2LGNA 4Q9QL 3LJ3A 2AVGA 3D12B 2XG4B 2Q3XA 2XWEA 2FT8A 1O9VA 2D73A 2XA8L 4H13C 4ODTH 5AZ2L 2XNAB 4LASH 3ARWA 3DUUB 3QIWD 4YGVA 4TOYH 3QQ4B 3D85D 3GMNA 3D85A 4U2ZA 1MDTA 5D1ZB 1SVZA 2AAAA 2G0KA 4FF9A 3DOHA 4OR1A 2HMIC 4HA1A 3L4CA 1P9MC 4GUPB 4YSQA 1MJ7H 4R8WL 4E0RB 1BLNA 3HEIB 1G6RH 5J5EA 4IK6A 3V6ZB 1SDDA 4TUOB 3BKYH 3UTZA 5A40E 5E24E 5ITZA 5CZXC 1CLCA 2OZ4H 3SPJA 3IMPA 4IHJB 1Q9LB 4TSBL 3SE3C 3F84A 4J8RB 3SCMA 1D3CA 3WNMA 3H3PL 4MQXD 4LF3B 5ICYA 5JHDD 3QULB 1I8MB 4U49A 3TJHC 5A2QM 5CCKL 1X9UA 1HH9A 3RX9A 1EXHA 4O02H 3RGVB 3M1OA 1PJ9A 5ALBH 3ARDB 1RUPH 5CBEA 1R24B 4J3OD 3X11B 5EC1B 5DJ8A 2MRYA 5LOVB 2NSMA 1F4WH 1G7IB 1DZBA 1I1FA 2OXHB 2H32A 3K6IA 2LU4A 2DQ6A 1HL5A 3VX0A 3DX0A 2DTML 4BFJA 1WWBX 1AR1B 5BMVB 5EORH 3AG2B 2WLLA 1SYSA 1A4JA 3N5AA 1HC1A 1NLDH 2JIXB 4XO4A 2WJ5A 1CDGA 4PJCB 2J6WA 3G08B 1GHFH 4FZEH 3BVWA 1U8PB 3DO3A 3HJWC 3HI1A 1P7QA 3LIZL 4RMWA 3IE9A 5H4ZA 35C8L 1JNNL 2HFTA 3DDGA 1AOZA 1UD6A 4L8SB 1H8LA 4K9EL 1CK2A 1C16A 3V6ZA 1RI8A 3ECBA 5SV4A 2EABA 1CR9L 4J7RA 3BIBX 4GINA 4MVBC 1FNKA 2VSDA 4NN6C 1CYXA 3DOSB 3TYGL 3LV3B 1ZJBA 1X5YA 3DYPA 3ON1A 1AJ7L 3VWJD 1EMTL 1U8QB 4YH6A 2MCMA 4E41E 1B88A 4QD2E 3GMPA 4ZDHB 2X7LA 4UT7L 3S98A 3HNTL 1M2VA 2FEJA 3OKLA 1GZ0A 1KB3A 1HDMA 2B5IB 4M6OL 4IRSA 3MV8A 5JIKA 5D71H 1HEHC 1IRAY 3NJGA 3PWPB 4PPTA 5EO9B 3WS6C 2I24N 3WHE0 4ZPTA 3RWCB 2AJZA 1B2WH 5GGTH 5HY4A 1CDIA 5I1IL 4TLTA 1GJWA 1QBLH 2WANA 5D9SA 3M4SA 2H6LA 4PIBA 2A6DA 5A2AA 3CCHA 4TNFA 5ABAA 4Z95H 4M1CC 1JK9B 4ERSH 2EDFA 2AK4E 3S0YA 1ORQA 1YC7A 2VQUA 3N40P 4EBQL 5AUMA 2ESVB 4JG9A 5GANK 5K69A 2DI8A 1ZPUA 3O8XD 3CN4A 4FNUA 1AP2B 5I8OH 4PBXA 1I85C 4D0CB 5IJ9B 3WJPA 2JCCB 3AFLA 3QUGA 2QGDA 4Z7AA 4ZXBA 1JF1B 5C2BH 5EBWB 2MJWA 3EYSH 4FQXD 1KIQA 1T0MB 1YGYA 1M6OA 3ZRSA 4XAKE 4MQSB 2X1XR 5A2FA 4BV1A 2EEAA 1E50A 1YMMA 5DRNA 3SYAA 5HVHB 4RQOA 1ML0A 4J2QA 4P23A 1TLMA 2B4CL 3PAUA 2F5AH 2IMMA 2FD6L 4RNRB 5C7XL 4OQTH 3ULUE 2J1ZA 2B59B 4HK3J 3KGRA 5DA4A 1D5BB 5I1GH 4BYHA 2V2TB 4GSRA 2VN5A 4GI8A 4LK4A 2BOBA 5I8CB 1PFCA 2VZUA 4WWID 2TSAA 2Y5TB 3N41F 3NRPA 3FU8A 3O6FD 3SBPA 3LPPA 1EEQA 4BCZA 1E7KA 1T7WA 1WC7A 2FAUA 4OBSA 3RWDA 4P23B 5D7JD 2ZTBA 4OFVA 3ZDZE 4P46D 4BEIA 3IF1B 1RU9H 3RBGA 1CICD 1KBKA 1FNLA 3GKWH 4G7VH 4HD9A 4KGJA 4L3ED 2DJUA 2XQBL 2J6EA 1IM9A 1GY1A 3NN8B 1FFNB 2NX5A 3WIAA 1KTLA 3H0TA 4F3FA 3B34A 4K5NA 2JCCA 4HSCX 4WU7B 1KIRB 3HW7A 2YAQA 3DHUA 5DZOA 1PNDA 3RY6C 2MHAB 3ILQD 2BCMA 1J88A 1Y6MR 3FO2B 1QO3B 3F6LA 2ZOWA 4BCXA 1QPXA 4G9FE 2NY3C 5JIIA 2P8MA 1HWGB 1UJ3C 3P9WB 1SHMA 3QO1A 5D1XC 1HYSC 1A6WH 2XZCL 2UYLA 1TCRA 1XF4B 2MOQA 2ZWKA 2DQCH 3BO8B 4E9XA 5E2VL 3B9KB 4HIPA 1FIGH 3DGGA 1BHGA 2DLIA 1CE1H 2PXYD 4I1RA 3X14B 2VE6B 3INOA 2F61A 4YDZA 1NGZA 2CKBA 1EH9A 3WPXA 3ZDYF 4HZAA 2WLZA 4PW9A 4U31A 4P2CG 3LCYA 5J56B 2KQNA 1GOFA 4IRSB 4OLWH 3SE4C 4GUQA 3QUXC 4W4OC 3SDCC 4BDVA 2HLEB 1RD6A 2H1PL 5A16B 3MRMA 4AIZB 2XACC 1XL6A 3F7VA 4R97C 3GMPB 4ZDHA 5C0AD 4YDVB 3VJ6B 1ZWIB 2YXVA 3PP4H 1ROWA 2P46B 3AY4A 5KVEH 5MEPA 5EF1A 4WHTA 1RK0B 4LPXA 5FYLL 1H6TA 1WISA 4FS0A 3GUFA 3LPFA 5F3HB 2P1YA 5JMOC 4DFHA 3X14A 1AKJB 1G7QA 3MNMA 3LKSA 2JCCF 4PVNA 1K9MH 4EE2A 2BSSA 4MMZC 5KSAA 3IEWA 3T08A 4YE4H 4O4LA 4LARL 4DSYA 5T3ZH 2YA1A 1T04B 4LXFA 2QSCH 2YO3A 5L4IA 4Z95L 3G9AB 2ZWSA 3VWKA 5E4EC 4LSTL 5GSRB 4P2RA 4Q6IC 4MCYB 2P8MB 1O7SA 4POYA 5FW6A 5F89A 2BNQE 5LGJB 3V4DA 1C7SA 2VXUH 5JXAH 1N6UA 4HUCA 3LQAH 3U4BL 1KYOJ 3QJFB 5AL0A 3FQWA 1T89C 4UNTA 1OSZA 2VDPH 3A0OA 2WO2B 2VZ3A 3LKOA 4EZMA 5FM5M 2PYEB 4NUJA 1OCRB 3V4PA 4DUWA 1CDJA 4Y5YC 3O2WH 4F2FA 2OJ1A 3JWNC 5TQ2L 4Y2NA 3EH4B 4IM8A 4Q6IB 5EHFA 4B7IA 4PGCB 4BSVA 2DWEA 4RBPK 1OQXA 3GSWB 1NGYA 3BYYA 5ECGA 4FG0A 4QRPA 4UIMA 5IJVA 1W8OA 3S3JA 1ZS2A 4YE0A 3KPLA 3UTSB 4FXGB 5DJYA 1UWEL 5KW9L 4K5MA 1BF5A 5A7EA 3L9YA 4PWIA 3RVWC 4DW2L 4JFDE 3C08H 3VQ1C 3DV6B 3IRCA 4JO3L 1AXTL 4OFKA 5J9PB 5G4UC 1BFVH 1Y7VA 3BC9A 2BP8A 5DLML 3THML 1Y1DA 3GI8H 3NCEB 1X5AA 2XKSA 1QD9A 1INDH 1RMFH 3KLHD 1QFHA 4Y4FB 4TSCH 1RULL 3SDAD 1D5ZA 4XWOD 4ZO8A 4AW7A 3DIVA 4F2EA 3JALA 3VSVA 3E1ZA 1BFOB 4CBZA 2EKSB 1KBGH 2ZX8A 3STLA 1AH1A 1J5CA 3B2XA 2RHOA 2NXZC 5GGSB 2P5EA 2XIIA 2ZIDA 3C60C 1ASPA 3OQRA 4G72B 2V9QA 2EEDA 4A7VA 2D7TH 8PAZA 3VFNB 4HEME 5E5UB 2E56A 3O9WC 1YQNA 5JHLL 1URLA 1OF0A 4LHUA 1T7XA 4APXB 3NP3A 4U1LB 3ZT6A 4KJQC 4NO2A 1FIGL 3S8FB 2O6CA 1BJ1J 1NCTA 4HLZH 3MQIA 4NO0B 5LNGA 3R0MA 4FP8L 3AS3A 2F9ZC 4QMEA 4UT6L 3OG6B 2J7LA 3TA3C 1OHQA 4LCIH 2E4FA 1ADWA 3T77A 2CH8A 4POZC 1K8DA 1SUHA 4A7GA 4AYSA 2PXYB 1T1WB 2FO1A 4LVHC 4AEFA 1NANI 4PRAB 3MRGB 5DD3H 1ZLSL 1MHHA 3PWVA 3AU1B 4IOIB 3RDTC 1KLFA 4WZ9A 2ZVYA 2P5WB 4NQVB 2EDTA 1NCCL 5H94B 4TUYA 5CA0B 4LCKA 2AP2A 4U3XA 3O3AA 5FGRA 5JVDB 3S3PA 2YAOA 3G5WA 3GSNL 1IGJB 2C1PB 2GJ6E 2XY2A 1PZCA 5HVWA 1AI1L 5CIPA 2XZAH 4MMZB 1W15A 4TQHA 4F57L 2ZX9A 4HMCA 5DEFB 3WLBB 2X4NB 4Z78A 3OJMB 5E99L 4O2CB 3EJPA 4IRZH 4R4BA 2O5NA 5D7JA 1SBSL 3HBPA 1LEGA 2P8PA 3R0NA 4Z0XB 1RQ2A 1HKLL 1T4KB 4LRIC 4C56E 2LOEA 2EXYD 4YHIA 1JNHB 2KMWA 5TDOA 2IG2L 2EH7H 1D2PA 3V6BR 4U6HB 3VCZA 4LCCC 2I07B 3OV6A 4P2QA 4F2MB 5GS1B 1UKSA 2WLLB 4JRYB 2ZXGA 1J1XH 3DBSA 2NX5E 5I1CH 1ZT7B 5IVOA 1NWOA 4P2OD 4UTAA 1OM3H 2EE2A 5IEHA 1ZE3C 5EFIB 3LWVC 5MI0B 3O8XB 2HH0H 1MFAL 3ZIYA 3F8UB 4C82A 4MQ7A 5FYLD 5B39B 3MOQA 5EU3B 5BMFH 3OR7B 3E20B 1K73H 4GI6A 4LT7A 1QLFA 4X5WB 1JPST 2PCPA 2H4EA 5EA0L 3GXFA 2V2XA 3KCPA 4KI5C 3VM5A 5BV7C 5IVXB 1UWXK 3PWJA 2RTTA 1MUJA 2X4OB 5TE6H 2N56A 3QNYB 4XHQA 5C08B 4YSSA 4DKDC 4FQXB 3DGDA 4PV8A 3GK8L 3OKNB 4DEWA 1QLEH 3U0TB 3DRQB 1X4YA 1F6FB 2IGLA 2NUTA 1KPVA 4EJ1C 1E4HA 4X9FA 3ZKQD 5AW2B 1VHAA 3CSFA 3QIWB 5B1CA 1C5BL 1JZ3A 4OCRL 1ES0B 1CF8L 2RJMA 1VEMA 2YMOA 1WVZA 5JPMA 1M7IA 1I9IL 5D1QE 4ZUUA 5C0JB 4KU1A 1EWHA 2FJFA 4WEBH 5I73C 3CPQA 1GCFA 2A3TA 3B5TA 4K7PY 2YFNA 4C4UA 4K15A 4WCYL 5FGSA 5TD4A 1BFTA 1YNLH 3QUXA 4MLSA 2QDVA 2WUCH 5DS2A 5E1HB 1A9EA 1MW3A 1XIWB 2ORBH 3CIAA 5EU5B 3L2MA 3ATAA 3G6DL 4BXVA 5HXMA 4PRHA 2HN7A 2QZ5A 4LKCA 3MLRL 4R7DA 3WTTA 1L6PA 2JKSA 4LAJH 3TO4A 1DO6A 2BXYA 3Q8EA 4IGBD 4FQPA 1GGBL 4N1CA 1ZHNB 4I0KA 4FEIA 5IW1B 2EH8L 3JATA 1ZOXA 4YDNA 4AE0A 4BINA 1HZHL 3VU1A 2ZYSA 3S5LB 3RYFA 4K9JA 5BQ7B 5KJ4A 3L3OC 4NQXB 3N1FC 4H88H 1MIEH 4R2GD 4XNZB 1I9JH 2XWJB 5GRUH 5DUBA 5HHNB 3TA4D 3PFUA 3RZCB 1T7VA 3DUSA 4FQQB 3L5XH 1I1AA 3D39B 4IKJA 4O51B 1DJHA 4NBXB 4LVOC 2IVFC 1IJNA 2JLLA 1NIEA 1JVKA 5L6YL 3BPOB 2Q2LA 4HUUA 1OP3H 4JZJB 3T6XA 5JOPE 4K0OA 4APQA 4A37A 1CK0L 5E1IA 4RAVB 1E2ZA 2ZPKH 4YJ2B 1RZGB 5I6XB 1TYEB 4ZK8A 4F57H 3X17A 4CUCA 5AOMA 2WZPA 4FA6A 5BS0B 5FJ4C 1JPGA 4IHOB 5EAZA 1IBDA 4FI7A 1F42A 4I18C 5IV2A 4RBPH 1QYGH 2R751 3CBJB 4JFPA 1C8QA 2QBWA 4PTTA 5DEGA 1RUQH 4FGMA 1CFSA 2VDKB 4PJIF 3RE0A 3HG2A 4QJ4B 3KDMB 5CLTA 5CP3A 2G9KA 2F7RA 2Z8WC 2BY0A 1PZDA 2F54E 3MXWL 2DWDA 4P2OA 3ZKXC 1GSMA 4G43B 3AY4C 2O61B 5E6YA 3TZVB 1G6VK 4LL9A 2Y2TA 2J8HA 3F58H 3NZ8B 4RETB 4TS6A 5DJ0A 1ETZB 4G4ZA 1N18A 1MZYA 2AJ3B 1A4KB 1DJXA 4HH8A 4N0FA 4U6TA 1E4KA 4Q9RH 3T4AB 4QTHB 5IW6A 1JZHA 4NFDA 3BP6B 2IAMD 3QZWB 1AR1D 5DHVH 5CS7A 4I50A 1L0PA 2EC9T 3GS4A 2OW6A 3DXAD 4X8CA 1TPXC 2NY2B 3FQYA 4X6CF 5M7QA 4MD5B 5M94B 4UOJA 1FVDA 5DVKA 4FQLL 5FYJL 2ITCA 2Y07L 1NMBL 3O4OB 3QXTA 4WUKH 3ZRCC 4CSZA 4Z78B 3QUYA 2DDQH 4KXDA 5KAQG 2AJSL 4YOKA 2VN4A 1U95B 2K70A 3VXOA 4XPHH 4HJ0D 5DRXA 4BFGA 1KPVB 5K5YA 5TDNA 4XXWC 3WIIL 3PS6A 3HMWH 3KLHC 1QA9A 2NYZA 2Y69B 3V6OE 3GJFK 3RURA 2G5BB 2WV3A 3GYRA 2C34A 1CFQB 3EH5B 3JTTA 3QUHA 4Y7MA 3IDYC 1KCUL 3L3GA 3MV7D 3MBXH 3X13A 3L1EA 1YUHB 3PWJB 4BSVB 1K85A 2VW4A 4NM4L 2BVOA 4JRXE 3HC4H 4XCEA 4WJG3 3WCYA 3F64A 2VAWA 1RZ7H 4JFUA 1N59A 2VNCA 1NCAH 3NSJA 4EZJA 2EE3A 5LBSH 4MQ7B 4JGJA 2OYMA 4Q58C 4DPRA 4Z8FL 1LO0L 1MI5A 5EZYA 3KYKH 4AZ8A 4AT6A 3C87A 1ZK5A 3FFDA 5GONA 4JW3A 1Q8RA 4LLYA 2EIJB 4N2BA 1NCWL 5C0BE 4XTRC 1CGYA 3E9TA 2RHLA 5F7DA 4DZBB 1JD7A 3K72A 4DP4X 1N0XH 2CLZA 3QDGE 2QTEA 5FDYA 4ZUTB 3M8OH 3KPRE 4AKQA 5F9JB 5MP6L 3EYVA 1T4KA 4Q4EA 1A5FL 1D9KB 4GSQA 4Q14A 1UD5A 2ERJC 4JFEB 4NHCL 2PTTA 4YDJA 3CZGA 4QF1B 4U1JB 4LSSL 3HUJF 4X6FB 1WIOA 1HZLA 1MCNA 5TJWK 2P5EE 3B83A 5ANHA 2HA1A 3E38A 4MNQD 4YUEL 3ZDXB 2NYKA 4Z76B 5CR8A 4FA7B 3U0WH 4Y5XB 4PRBB 4Y19D 2CDFB 4OD2A 4MZRA 5FWQA 4I3GA 1NGQL 5HI5D 3VXRD 4YHNB 5IESH 4YJ3A 1MPAH 1FPTL 3BSZH 3NIFF 3RPIA 4WU5A 4J39A 2CGRL 1VZHA 3CZEA 5EDXA 4YDKH 1F02I 5DD6A 3SKNB 1PQZB 3DMMC 1Q9OA 3TT1L 4G1MB 1PCXA 3IKCB 3NACL 2NW3A 3RDJA 1OZTG 1XGYH 3KPLB 1EGJH 4O4IB 4WNQA 4DGIH 3P10A 4Z7VA 3QI9A 4FHJA 4XNUL 3RVWD 1QQDA 3L4ZA 5C8JA 2VDOH 1QSFE 2PUQT 1MLCA 3CFNA 3ENEA 1KPRB 1AJ7H 1P6FA 1PIGA 1MY5A 3GMMB 2NTFA 3VGAB 1QFOA 1E9QA 2WN2A 2DJMA 3L3OB 3DGGB 3P11H 4I4WB 5FUOH 5EOQL 3SPIA 4UIKL 3P4OB 5KVGE 3TD5A 1U8IB 2XQYK 3IDUA 3LNFA 2JF1A 4TVPL 5AYUL 4D9RE 1Q72H 1OY3B 4NFBA 4WBNB 1R3IL 4ATTA 2LV4A 2V8MA 4IHBA 4WFHE 3WL9A 4F58H 4YAQA 2A7BA 4N6RB 5F7AA 1KJMB 2CO2A 2QHRL 3MSPA 3KPPB 4G9DA 3UABA 3JVGC 3VWJA 2DIJA 3MJ9A 2YJQA 3L3IA 2DD8H 2Z8VC 4HJEA 1BD2D 4C83A 2E27L 1OANA 4UAHA 1DSWA 2J1XA 2VLRA 3VGEA 1IC7H 4PP2A 2G9IA 1NEZG 1NGWB 2R56H 3BAEH 4CJ0A 1MIML 1JI1A 5GRXG 1A7QL 3WAKA 1J5OL 4TL4A 5CN1A 4P9HC 4E9YA 2Y3NA 1AKPA 1KBGL 3WYRA 1U43A 4G2AA 1YN6B 3C2AL 1EUTA 1C8PA 3EFFA 2AQ3A 4B5CA 1HHJB 1QW8A 2GITB 2YK1L 4WSKA 3S5YA 2BOBB 5I8CA 1LDPL 4MMXB 4ZI7B 1RU9L 5DHYB 4IU2B 1UM4H 5L9DH 5LA6A 3GKWL 4EI6B 5LUMA 3OHXB 2CDEB 4G6JH 5HGGS 5HY0A 4L4TD 5DURD 1NDGB 3HRZA 3OZLA 1SYVB 1PG7L 4FCAA 1UJTA 5AVZB 1JS4A 4KK9D 3TNNB 3N85H 1CBVH 3C5SB 4PJGB 4JKPL 4UQ2A 4G7SB 4EPSA 4S1QH 3PUUA 4L4VB 1YAIA 3WY4A 1SJMA 5I8EA 4L4TA 3KYKL 3RVVC 2PYEA 4JVUA 1RSFA 4NUJB 2A99A 2WZAA 4NCC1 3MCLL 4WVRA 4YWGL 3VD5A 5CLYA 1YZZA 5IM7B 1MQ8A 3FU7A 1NFAA 3HG3A 4CNIB 2IGTA 5DK0A 5IB4B 4XGZB 5EF3A 5BZDB 3UJJL 2CMRH 3WUZA 1WWWX 2Y06H 2VW6A 2W92A 2F1AA 3PP3H 4G8IB 4A6YL 2WVSA 1JF6A 2HG0A 5BRZE 3RIFF 3VXMB 4WO4A 1ACYL 3K8LA 4G6AD 4HEPG 1NKRA 2EE6A 4HIJB 4WEBL 2V5RA 2ZSVA 1R6VA 3LRGA 1M2OA 5C09E 2WSPA 2ZUSA 3JYCA 2JV6A 3CLFL 1A25A 5AW3B 4U1GB 2ZXEB 1IZKA 3G6DH 4A68A 4ZPTB 5SWQA 2GUOA 3IGAB 2ED9A 2YOCA 4PY8I 3NSFA 5KYWA 3QDHA 2PTUA 3MO1B 4Y4HD 4ADGA 4LOFA 3ESJA 2CUHA 4X7TB 2BY1A 3Q13A 3I85A 3OKMA 5ITBH 2ZF8A 4AGQA 1L6ZA 4ANWA 3C5ZC 2ZOLA 5MN5