2ZF8A

Crystal structure of moty
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
271
structure length
246
Chain Sequence
b'VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGRVVISLGRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component of sodium-driven polar flagellar motor
publication title Insights into the stator assembly of the Vibrio flagellar motor from the crystal structure of MotY
pubmed doi rcsb
source organism Vibrio alginolyticus
molecule tags Structural protein
total genus 49
structure length 246
sequence length 271
ec nomenclature
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
A PF18393 MotY_N MotY N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2540 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zf8A01
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zf8A02
2ZF8A 1OAPA 4B62A 4ZHVA 2ZVZA 4G4YA 4ERHA 3S0YA 3S06A 2HQSC 4G4VA 3TD4A 3OONA 3S03A 2K1SA 3S0WA 4R40B 3TD5A 3LDTA 4PWTA 1R1MA 3CYPB 2KGWA 3S02A 2MQEA 4G4WA 4G88A 5EB1B 3TD3A 4B5CA 2LBTA 3WPXA 5EB0A 4G4ZA 3WPWA 4G4XA 4RHAA 2L26A 3KHNA 4ZHWA 2N48A 2ZVYA 3S0HA 5EAZA 4ZHYB 2W8BC 3CYQA 2ZOVA 2AIZP 2LCAA 3IMPA
chains in the Genus database with same CATH superfamily
2FZ3A 3WFCH 2ZQKA 2DAVA 3LDBC 3GIZH 1SUJA 3QDGB 3KVDD 3EDJA 1CF8L 4UT9H 4NERA 3PWPA 3RGVC 2WQSA 1T2JA 3ARDC 3N2JA 1OSZB 1MPAH 4QRRE 1F6AB 4OI8A 2P5ED 4LCUB 1RIHL 1P6AB 1ZSHA 4FFBB 5IJBC 4U6HB 3C8KA 3ZDXB 2F5BL 2WVVB 4HK3J 1IAIL 5K9KA 4A7SA 1DJSA 5DCCA 4WWOA 4A7GF 3ZL4H 2YAPA 4P9HH 4Y4FD 3PAZA 4F8NA 4KVNL 1AE6H 1J5DA 4HEME 3JZ7A 1F90L 2ED8A 4KVCH 2OXHB 1ZDQA 3WFZA 1WA0X 4D2NA 3QB7C 4HS6B 1X7PA 2RMNA 3KYMA 3MRNB 3QR0A 2XA3A 5KVEL 4NRXB 1UKSA 2WN3A 3OKDA 1INEH 1UZ8A 2H41A 5FCSH 5JIDA 3GRBA 2L8AA 2O30A 3OHXA 4ZQKB 3BYYA 4LF3B 1JJ2F 3N0PB 2N59A 4X8GA 1BMWA 1ES0A 3LQZB 1IV3A 1UB5B 2PW2A 4LNRB 2LU3A 3TO2A 4KX9A 2XTJD 3K8KA 4Y5XA 2J8UF 4KZDL 2UYNA 3D39B 1G7HA 4I18C 5DURB 3TO4B 3BRDA 2VUKA 1IRAY 2EO7A 5A3IC 1TG8A 1XWVA 2VRAA 2X7LB 3B34A 3SKJH 1ZXKA 5BVPL 4LEXL 1LO4H 4B9PA 3X12B 1MLCA 4YNYA 4J8QA 3T65A 1OLLA 4X0NA 4ABQA 5CJ8A 1UUSA 4DO4A 3RX9A 1JZ4A 3EO9L 5IHZB 1T66D 4N9GB 2EVFA 3IJ8A 1RULH 2IOIA 3CPUA 4BRVA 1FAKT 3GBDA 3IT8D 1X5KA 2CUMA 1CDCA 2Z8SA 3RWHA 1KGCE 5AYQA 1WA1X 4P04A 3MA7A 1G6RB 4XN9A 1J12A 5SWSB 1CDYA 1MF2H 4MA7H 3I6LE 1O6SB 1GY1A 4Y8AA 1B4JH 3D25A 4JZNA 4PP2A 3GGWA 3WGVB 3GHBL 3V5HB 2EDLA 3KGSA 3MRIB 2X2JA 4H1LB 4Z7WA 4I4TA 3EYSL 2BRRH 4HUNB 4N85A 2OYPA 2OI9B 5E5MA 4ZODA 4O4IA 4XX5A 3L9EA 3KWXA 3MUUA 3CMAF 4FYRA 2QQNH 1F86A 5A7BA 5CB4B 2P5WB 4I85A 4U1SB 1JTOA 3ASWA 4KMTL 1WZ1L 3MNVB 3MMEB 1KIUA 2XKNA 4IBZA 2W88A 3EIFA 1YEHH 4RAUA 1PZ3A 2JELL 3D09A 4P3CL 4D0BB 3Q1EA 5BOZG 4CJ0A 5F96L 3ATFA 1TTFA 3WGLA 1EZSA 2BWDA 5D8JL 1MFDH 1NKGA 3MR9B 4XO9A 2VJ0A 4Y19A 3BH9A 1GYUA 4L5FL 2OTPA 2O61B 1A2YB 2I07A 3MQWA 1WH0A 5IG7B 1HHHA 1NGXB 2XVLA 4QHUA 1PBYA 3WXVH 1R5VB 2C5DC 4A66A 4H13C 2O5ZL 5ITZB 4XPHH 3TEZA 1BA9A 3U4BH 4ZFFB 5ESAA 3CE1A 3KG5A 3MRHA 2C9AA 2YSTA 5I6KA 3D0AA 3DDGA 3QC5X 3LB6C 4Y9GA 3NJXA 4OT1L 2PWHA 3TV3L 4P9HC 2B15A 5F7EH 1CTNA 1NBVH 5C0DB 3L7EA 4RISL 3N1QC 2H6OA 1S5IH 5I1HH 2ALEA 1LQBC 5C09E 5AOJA 3GTZA 3QORD 3H56A 3VFGH 1X5YA 4UCFA 3CFBB 3PNWB 1FVDA 2WO4A 1AZRA 3V7EA 4JKNA 4YE4H 5D6DA 2G60L 2FX7H 4YEEA 1BVNP 2H6LA 5JVDB 4LBEB 4B9ZA 4OLZL 4U4BA 5DJZB 4Z7NE 3SDDA 2BP0A 2R9HC 4OZFA 4KZCA 4L05A 5DA0B 2VC2H 1HFUA 4N5UA 3RE3A 3GNML 4EE2A 2TSAA 2E7DA 4LHUA 4UNVA 5AW5B 5KVEE 1R9FA 1XCXA 5CMAA 4ZRGA 3CCLF 4XZUB 2ZCKL 2VRQA 4TLKA 3V9EA 5KSVB 2E3VA 2BTUA 1T03L 4NQUA 5DUBA 2YPLB 2DQJL 2YUZA 1CVSC 4D7PA 1XIWA 3HZYB 4M61B 5IMKB 5T33H 1JPST 3JUZA 5ANMA 4C55A 1S5HA 1YN7B 4FERA 4XI5D 2VAPA 4GUCA 1NC4B 3WV0A 1CE1L 1JP5A 3C87A 3UJIH 4YHLL 5B7FA 5FM4A 4IDJH 2WWKO 1F1AA 3HMWL 5J12C 4ERHA 3GXFA 3TBCA 3PAUA 2VSDA 3FU6A 1NPUA 4IHBA 1IGYA 4ZYKA 1CU4H 4CSZA 4GJTB 5JIIA 3FTXA 4M9OA 1OQXA 4MWFB 3TT1L 5IEHB 2F9ZC 3PLAC 4EDWL 1H8NA 2PCPB 1ZKAA 2P24A 4NPYB 4Y1AD 3Q6FA 3ZKMD 3DXAB 4HC1H 1JZ7A 2OX5B 1INQA 5D72H 3OKKA 4Q97A 1K5WA 3KLLA 4FMVA 5I15H 4MAUH 2P8PB 5DU7A 1AAJA 1KLFA 3MRJA 1SMAA 4R90H 3R1GL 4CJ1A 2B33A 1UD3A 1JXDA 5K39A 1LMIA 2HYMA 5F1KC 1THAA 3WGKA 1XF3A 3GTVA 5E24E 3JV4A 3E3QC 3HUJB 2Y0SA 2LBXA 3FQNA 3QR2A 4L37B 4R7XA 1JL8A 1DL7L 2X70B 1M7IB 1WUZA 2W07A 4NZ8A 3ARFC 1F4WL 4C8EA 1WTGT 3AAZB 2YGOA 4GW5A 4HXBL 1J8KA 1CFBA 2GUYA 2Z31D 1UOVA 4WV1B 4F7CB 5IJVB 1SHXA 4RESB 1GL4B 4JUTA 4UM8A 4EIZC 1F42A 3N43B 3QIUA 1N64H 1X4ZA 3GBLA 2EQDA 3I50H 1GXEA 3S88H 2CCLA 3IFOA 4JVPA 3VYUC 5A2KH 1IAOB 4WUKL 5DZ9A 4ZZFA 2V5TA 4MAYD 5T8IA 2Z0BA 5GS2D 2IANB 2CUIA 2ZNWA 4MQ7A 5JCOA 2NCEA 5ICYA 3FB8B 4HCGA 1TTAA 4L5FE 3F58H 4LRNL 1CC3A 4X9GA 1U8HB 2X1OA 5F71A 2QGCA 4UTBL 2XWJB 1ZHBB 1FVEA 2MTPA 4F80A 1U8PB 5DQ9A 3QNXA 3NPSB 4PW3A 3BOVA 3K2KA 3VRJB 4KKRA 1EHAA 4G43A 1Q72L 3BT2H 1PSKH 3LRLA 4LAJH 5FDWB 5MENA 3EYQD 8FABB 2EZ0C 4YJZL 2XN0A 2X88A 3OQRA 3O3AB 2HLAA 2DH2A 1YY9C 2BSTB 3CZFB 2CGZA 4P5KB 3MGOB 4POZD 4UM9A 1HCZA 5FFGA 3ROOB 4FXGC 4P5TD 3SOBL 1R3JA 4ZMNA 2DT4A 1CURA 3VMFB 2BNUA 4ODUA 3VAEA 3VWJD 4LLMB 4ONGL 1KWKA 4FX5A 4HGKC 5EPMB 1NMAH 3WJRA 4APQC 4KNSA 3DX7A 4LCWB 5DJXA 3DOSB 3IXAA 2H0FA 1VA9A 2APTA 2XXFA 2GI7A 2J21A 4MBOA 4AQ1C 1DVZA 2H3XC 1KN2L 3NH7H 2CG9X 2X4NB 4A2GA 2EUXA 3TA3A 3VX1A 4LPTA 4NNXA 4D0DB 4B60A 4CVXB 1E9PB 2YZ1A 3CCQF 4KY1H 4PJIB 3N44F 3K6OA 2JJTA 5GGVL 1ZSDB 4FEIA 4Z77A 1PLCA 1QMUA 1SJEB 5INCB 5HDQL 15C8H 2DTSA 2A0LD 3CQQA 4S2SB 3L3HA 2DN7A 1UXSA 1ETA1 2WYZA 3DO7B 2AMTA 4WI4A 3JT0A 2GABA 4FTVD 5L8KB 3VG0L 4G7YL 1R4XA 2JI3A 5DLLA 2EEAA 1U40A 4PJ6A 2QDWA 2C9QA 4ZXBD 4PI0A 2A4ZA 2BVUA 4HVBA 3H54A 1KB5B 1JN6A 1MHPH 1RZFH 1TXKA 4CSSA 2R1XA 2X4TB 1S9WB 4IOSD 3MXVH 4G4VA 2RQ8A 5EZYA 4TKWA 5I6NA 3RBSA 4X6DE 4QWWC 1OCCB 3FQTA 1KCVL 2CCWA 4OLXH 1QPKA 1X7OA 1JK9B 2PPEA 1JPEA 2OTWA 4GQPH 4BXVA 1L0XA 2MHAB 1FG2A 4RQQA 4XAKE 4I2XB 5HHNA 3IFNL 3C9SA 3F8UB 2Q3AA 3HW7A 4MCNA 1PFCA 2PPAA 5B1KA 4F6RB 4HAKA 4WI5A 3LIUA 1UA6H 5L4IA 4JO3L 4EUPG 2KZWA 3JWDH 2C7UA 4YJ3A 1HXYA 3UYRH 3IE4A 4LL9A 3FUEA 3VYPA 4XOEA 3UCRA 4MHHG 3G71F 1R6VA 4MMXB 4IOFC 4NZRL 4HOZA 4F2ME 4HJ0D 4TUJB 1DJHA 3QDHA 1A7BA 3T8MA 3P0YH 2VW4A 4D0CA 4L4TA 4HDIA 5B1BB 2DWDB 5LBSL 4BFIB 3WTWA 1OE1A 5E0QA 3P0ZA 4RFEA 4U3SA 4WK2B 3PWPD 3MNZB 4E9QA 2PO6A 3ESVF 4AMWA 4NT6A 5I8KL 4ELMB 5JDSB 1FFPB 2YK1H 5DWUL 2OMXB 1GSMA 2JIXD 1XSIA 2ICWI 3LKNA 2IV9A 3QEQB 5FYLE 1GZPB 3KR3L 3WIHA 4H2AA 3DMMC 3GBML 4PG9A 1P5UB 4EVNA 1U92A 2Q86B 2VMJA 3CG6A 2VXSH 3RB7A 1W5FA 2J5LC 5AW4B 5BMFH 5C0CD 4LSQH 1YQNA 4HIQA 2EDFA 3WMPA 4HX1A 4TOYH 4F92B 3K2UH 4HIPA 2AGJH 5C0FB 5DA4A 1F3JB 1OAYL 4TL5A 3RFZA 5JQ6H 1OSYA 4K4KA 3OSKA 4IOIA 5C8JA 2R6R1 3PY9A 4OJCA 3I56F 1GGIH 3PREA 1VKXB 1HN1A 2KLTA 4KUCD 4G42B 1BJMA 3VFOA 2BX5A 5GIRB 3ULUL 3CFKA 3QXDB 1YEGL 3HBZA 3QK0A 2H1PH 4J3VA 1JFQL 5DJDB 5JW3H 2H3NB 1NGZB 4QXGL 2ZKYA 3ABMB 1MJ7L 5EEWA 3CQFA 2BSEA 4TV3A 5TE6H 5HDRA 4PJ7A 3BIBX 1G0YR 4KUZH 1LE5B 3BUYB 5T3ZE 1RZJL 4ZUSB 2VDPL 1G7PB 3BUBA 3F04A 5EF1A 1N6QL 1BF8A 4LRIC 5DJAA 1T4KA 1J7VR 4FFZL 3IDGB 3KLSA 1Z5VA 3B5HA 3M1BA 2PTTA 2UXGA 1BZ9B 3E6FA 4EI6A 3T1WA 4N2HA 4R4NC 5MERB 4MCZB 2X4UA 1KGYE 4GMTH 2MWCA 4XOCA 3LV3A 1RZGA 3HUJF 3BPOC 3B8YA 2VIRA 3T2OA 1Q4NX 2CUAA 5DJCB 1VQVA 4XH2B 4BYHA 1DTUA 1PL3A 1GCYA 3C08H 3TBSB 4DPBX 3LWRC 3Q01A 4HXAL 4JY6B 3F85A 3QZBA 3IDJB 2V8LA 4WWKC 3RPIA 2FEEI 3GUTB 2JJUA 4ZHQA 4MJJA 4AW7A 2KERA 3D2UA 1K72A 4L4VB 2XACC 5DI8B 1V5JA 3QXVA 3B6NA 3DI2B 4UDTA 4O4YL 3PQYD 4KJQC 2V2TB 1PZBA 3N43F 3JTSB 3W82A 1A7RH 3HG1B 3KDMB 2IC2A 3FOMA 4YIQA 4FFYH 5C3TA 2OL3H 4G5ZH 5FPIA 3JWDC 4GG8A 3UEZA 2BY3A 3K74B 5E6ZA 1OB1B 2DS4A 5HYIA 4XXWA 2WTRA 4MMZA 2BDNL 1JGDB 4IGBA 2X2YA 2N7BA 4V11A 2CQVA 5HGBA 3ES6A 4P2YA 5LJYH 1W6LA 1R34A 2G9HA 1AFVH 5CSBA 4B97A 2N3JA 3US9A 2J6WA 4HWZB 5AOIA 1YEEL 4CADB 4ZHYB 1MFUA 3OV6A 5HHVH 4DCQB 5HBBA 4MD4B 3RZCA 4QXUH 2B2XH 5J11B 3FUJA 3C5JA 2FJFA 3FK3A 5L2KA 1KDJA 4N28A 2WCSA 1X7SA 4Z0XB 2Y25A 4NENB 4M48L 5H2BA 1K8IA 4RBPK 3WCYA 2Q76A 3VI6A 3TBYA 2EDWA 1HS6A 3BRGC 2R29A 1RV6X 5KSAC 1DANT 5F2FA 1BIIA 2XVGA 5FWRA 2A1WH 4LOEA 3SJVE 4HUVA 1JHLH 2FJGB 3E3QE 4KGJA 4OJYA 2FECL 4FQ2H 1J9SA 1LK2B 5LG1A 3BH4A 3TJEH 3B3IB 1AQ8A 4JG5A 4N3UA 1GA2A 2HZHA 3SGDI 4J2XA 3F7VB 3IYLW 3LEVL 4MFHA 1DEEB 4MXWH 4H88H 4PJIF 1D5ZA 3PV6B 4KV5E 4PRPE 5E7FA 5AVZB 3CDGB 4N8VB 4PH8A 1OAJA 4YLBA 1YQVH 3WN5C 2APSA 2UVFA 4IBLT 4Y1SA 5IB1B 4FL4B 3QXTA 3QJXA 5HI3C 4O00A 3LZPA 2OMUA 3FO9B 4MJIE 1OTTC 5E9DB 3S5LG 1BLIA 2XJKA 1TQWA 1Y6KR 1U8CB 2CHSA 4PTUB 4G8GE 4PJXE 3BEWA 1DBAH 3ZUNC 1YEKH 2VRKA 1TJGH 5IQNA 4AYID 5I1JH 5EU7E 2IG2H 2VLKB 5D7IB 4TRPL 3VXME 5IOPB 3BWSA 4EF3A 4YHKL 1JZFA 1HXMB 3MLYH 2DQEL 3RVTD 3TN0A 1QI5A 3ULUE 1S46A 1FNEB 2VGLM 3ECQA 1ZVSB 5CCGE 2Z91A 5C0IA 3RHWK 1Z6JT 4UTAH 3EXJA 5GRJH 3BP7A 2ZJSL 2ZWZA 4X4YA 2WSPA 5HY1A 5IIEA 1T1ZB 5IJ9A 4P4KB 1R0AH 4CMMB 1P4IH 1ZVYA 4JKKA 1PFOA 4IHOB 2OS7A 1SEQH 5KMGA 3WLBB 1YMHA 1TEGA 3QO1A 3L08A 3QJRB 2VLRA 3GSWA 4OZ4A 3LXUX 4N0FB 4N2MA 2E6JA 3PP3H 4DZBB 3Q2WA 1U41A 4WW1B 2BFVL 3PPSA 1MWAL 1IGCL 1P84K 1K2DA 3B1TA 2XWBA 2ZSWB 5BOJA 5F7AA 5D7HA 5E70A 5GZOD 2PCFA 4ELMF 5L9DH 3CFDB 1W0WB 3OKEA 4U6YA 5ALBL 1N6UA 3OJDB 5LGKA 1KY6A 1BXAA 2CPUA 4FRWA 4HUXA 5CJOL 2Q8AL 4M7LH 1LWJA 1OD9A 1DZ0A 2NTFB 2XQYA 4MVBC 1OGTA 1IQWL 4Q4IA 6TAAA 1IFHL 4NP9A 4QCIA 4J4PA 4NQCD 5DVPA 4L1HA 1SN5A 1U4EA 1C08A 2AXHA 1BXUA 5J2UB 4GYBA 3STLA 4HHWA 2UZIH 1RZ7L 2DEWX 5DJ6B 4EQ2A 5IW6B 5FHAL 4F7TB 4K73A 4A67A 1ZMYA 4BVQA 3CHQA 3IMVA 5KVGL 3MRBB 2OZBA 3LN4B 5AAMA 2F53A 2FT8A 3BLBA 4IKNA 4R0LA 1DQMH 1HXKA 3INUH 1U8NB 3K72A 4Z18A 1P4BL 5AD0B 5JA9A 3BN3B 3HE6D 4G6FD 3UTQA 4H8UA 3M84A 1LO5A 4R4FL 5IHLB 3C9TA 3PYCA 4QHNA 5HYSB 1HZHH 1A5FL 1UD2A 3NCWA 2P5PA 1FQ9C 4I3RH 4M8UA 5CEZD 1H3TA 2AQNA 2FWSA 1CXKA 4L1BA 1T5XA 2AABH 5DVLA 2LQRA 3VA2C 1E2VA 1JCVA 3MLXL 3P1VA 2G2PA 1EAPB 4CU8A 2BCKA 4JQXC 4IS6A 3ZR5A 2R23B 1BBJB 1JUFA 2L7JA 3KPOA 3L3IA 4LE8A 4AQAB 5DZOA 4HJIA 5FECA 1P7KB 4MA8L 3LNHA 1SVZA 5TD4A 2L0DA 1JZDC 5HHXL 1UFYA 5C8YB 2YD3A 4TUOB 4FQPA 4EBQH 4PVMA 5AFAA 1CFTB 1DLHA 3CMGA 3NZHL 3QFJA 4P4RB 5E8PA 3AU1B 2EDEA 3TXAA 3ZYIA 4E5XB 3D18A 2DM2A 4B5CA 1MJUH 3TA3D 2YS4A 2G2NA 1TQCC 1C1EH 1WD8A 1W6WA 3GM0A 1Y0LA 3DSFH 4UQ9A 3MREB 1VCBC 4TUUA 2V7HB 4QRAA 2C4FT 2DICA 3ZTDC 3NJLA 2ZOVA 1D6VH 4QRPE 2CCVA 3KW7A 3HZKB 2CZNA 3J80M 5BS0B 3F7QA 4NO2A 4ANVA 3I3FA 2B4CH 3EYVA 2CGRH 1QFUH 4LGRB 1QWNA 2VABA 1C8PA 5JIMA 2XZCL 4EI9A 3NACL 1O75A 2MQEA 3N9GH 1YMMD 1D5XA 3A6CH 3UT5B 3V7AE 1SHMA 3EADA 2E5EA 1IFGA 5ITFA 3L4CA 2VAAA 3INOA 3EGSB 1ASQA 3O6FC 2J72A 5I18L 1A6VH 5F7YC 4MBRA 4OCXL 1U8KB 4BIKA 5HHOA 3HKZA 1BF2A 3NFNB 3DOIA 5CUSH 4F57L 1A25A 1AS8A 1Z5LB 3RUGE 4ENZA 1K3ZA 2HT3D 1YHPA 2Z35A 5M95B 1GW0A 4A2FA 2IAMD 2J4WL 1VQOF 2NXYB 4OVUA 3MRLA 3OKLB 4YAQA 1NGPH 2E74C 4A6YB 2ICWJ 3GSNB 4UB0L 4DGIL 4DK3A 2HRPH 1TDQA 1EDHA 4IMLB 1XQ4A 5BNXD 5IW1B 2CKBB 4LKXA 3P30L 5ISZB 2NUTB 3SKOB 2WKOF 1ILSA 3HAEG 1FNKA 4P2OA 3BZEA 3P10A 3IDYB 1DUYB 1XGQA 3QHFH 4X7TB 3UO1L 2VDMH 4CDGC 1ADQA 3J8F7 4OV6F 4UBDC 2GC7C 5EOQL 4PJEA 3WKPA 4AEHL 2PO6D 2R4SH 3AUVA 4BT3A 3O3UN 4BKLB 2JXMA 3LXAA 2QR0B 3VJ6B 2YPKB 3KPSE 1YEIL 2JKXA 2YO3A 1T7YA 2A6DB 2CXGA 3AC0A 3S2CA 1DQIA 2QSCL 4PMEA 4G9FA 1MN4A 4LNUB 5D7JB 3ARQA 4MJ2A 3NOIA 3U6RB 6CGTA 3LN9A 1OAQH 1HAWA 4MKMA 1JWSA 1W0VB 2HKFL 1VF5C 4JHBA 2J8UA 3RWFB 4AKQA 5CLYA 5D7IF 1AGFB 4FJZA 4K7PL 1IBYA 1OP3K 1T66C 1EH9A 4M7JL 2FEDD 5L0QB 4WTQA 3PWNA 1JYVA 3ECBA 3JV6B 4G1EB 5GSVB 3CAFA 4X6BB 2GJ6B 3EH1A 5E5LA 3VXSA 4X6EB 1TZIB 4JLRB 3N55A 1YPZF 3QUML 2FLMA 4JY4B 5FKPB 5T3XE 2Q10A 4U1JA 2Y3NA 4TVPL 1GZQA 1KXVA 4HS3B 4RZCA 5DR5H 5IGXL 3MRFB 2HX7A 1ZPLA 4H8WH 4XNZB 2CO2A 1AD9A 3MYZA 4G8AC 2BSED 3U9PH 3P3UA 2GEQA 3O3DA 4WO0A 4PLOB 4JFXB 3VVVA 1U3HD 1IILE 1AO7B 3KAAA 3MV7D 3QIBC 5AEAA 5FNVA 1K8AH 2BP3A 4Y4KA 5EOCH 3HKDA 3H2QA 1NWPA 4DO6A 3G9VA 1VFMA 5F1SA 1HE8A 4YJ2A 5KVFL 1PQZA 5I1EH 3QRGL 5F0PB 2E46A 2B4CC 2ZUSA 1NAMA 1N59B 1JNHA 1J0KA 1TUBA 1U0QA 1J10A 1OOWA 3LNIA 4G6MH 5E8DL 5I1AA 4XBGB 3VGFA 5JNYB 4G7VH 1XT5A 5DEGB 3UROR 1V55B 3OQ3B 1L9TA 2EYTA 2ZKMX 3QDJA 4TTGA 1TNNA 5DJ2A 3JASA 3HI6H 3ZMRA 4XMXA 1J9TA 1IM9B 3D2UD 4NRZB 1F00I 2YKLH 1AZVA 2KDGA 3DX6A 3P4MA 1FYTA 3IF1B 1DO6A 1VPOL 3MUZ1 2ALAA 3TYFB 5BW7A 3EJZD 4GAAA 1QVOB 3ZPDA 5HP8A 3ZVVA 5CA0A 5AZUA 4Z7UA 1BVKB 1FV1B 1GRWA 3QORC 4WF7A 3G6DL 3QNYA 3ECVA 1U93A 4U3JA 2FBOJ 1MCPH 4J5VA 4XPBL 3JALA 2ZUXA 3VB8A 3Q6GH 2P3YA 4YXHL 3RWCA 1FZJB 4B62A 4JFOB 4L18A 4WEUD 4L9DA 5LYJB 4PGEA 4PGJA 1NFKA 4M62L 2OQJB 4ZPVA 5ACLA 5BVJB 2ZOKB 3TYGL 2X1PA 2X4QB 3TEUA 4PRHE 1L5GB 4BSVB 2OJZL 2YPVH 3MOQA 2PKDA 1SOXA 3KVPA 3VXUD 5L2KD 4PBVC 1K6QH 1UWEH 2WWMD 2E7MA 1OTSD 1HI6B 2PETA 1TVBA 4GRWB 3WHE0 1QBLH 4Y7OC 3K6IA 1YI2F 4JPKH 1AHWC 1MCHA 4JRYE 4XI5C 4BT6A 1DLFH 5IESL 3R0PA 5BQDA 3BYQA 3DVGA 2CO7A 4JN2A 4LVNC 1MCEA 5HJGA 3CVIH 1DQDH 3IFPA 5I30H 3S8GB 2Y3AA 1QUNA 5DD6B 3UG5A 2VZUA 4FE9A 4QRUA 4PWEA 3BAIA 4FQCL 4PRAB 2A6JB 2B0SH 3TH3T 2HMIC 1J05B 1CF8H 4J3OD 4UT6A 5F93C 3H8NA 1UFUA 3MRQB 4YBLC 1Y07A 2OSLB 3S36X 5GINC 5F9JA 2XXGA 2WMPA 3FRUB 1TYRA 4U1LB 3MUGA 4H8WC 2P8MB 1J1OH 3GZQA 4N3TA 3ULVH 2F74A 3R8BB 4WU5B 2EDBA 3HAXD 3GI9H 4FZ8H 2F0CA 2YMTA 3MAWA 4FQQB 1F90H 5CBAA 2NY2B 1ZLVK 1TETL 4IRJA 4BZ2H 4QKXB 3IVKB 1ETB1 3FSOA 1XF1A 2DM3A 1OANA 1UOWA 4OJEH 4YDVB 4YGAB 2V37A 4PB0L 2DQHL 2JJVA 5IB2B 4OKVB 2RGSA 4TVPE 3ZDZF 1A8JH 3UTTB 4LEEA 3VQ1C 1G1CA 4GSRA 3KLHD 3FCTA 1PZSA 1R17A 4NB7A 4Q8BA 4OB5H 5KUMA 3J81M 3LKPA 2E9WA 1E5YA 3KPRE 2B5IC 4MAZA 4I0PB 3QDGA 2WLZA 3L5XL 2Z7UA 4G82A 3N1PC 4PJ8B 2XC8A 2ZUTA 4ORZC 3FFOA 4GW1B 4DK5A 5F70A 5HYFA 1OSZA 2XWTB 4OF0A 1F6AA 4FFBA 2OR8A 1Y18B 3IK2A 2WVVA 3T3PE 3DVNB 4DPCX 1FORH 3FS9A 4KTDL 2VLRD 5HGAA 3RVXD 2QADB 3BD4A 5D1QB 3RA7L 3T2NH 2DDQL 2YD4A 4HG4J 3QUKB 1HL4A 2ZUWA 4HS6A 4ZFOL 4B9IA 1HL9A 1KBGL 3GZOA 2QMKA 3LIZL 3MRNA 4AXWB 5BVPH 4NRXA 1JFHA 1L9NA 4DVRH 3B9KB 3BO8B 4WI9A 1OTUD 1PX4A 2B3RA 2XV3A 3L4WA 4I55B 2CHXA 6FABL 4OQTH 4FQXD 4LF3A 4OLVL 3S2AA 2Z8VC 3FTGB 2O1AA 4Z78B 3LQZA 1HL8A 1UB5A 3T0EB 4LNRA 3S3DB 3SQRA 2WXOA 4IM8A 4X8JB 4HFUL 3IETB 2VUOA 1CVRA 4PCSA 1S8DA 3DHPA 4P5TC 1UXMA 4X6CB 3X11B 3ZTEA 5DD5H 4ENEC 5JIQA 5CGYC 3D39A 1A3LL 3TO4A 1E5UI 3H6AA 3SYQA 4E36A 1OP4A 2XZAH 4NWTH 1H8LA 2P5EE 1DQJB 1M4KA 3GXDA 4LCVA 5F1IA 2E86A 2X7LA 4KMTH 5I19L 1AZCA 1A7PL 1WQVT 3X12A 3L6FB 1MXDA 5F96H 4HK3N 5SX4H 3BKCL 3MNDA 4MJ5B 1E3FA 3O9WB 4X7DC 5IHZA 4N9GA 3UYOD 2IPUG 1CYXA 3PJLA 1X5MA 4DSYA 2OTJF 1NFDE 1WITA 4YHNB 4ZDHB 4GQQA 4YPGB 3T3MB 4AWJC 1G6RA 2H8EA 4L4JA 5JPNC 5SWSA 2NY3C 1O6SA 1AACA 3UBHA 3I6GB 2DWSA 4M7ZC 3DK0A 5DMJB 3V5HA 1NIFA 1RCYA 4JJ5B 3MRIA 1DO5A 1HX0A 3PAYA 2EDRA 3QSKB 2B1HL 4H1LA 3ZQWA 4FA8A 4IBSA 4CVUA 4CGTA 3ULVC 5KVDL 2XTJE 2ADGB 2JV6A 5A16B 2KC0A 5D93C 2P5WA 4U1SA 1IGTB 5JTWA 1H3VA 3TV3H 4MSWB 3MNVA 4PU2A 2IDSA 3MMEA 5TK4A 1MRDL 1GTNA 1OOAA 4N2LA 6PAZA 2HP4A 2LVEA 4M1DL 4D0BA 1IEAB 1KPUB 2BS71 3TWCH 4DPAX 5IHUL 1AZNA 3VXQB 4NWOB 1NIAA 3LWVC 1YYLH 1BZOA 2G60H 3NK7A 4N0UE 2ENJA 3MR9A 2Y7NA 1RUAH 1OF2B 4OLWH 1XR9B 3S96B 1AYOA 1I75A 3NFSH 1SLVA 1U3NA 3OB0K 2VZOA 1IZJA 3DX0A 3E7JA 1IGMH 5AOLA 4CC1A 4PWJA 3QJZA 2O61A 1A2YA 4UINH 4HJ0C 1YEFH 4OFPA 4LBAA 3SDXE 5ACZB 5IG7A 5J9PA 1NGXA 1PD0A 5FYJD 4BCYA 3ZTJH 1R5VA 4GAGH 1N5YH 5ITZA 1FNLA 4EN3D 2W65B 1XGPA 4ZFFA 3X3FH 4NUTA 2F7OA 3BWAB 2WLHA 4FYSA 2ZCKH 1GGCL 2FHBA 5LHDA 3BZDA 3LWOC 2NY1B 5C3LD 3NCYS 4O2FA 2SODB 3GDCA 4ZK7A 1J48A 4RETB 5K5YA 1Z5WA 3AVEA 3N6YA 5HVHC 3CFBA 3PNWA 4A7TA 3S7GA 4UZSA 5BO0D 4IU3B 5ILTH 4IEFB 4AH2B 5JVDA 4LBEA 4RFOL 1F4AA 1ZEAH 1Q0YL 4GRWF 5DJZA 3TPUB 3FZUD 2BLFA 4M7LT 1S6NA 1KEMH 2R2HB 1QFWM 4B9GA 4XN1A 2CIKB 3KCWA 3OHXC 3MV11 4UQAA 3MLSL 5ECGA 3APNA 1S3KH 4G8EB 2G3MA 2CO6B 5BRZB 4MA3B 3EDDA 4XZUA 2F7IA 3NCEB 2QT6A 4OZFH 5DVKA 2WSDA 2YPLA 3LOWA 1J1PL 3L5WB 3L9RB 3HZYA 4M61A 4MJ4A 1VEPA 4Y5XC 3T4AB 4X2UA 4HETA 1UC6A 1HWWA 1NC4A 2X28A 4OD1L 2WXRA 4A2DA 2X41A 1TTRA 1OE3A 2V5YA 1NAKH 2UY7B 1A0QL 3NYKA 5CEYB 3BAKA 4IBVA 4XCQA 2K6ZA 2YD1A 4ZMOA 3TH2T 5GJSL 4XWGL 4U1NB 2OZ4A 1XEDA 3ZK0A 1FL6B 5IEHA 3DNKA 1M6OB 5FYJU 2PCPA 4YQXL 5EEYA 4OKDA 4NPYA 2CXKA 4LAQL 2VR6A 5J56B 3II3A 5DO2D 3DXAA 4ATTA 3VO8A 4OJFL 1IJNA 3VXSD 3EOBB 4GMSH 5ALCL 4PJAE 3KWVA 3U0WL 4BQCA 3HB3D 2V3FA 5EU6D 2P8PA 1DDHB 3HTNA 4HGWB 2HFFB 2YQ2A 1OARH 3MLVH 4HCRA 2BNRD 4Y16A 1CL7L 4GBXB 4P2AA 4QRQB 1M7UA 1QA9B 2D0GA 2NR6D 3FH8A 4WRLA 1H6TA 4Y88A 3HUJA 3VRIB 3CSYB 4L8CB 2W38A 4L37A 1Q72H 4RGMB 4XC3H 4KMQA 3WEAA 3BPLB 4A37A 2X70A 1M7IA 5AB9A 5KVDE 3BAEL 3SDAB 3SSGA 5CD5D 5DF0A 4DO5A 3AT8A 4OTXL 3AAZA 3QG6B 4AEIH 4JAMB 4WV1A 4L0ZA 4F7CA 5IJVA 2AJYH 4B9YA 3OAYK 5KJRL 2IAAC 2NNXA 3ET9F 5HXMA 5FO9A 1I8KB 1NMCB 2OZ4L 4Y1AE 5HSFA 1IAOA 4KQ4H 3T6XA 4XT1C 1QFHA 5DRZB 3JWNH 4NQDD 5GZND 4EXKA 3QDJD 2IANA 4K3GA 4P99A 2WIMA 3TWYA 3FB8A 2APVA 2FHFA 4J6IA 1E3XA 2H2SC 1HVXA 4TLUA 3ARYA 2JKJA 4RVBA 1D5IL 4X6CF 5D7KD 5F9DC 2XWJA 3OC5A 1ZHBA 3L54A 1U8PA 2LLNA 4NPJA 4KHXH 4UAOB 4XMLL 5DZNA 3VRJA 4ZNEE 5DZLA 5GGTA 3CLEL 5GGVH 2AITA 1G9NH 5FDWA 2NQCA 4BKTC 3RY5A 3ZO0A 5IQOA 3IMTA 8FABA 2K45A 3NEOA 1FH5H 3WFHB 3NJKA 1QATA 3O3AA 1WDAA 2OV0A 3DDFA 4E6EA 4ODHH 5C07D 3CZFA 4P5KA 5D6DC 1OPOA 3BC9A 3MGOA 1OT4A 4FGMA 4MMYB 3ROOA 1HKLL 3DV4B 3EH2A 3FSVA 5CD3B 3BKYL 3C8HA 4LLMA 1PCSA 1V3KA 5EPMA 1A6AB 4RGNC 3SDDC 3D85D 3GSOB 3I6KB 3IJ9A 4LCWA 3SDYL 1KC8H 2OAAA 3U7YH 4JRLA 1BZEA 1NL0H 5T5FA 3DOSA 3H9SD 3T3MF 5LKNA 1XGRA 2DQUH 4PJBE 1FDLL 2BHYA 2XN2A 3TJHD 2X4NA 3MACL 4XXDB 4AV0A 1O7SA 4D0DA 4CVXA 1E9PA 3KPMA 1QEXA 3ZE1B 1CGXA 1CTMA 1E4XH 2AEOA 4PJIA 1XIWC 4PTTB 2HFGL 1DBFA 3ZTNL 1R1MA 2FBRA 1T22B 1ZSDA 4FNSA 2JCCB 5I1KL 4FKEA 2BP8B 1SJEA 3CIQA 5INCA 1C8QA 2WINB 3L3JB 4S2SA 4Y5YB 2GK0B 3O41B 2KLRA 2JMRA 3RVTC 3DO7A 3SCMD 3NEEA 4E9WA 3GS7A 4LSUL 3VYSC 3PRZA 2Q9OA 5E6IB 2AXJA 1OM3H 1S9WA 4TLSA 2JJWA 3VXTB 3IDIB 4DVBB 5I66B 4PJDB 1VQ5F 4G6JL 5KZCB 1MCNA 3GT6A 1U8QA 4GIPD 1JK9A 3ABZA 4QHLB 2MHAA 3P9WB 1E43A 4I2XA 1BBDL 5J3HD 2VQUA 4L8SB 2GIXA 2DH3A 2PHNA 4R7LA 5B38G 2VDKB 3T2QA 5T5FL 4FCAA 3GBMH 1YJDH 1IKFH 2F5AH 4LL1A 4FFVD 5EO3A 2E27L 4XCFL 2GZLA 1IAMA 4MMXA 4XNUH 1URZA 2A7BA 4M7KH 3II1A 4PJ9B 3BN9D 4TUJA 2WTOA 4CU6A 3FU0A 1QBBA 1OAYH 4FTVE 1CD1B 3ZOPA 3CU7A 1PG7L 4BFIA 2DWDA 4D8PB 4LCIL 4ZTPL 2ZWKA 1OD7A 3MNZA 3B4NA 3JWNC 3JBG7 1TQBC 1EJ6A 3RDJA 4ELMA 1KB5L 5D1XD 5JDSA 1FFPA 3QIUC 2OMXA 3D3VD 4QKTA 3Q2NA 2J1WA 3QEQA 1IEHA 5TQ0H 1GZPA 3JYCA 1SY6A 5ANHA 2W91A 2ZOLA 3G6AB 2IPTL 1P5UA 4HEPG 5JXED 3I02B 1H6UA 1TJHL 2Q86A 5JCOC 2D3NA 1CDUA 5GRUL 1P2CB 3OPZL 4YDJA 1G9NC 4W9HC 2EUVA 3S8WA 1KMGA 3RKDD 2QGDA 2OSWA 5FF6B 4JRFA 4ZFZB 2WGXA 3WIHH 3ETTA 4N8PA 1J0ZA 5C0FA 1BZ7B 4JCLA 5G2NA 4FXKB 1F3JA 3IRPX 5JMRA 5F3FA 2R39A 1PCXA 3UTSB 4CA4A 4OJDH 4OFYD 4AUYA 1VKXA 1E5ZA 1IIIA 1KTDB 1QSEB 4G42A 2A9NH 5GIRA 2NY0C 1XF5B 3G5YB 3QXDA 5AQ0A 2ZNXA 3FAXA 3HWUA 4Y4HB 5DJDA 2H3NA 4KFMA 1NGZA 3MTRA 3TH4T 3PWPE 3AROA 4HAGA 2AANA 2X4OB 3IWVA 3O4LD 5ADPH 3MI6A 2ENQA 4OF6A 1NGYB 5HGGS 1LE5A 3PL6A 1RURH 1V27A 2AQSA 4HWEL 2CRIA 4B9CA 4PVBA 4HT1L 1G7PA 2R7EB 4NP4H 1S9KC 2NNAA 3QZWB 4QR7A 4IBUA 2ESVD 2NNCA 4PRIB 1CGVA 2EC9U 3MLTB 2BDNH 1F8TL 3IDGA 1EERB 4JFZL 3TA3C 4PS8A 3TD3A 3APDA 2OR9L 1HC1A 5B4MD 2J73A 4AGLA 4ZFGH 1BZ9A 2CBOA 2QKIB 1X5XA 3NSCA 4XVTL 5C0CE 3TD4A 3ROLB 2BHZA 4AJVA 3FQ2A 3TL5A 3FO0L 2JJTC 3MBEA 5MERA 4MCZA 4Z3IA 4HH9B 1TFPA 4BINA 4HLEA 2ITFA 4KK6D 2K4AA 2J88H 3G7TA 4IIQB 1QNZL 2DBLH 2F7QA 3FMGH 2BNQD 5DJCA 3AGKA 2X2HA 4JDZB 4XH2A 3LAFA 5SWSD 3TBSA 1R46A 2XXCB 3FT0A 2Y6SC 4JY6A 5CJXA 3IDJA 3GUTA 1FO0B 5GIOC 3LNGA 4LDOB 5I1GH 1MCFA 5DI8A 2RHOA 3ABGA 2MCAA 1F3DJ 4NC1E 4XCYB 3JTSA 2V2TA 1B90A 4L48A 2PYFB 2P5WD 2C4XA 3HG1A 3KDMA 1JDDA 3I9GH 4HULB 2WXIA 1U2HA 4BWTA 2RD0A 2VN5A 1YJDC 1A22B 1OB1A 4NFBA 1N6VA 5ID1B 5G4VC 3KJ4C 4KROD 1JGDA 3UAAA 3B2UC 5I74B 5I71B 2QTPA 4L1TA 1GAFL 1TOXA 1MNNA 2EVJA 3I3DA 3R8QA 2V2XB 5MEPB 4P8QA 3V95A 2DLEA 4FNLL 1ZT7B 2WTPA 1Q9OB 2QHRL 4JFEB 4CADA 5IBUG 2BK8A 4FKKA 4G3YL 3U36B 4DW2L 4DCQA 4MD4A 1AKJB 3NGBB 1LL1A 2YWYA 3W39B 4LEOB 3QGVA 4ODSH 4Y2LA 1D7BA 3J27A 1D9KD 1S72F 5HP5A 2Y5TB 4CNIB 4BFNA 2CJSA 4E9RA 4Z0XA 4JGNA 4NENA 3P3RA 1EA9C 3S02A 3UC0L 2BP5M 3ZE0B 3OWRA 1GPOH 2E6QA 4TPRH 2PO6C 1CBVL 5J57B 1ZV5A 4TRPH 4JFDD 3LS4L 1QQDB 4YHKH 3SKMB 4N2FA 2IWGA 5AWNH 3T4YB 2FJGA 3IAGC 1JFFB 3EJYC 1KIRB 1R3LB 1LK2A 4KH2A 2WKOA 3B3IA 4YPJA 1M1XB 3WGNA 1OT1A 3DWTA 1OHZA 1JZJA 3B2XA 2R29H 3F7VA 3VXNA 1DEEA 2MMXA 3ZE1F 5LP6B 3PV6A 1A9BB 2GIYA 3CDGA 4N8VA 3HC0B 3WUWG 3FSWA 3GXUB 5IB1A 5MN4A 4TUYA 3B8SA 2K3TA 1EJFA 2FR4B 3NRPA 2UY6B 3FO9A 2QQQA 1I7RB 5E9DA 1SYSB 3VGDA 3RFZC 1F02I 4O9HL 4HUCA 3SEPA 2F1AA 2B8OT 1DBKL 5IK3A 4K71C 1U8CA 4PTUA 2DM7A 1BFSA 1B4LA 3S0PA 3QPQD 5GSRB 3AMLA 3V7AG 3IEQA 1LDPH 1LGVA 5CEZL 2H45A 2VLKA 5D7IA 4PJDF 5IOPA 2JKTM 4YDNA 5ESVB 5IW3A 3ELAT 3QHDA 2WANA 4N8CH 4NQED 4S0SD 4FULA 1FNEA 1OCOB 4KJYB 3S48A 5ALBH 4D8OA 3ZKSD 1SOQA 5D2LF 4OD3L 3ARBD 2MCG1 1T1ZA 4RHAA 1LHZA 4P4KA 5TF0A 1L9QA 5CJOH 5ELIA 4CMMA 3CCSF 5EZOL 2D2CC 3DTDA 3K6FA 3L5HA 3O8XD 2B9AA 4MNHB 1QFWH 4P57A 5F8RC 8PAZA 3CFCH 2Z92B 4IHOA 3T09A 5IQ9B 2COVD 2E7HA 3RB5A 3WLBA 3ZX1A 1HT6A 4RGNE 3RY4A 4MZIA 3HE7B 1DVTA 2F58L 1AQDB 4RAVB 4BD4A 1GO0A 1SMOA 2EACA 4N0FA 4N0CC 4OLYL 3VXRB 4DZBA 5C2UB 4PRNB 3C6LB 4K8RH 4WW1A 4WY7L 2HVYD 4CC4A 4W4OA 4Y2DB 2DQIH 1QRND 3EJJX 3HZMB 4QY8B 2ZSWA 1I1AB 4OM1H 4BV1A 2XYCA 3IMWA 4WCYH 1OY3B 5L7XL 4O2CB 4Y16D 3EJZC 3V5DB 3CFDA 1W0WA 2EYRA 2UZHA 5A6MA 1AGBB 1XO8A 3HJEA 3OJDA 5FO8B 3SPIA 5LXVA 3F6IA 1A5FH 5E4AA 4MJHA 3NJHA 2CO4A 2UZXB 2R0LL 4XXWC 4MMZC 5TE4H 2DQCH 4GLRH 2NTFA 3FL7A 4IGBC 1QO3B 3Q5TA 5EUOB 3GMLB 5IROA 5FGCB 5K1NA 2YMXL 4CN1A 3HKCB 2GKIA 3ZMEA 3LEYL 3RAJL 3LS5L 5J2UA 2VWEC 3RDTB 5DJ6A 3WO4C 2J6EA 2XBTA 2H8PB 3ARED 1QR4A 5D7SL 4JEGB 5EIIB 5BOPA 1NDTA 3AABA 3MRBA 1SEBB 2VR8A 4M56A 3RZCC 3FUDA 2WWMC 4LVOB 5G55A 5AD0A 1A7OH 1XAKA 4JPVL 2DYPB 2ITEA 3S5LB 4PG2A 1CD0A 1T5KA 4JE4B 3QG7L 4LK4A 4ZUUB 5HYSA 1CD9B 1AG0A 2MNUA 4QYOB 3ZR6A 3QUYA 1BOGB 1N8ZB 1MI5D 4OIAA 2IWEA 2OMWB 4I87A 4PB9L 1EAPA 1COMA 1PKQE 2J1YA 2R23A 3VI3E 1ZA6B 4AQAA 4ZX3A 1JNJA 1G7IB 1N4XL 2NZ9D 5GS1A 3V0JA 4LASH 4I77H 4BDVB 2QBWA 3TJPA 3NACH 1P7KA 4JG0H 3JWNE 4NQCE 2ZSVB 3V0EA 2NOYA 3BDBA 3BFOA 5C8YA 4AYFB 4LCWD 1JG9A 4TUOA 2G0LA 4NO5B 3BQUB 3ZL1A 3LPOA 4P4RA 3AU1A 3DPDA 1UKQA 5GJTH 4MRCA 2ICWA 5I18H 5JW4M 4E5XA 4AIXA 1ONQB 4NJAH 2HWZH 5DRNB 3H9HB 5B1AB 4AM0Q 3M6DA 4E0RB 1JWUB 3MREA 4M9PA 4QHMB 4MYWB 2J1KA 3Q13A 2V7HA 4KKAD 2IGLA 1DVFD 2R2CA 5I73B 3CVHL 3HZKA 5BS0A 5LQBL 2QZQA 1I9IL 1G7QB 3LRMA 1KV3A 4LLVB 3TN0C 5CEZE 4PSRA 1C5DA 3CK0L 3KLHC 5IT9M 4UIKH 1WZKA 3Q7JA 4HIIB 3FU7B 3VI4B 4JK0D 3L5IA 2BOCB 4XBEH 1A3ZA 4KJPD 2IPUK 4KAQL 2DYRB 1T6WA 3UT5A 4K8RC 4YC2B 1BQHB 4AEHH 4YSAA 4ALAL 3VFUB 3EGSA 1D3CA 1ZS8B 2YAMA 4JG1H 1U9KA 3SGEH 2VDLH 3RVUD 1U8KA 2FLBT 1JK8B 3NFNA 3N42F 1JYNA 2FIRT 1Z5LA 2AJZB 2H47C 4YE0A 3VFMB 5ADOL 2ZYSA 5BUPA 5IVZB 3V5KB 2H2PD 3ZE0F 3ZKND 4TZZA 3NIFB 3FUHA 2HKFH 4XO4A 1T1YB 2FNBA 4LARL 4M6ML 5DVNA 4C4UA 3OKLA 4OBRA 3GSNA 1JI1A 4IMLA 2DLHA 3STZB 3WG7B 2VDNH 5AW9B 1BMZA 4Z3HA 5A1AA 1A6UH 2PCXA 5ISZA 2ADFH 2NUTA 3SKOA 3VH8G 3SBQA 4G2AA 1N26A 1CLZL 3JAKB 2FT6A 1FFOB 2AQTA 4NWUH 4OVVA 2ZYHA 1DUYA 4X7TA 5FW6A 4UQBA 1WIPA 2VLJD 1E8YA 2I6RA 3FF7A 2H4EA 4KK9C 4J4PC 1IAII 1YMME 2PYEB 4U6XB 4X9FA 5M94B 4BKLA 4BK5A 2QR0A 2NYYD 3PGFL 4R7DA 3Q5YA 2YPKA 4OFQA 2V5MA 1IUZA 4J7RA 1ADQH 1JZEA 2FCBA 2A6DA 4LB8A 2WALA 5AAMC 2E9JA 4FN0A 4PJGF 3BAXA 3SPHA 2X44D 4EJ1C 4R0LC 5D7JA 4PJ5B 3F84A 4UI2A 3U6RA 1TZ8A 4GH7B 4WIQA 3QJHB 4JE0A 1JXJA 1W0VA 3RWFA 1ZT1B 1AGFA 2HT4C 1H3XA 3CSBA 3EW3B 3NSFA 4RMTA 4V1DB 4M6OH 4XPTL 4BZ1L 1BVOA 2DQTL 3E1ZA 5J06A 2MOQA 1YUKB 1GGBL 3JV6A 2P45B 4G1EA 5GSVA 3D0VB 4UV7H 4X6BA 2GJ6A 5GRVK 5E8DH 3CDCA 4X6EA 1UZGA 5IFHH 1TZIA 2DQFB 4JLRA 4WUUB 2FX8L 1HINL 4JY4A 2ZKHL 5FKPA 4A6YL 1WGVA 1INDL 3TZVD 3LRGA 5E2TH 2Y7SA 3ILQC 4HS3A 4YFLI 2CKBL 3MRFA 2YOAA 3MLWH 2HPTA 1X9LA 1P6WA 4XX1G 2V5RA 4LPVA 1J5OL 2LABA 5J7CC 1VPOH 3GXPA 4WEBL 4OV5B 3W37A 2HJKA 5BZZA 3RRQA 2AJXL 4JFXA 3SB3A 2PP8A 3PL6D 4FOMA 1AO7A 4AZ8A 4WVRA 4ZMYA 2YJQA 3KPQB 4YHZL 3BDYL 2VXTL 3HCVA 1KELL 3M8OL 1L7IL 1XSKA 3HKEB 4ZW3A 4NQXB 5GGQL 4XPBH 1T0PB 3IKKA 3UEQA 4AEEA 4EI5B 5AZEL 2JI2A 2X53A 2GSIB 3V6OE 4XC1H 3DPBB 4B5ZA 1N59A 4JL1A 5EBMB 2GHWB 3DX3A 3LHPH 3MBED 4P59H 3DTXB 2NMUA 4XBGA 5JNYA 3HC3L 4M62H 3ZDWA 5HY9B 4U0QB 5JZ7C 2R69L 4N26A 5ACMA 5DEGA 1DN2A 5GS0D 3AQZA 3V7QA 4YHOL 1NAMH 4EN3C 1TCRB 5HDBE 4CMHB 5K59E 1BXXA 5EUOF 1K73H 1IM9A 4XCCL 2HKHL 4NRZA 3EYUL 5I8OL 5E8OB 3IF1A 5TQ2H 5CZRA 3TYFA 4I9WE 3BWUF 4WHTB 2C34A 1QVOA 2BMKB 5IHWA 4BHUI 1BVKA 1FV1A 4PJ7E 4YFEA 2F19H 3RWDB 4NNPL 1KEGL 4TUKL 1OWRM 4B96A 1OPGH 3EH5B 2GJZB 3ISYA 1FZJA 4PFEA 4JFOA 1OALA 4YFDB 4DGYL 5BO1L 5LYJA 4UZUA 2I9TA 4H20L 4HA1A 3HRZB 4L3EB 2OQJA 5I0ZA 5BV7B 1U3ZA 4XMKH 5BVJA 2ZOKA 1LNUB 4NUGL 2Q87A 4AM0B 4AG4L 2FUTA 1MY5A 1FUNA 1ND0B 2WO2B 1L5GA 2X4QA 4BSVA 1NQBA 2QLYA 4OM0L 2JSFA 5FO2A 1MAMH 4PBWD 4RAHA 4CSTA 4AMXA 1HI6A 4P2OC 4M3JA 4XTRD 4HUUB 3ESOA 3VFSB 2GFBB 3EFDL 1MJ8H 3UH8A 5JOPD 3P0VH 2FATL 3SN6N 4S1RL 4ABVA 1N0XL 4P0DA 1EBPA 1RK0B 4AIZB 2P8LB 2JKRM 2P1YA 4QRRB 2ZUQC 5LCVA 1BQLL 1Z9MA 3QT2A 5DD6A 4LDLB 1HHJB 5IYZB 4GXUN 4PRAA 2A6JA 5CSZB 4JFQB 5C0AD 1ADWA 2GC4C 3AMKA 4KKBD 3MZGB 3QARA 4EMZA 1JD1A 2ZVYA 3MRQA 2VT0A 3QJUB 2OSLA 2NXZB 1OM9A 2VZTA 2VWEE 2PLTA 1QPXA 1I8AA 3FRUA 4HJSA 1BFVL 2G5UA 2ZE0A 4HKZA 1SHWA 2XICA 1G5AA 2P8MA 1I8UA 1T83A 4UT6H 4KTDH 4WU5A 5L2KE 3VXUE 1YYML 4JO1L 3H42H 3HB3C 4GQ9H 4HJ1A 4FQQA 1RZKH 1KXVC 3BUQA 2Q0ZX 3GMPB 3IVKA 3I6SA 5IF0A 1TJIH 1Z3GH 2AAVA 4YDVA 3U7WL 2O6CA 2VR4A 2X09A 3N1FC 5IB2A 3IU4H 5GONB 3BPNC 4OKVA 3UTTA 5E2UH 1Z1WA 1UXWB 2FB4L 3FT1A 3IRCA 3MJ9L 4FLRA 4H8VA 3VFNB 2VZVA 4KZEL 4Z7QF 3C5ZB 2VDRH 3HNVH 4URTB 4Y4KC 4I0PA 5C86A 1IX2A 4Q9QH 3L3OB 3VWKB 4GG6F 2XWXA 3KYOB 2AFNA 5LCVL 5FXCH 1D5RA 4JMXA 4PJ8A 4OLEA 4BH7B 5HXUA 4DT2A 1CGSH 3D48R 4GW1A 4GQRA 4HAFA 2EXSA 2XWTA 4RNRB 1MREH 4JMNA 4L2LA 4WFED 1Y18A 5D71H 4K23H 3DVNA 4G4ZA 4MS8D 1YECL 5DUPL 5F0LB 1BVLB 4LL4A 3T0DA 3O6LL 4F3FB 4UIMB 2F08A 3QHZL 5CSGA 5D1QA 4L8BB 3D87B 3UADA 1D5MB 3QUKA 3WXWL 4KO9A 4YDLB 3A67L 3QWRD 2HRLA 3FDWA 4AXWA 4QRFA 2XQBL 3VSVA 1RJZB 3B9KA 4L9LB 4NZDA 1DCEA 5FYJL 1F1DA 4AJWA 5BW7C 3JV0A 4K3EL 4I55A 5IT2L 1I8LA 4QJ4B 1VACB 3CXDL 3FTGA 2J1XA 4YUEL 4Z78A 2B9BA 5BMVA 3T0EA 3CD4A 4U7MA 4Y9FA 3LNEA 5FCUH 3FW6A 4JR9H 4R8WH 4X8JA 3IETA 3X11A 4X6CA 5IROD 3GQFA 3K80A 2O6EA 2VDQL 4OW6A 4H25B 5DHVB 5EDSA 4HMDA 5AZ2H 3UGUA 2PN5A 1KPRB 1UT1A 1T04B 3D4CA 3H1ZA 2GTWB 1U42A 3ZYJA 4G4YA 2NY6C 4Z76B 3GSRB 1DQJA 3RYFA 5JO5B 4PGBB 4WW2B 4AL8L 4DKEH 1MRDH 2VLRE 5LUMA 3AG2B 2VXUH 2JKWA 3L6FA 5HYJA 3N3EA 1S78D 1WBZB 5IV2A 4PBDA 1IL1B 2B7DT 2KPWA 3HZ3A 3LH9A 4LSSH 4MJ5A 4QGTA 4ZMQA 3O9WA 1IZKA 4PY8J 2HG5B 4I5BB 4HSAC 1FE8L 2IGFH 1T7WA 2YRZA 2WZAA 4TN9A 4YHNA 4ZDHA 4EKJA 3BKML 4YPGA 4YDMA 2IBGA 5AENA 3QUYD 4OCYH 4O02A 2DIAA 5C09B 3OF6D 4J3TA 4F58L 1QHPA 5IZ7A 1F56A 4HHAB 3I6GA 3T80A 1KTBA 2A4EA 4JJ5A 3IMUA 1EFXD 5F9WC 3N1MC 2C3VB 4DQOL 1G6RH 1QYGH 1PZ5B 4JFTA 2EUZA 2ADGA 5A16A 3TF7C 1FBIH 1IGTA 1WG3A 4FEMA 3OXSA 4MXVE 4MSWA 5ETUB 4Z7NB 2J2ZB 1RZKC 1M7XA 5DSCB 2LU7A 4NZTH 4H1LH 1MUJB 4OQ1A 5J3HC 1U2YA 1I9RL 5E51A 1OGAD 1T1WB 1IEAA 2V4LA 1KPUA 4I89A 4WTXA 1ZHNB 4HALA 4UMSA 1RFDH 3WS3B 4ZTOL 5AG8A 1OF2A 1P9MA 1HSAB 4IRJC 1S3RA 4FFVC 4HPYH 3TGXA 1XR9A 1EDYA 5EOTB 1EGJL 3S96A 2CHNA 3DTUB 3RVWC 4L0PB 5BS0D 2MJWA 1S9XB 2VERA 3ATEA 1EMTH 1IC5L 5ACZA 1OAKL 3EYFA 3MUY1 1HKFA 1I82A 2W65A 4NM4H 3DIDA 3QUXD 1FA4A 2Q1XA 4XPFH 4FHBD 2E59A 3GO1L 1ZE3H 3NA9H 1K4CB 4X6FB 1O9WA 3BE1H 3DRQB 4NAQA 4YHIB 1NCCH 3CFNA 1BIHA 4PLKD 1J1PH 3V2AR 1W5EA 3RTQB 3B5TA 4GAJH 4XODA 1OL0A 5IOKA 2XPGA 1XSJA 4U39A 3HLKA 3ALPA 3US0A 5EIVA 2R2EB 4Z7VF 4NQVB 2Y1YA 3B7RL 3REWB 1MRCL 1BDYA 3BIKB 5EIBD 5LNEA 1OK0A 4IU3A 4IEFA 4AH2A 1AQKH 1BQSA 4FJYA 1D2PA 1X5HA 4JO2L 3TPUA 5JR1H 1CXHA 4XWGH 2XYBA 3C2AL 5J6HB 3FN0L 2R2HA 2WQAA 1HNGA 4EZJA 5L4JA 2CBQA 1KGXA 2CIKA 5CN3A 1ZLSH 3ZSSA 4G8EA 3QCVL 2D03L 3L4ZA 2CO6A 1F11B 5BRZA 4MA3A 4R96B 1EXUB 3L3KB 1FHGA 4K3JL 5FYJE 3IS0X 4YWGL 4ODVH 1TYEB 2MQCA 3IB4A 2JQMA 1UCBH 3L5WA 3L9RA 5F7LB 3QFDA 3N2GB 2JNBA 1LO0H 1REIA 3T4AA 1KBWA 2FX9L 5C70A 2B20A 3ON1A 1L7TL 4OFDA 3WIIH 1CZ8H 3QHTC 3TO4C 3RYCA 4P2RD 1CL7H 2EDKA 3DX2A 4ZW6A 2UYLB 1S7WB 2UY7A 3A21A 5CEYA 1IV1A 3NG5A 4IHJB 1JRHL 1QSZA 1ZLUH 1MG2C 4BSJA 5ITBH 4U1NA 2B39A 4RWYL 2BXYA 3GTTA 1FL6A 3V4UL 1M6OA 4HWBA 2HX8A 4FNTA 2A73B 2LAGB 3TFKC 3NESA 4GT0A 2ROYA 4GRLB 3LN5B 2OZ4H 2GJ6D 1RSFA 1T0KB 2FAUA 3EOBA 4RFNB 2YXFA 4RLDA 2UYJA 4LQFL 1T5WB 5ICUA 3DRTB 1DDHA 1FZMB 4DP4X 1P1ZB 5HY2A 3GMNB 3OMNB 2HFFA 1HIML 3HR5A 2CH8A 2OI9C 3PABB 4HKBA 4GBXA 5AVVB 4QRQA 1FH2A 1DP0A 1QA9A 1KLGB 1WFTA 2IEPA 4FQIL 4IU2B 4N6QA 4YSEA 3RGVB 2RALA 4UT7L 4R3SB 2WC7A 3VRIA 3CSYA 4L8CA 3SE6A 5I1IH 3FF8A 3BGFB 4I88A 5F7FA 4HCRH 3PXLA 1FFXB 3ZIYA 1Y1DA 2VERN 5HYQB 2AKRB 2ORBL 3NQIA 4F1ZA 2NY4D 3QEGH 3QG6A 1NCOA 1EDQA 3H4FA 1HHKB 1NCAH 2C9PA 4OCWH 3F7LA 1HKLH 2JFCA 5FX3A 2WXHA 4QLRA 3P2BA 1K8DB 1I8KA 1HAUA 3MFGB 2V6HA 5F7DA 3S35L 2HT2D 5DCVA 3SIVA 4HWBL 1E27A 1ZE3C 5EZIH 2J5WA 2VSCA 5DRZA 1PZ2A 1GHFL 2RTTA 2EXYD 2EXWC 5EZLB 3VXSE 2DL9A 3FFCD 4UAHA 1IM9D 1MNUL 5EU6E 5F7UA 1EHLL 2R1YB 2YGQA 1O9ZA 5IREA 4F7MB 1SVCP 4PJFB 2CD0A 2BNRE 2HFGH 2YQ3A 4BK8A 5I9QB 2L7QA 5CCHE 3S36H 3VX0A 2JTDA 4FABL 1XCQB 2DB8A 4O2AB 1CIDA 3WD5L 2IADB 4N5ED 2EIEA 3WFHA 4HNAB 4FZEH 4CL7A 3NA4A 4PV8B 4ONFH 5HWEA 1KNKA 3QE5A 3AM8A 5A43C 4MMYA 3DV4A 4JO4L 1UM5H 4WAFA 5GGTH 5CD3A 4P2QD 4OJAA 1MW1A 1PJ9A 2C7FA 5ICZA 2J56A 1HOEA 3JV5A 3D30A 1I3UA 1P7QB 2JK5B 4FQ1L 4ZO6A 1U3PA 1A6AA 1PD6A 5FHBH 5JIPA 2Z8RA 5IM7B 3FRPA 3GSOA 4M43H 4UUJB 3VM7A 3CYQA 5JHLA 1NIDA 4W9LC 2X4SB 3V52L 4PGCB 1SLUA 3WMSA 1VZHA 4N8UA 4AVJA 1RLUA 4XXDA 5C0RL 1TQUA 4NQDE 4F2MB 3C6SA 1OCZB 2WBXA 3R0MA 3QDJE 5IQ7L 2YOCA 2IO5A 3QPQC 3KWWB 3Q48A 3OMAB 4HUMB 3V4LA 5T5FH 5D7KE 4PTTA 2AEPH 1T22A 4DGVL 2FHCA 4WNQB 2JCCA 3DIVA 3IEWA 4Z7NF 2E27H 2GK0A 1CN4A 3O41A 4R84A 1RUPH 1SUHA 1X3DA 1V3JA 2WWKT 3L95B 2CLVB 2GUOB 4B6ZA 4EI7A 4AX3A 1I1RA 5E6IA 1TJMA 4YLQT 5C07E 2ODHA 3VXTA 3C5SB 3IDIA 4DVBA 5I66A 1OSPL 1NTDA 4PJDA 5DMKB 4YLCA 3NTCH 5EU4B 2DJSA 1BM3H 1TVHB 4UU9B 4FFWC 4QHLA 3B56A 1XGYH 2O26U 2OMYB 3K2MC 4DKFH 3H9SE 4L8SA 2HVJB 1BZ8A 3AZUA 4KTEL 4N2GA 4CGUB 5D2LA 1NICA 3LCYA 5I75B 1BECA 4HJJH 4M6AA 2QPDB 3QDMD 4D9RD 3F5WB 4C57C 2NLJB 4QHPA 2TRYA 4X5WB 1FFNA 2WQRA 5D1ZI 2J1ZA 4Y16C 1WEJH 2ZX9A 2BFGA 3BXNB 3IMSA 5DQDL 4PJ9A 5CXPA 5FB8A 1QLRB 3MV9A 3A47A 2H8CA 1TNMA 3MUHL 2WOYA 4K3HA 3L81A 1FNGB 3QZLA 4NHCH 3VDBA 2DTML 4D8PA 2IF7A 4YVUA 1QD9A 3IKCA 2W0LA 4QJ3B 3ZTJG 2X9ZA 5EBGA 1OAZL 4GUOA 1Q9LA 4TSCH 3ARDD 1JHTB 4J3BA 4H8PA 2N56A 1LJMA 1O6VA 1BHGA 2GJRA 2VN3A 4WFHD 1IC4L 2O5XH 2AJSL 3T77B 1MAJA 3TIEB 1I7UB 5D1QD 3G6AA 1E4KA 3I02A 5HDLA 1WS7A 4UOW1 1P2CA 1Q1JL 2OSXA 1E7VA 2AVGA 3A4DA 4PIRF 4F33B 3X1EA 1VH8A 1CN7A 4XRCB 5FF6A 5JXAL 5G4NA 4ZFZA 1UCTA 3VGAB 1SY6H 5LXTA 2CHDA 3WENA 4XVTH 1A7QH 3NPSC 4FXKA 4ILDA 3OR6B 4Z0BL 1IC0A 3DLQR 4ZOCA 2XVKA 1JJUA 4AJYV 4GXFA 1CWVA 3DSNB 1PIFA 2C26A 1BQ5A 3KNBB 3NIGE 4M5TA 4U1HB 1FC1A 4MTMA 1KTDA 1QSEA 1XD1A 1PEZA 2G9KA 2H0PA 1LK3L 1PMYA 4FG4A 4AGPA 1XF5A 1H3PH 3IEAA 4Q6KA 5DD3H 2DIBA 3DUHA 3QDGE 4Y4HA 5J12B 5ABDE 3L1OH 4OZFG 3FYEB 5F7KC 2WNWA 1UB6B 2X4OA 5C0BD 3RKPA 1RD6A 4BE5A 5I6PA 5D1XE 3WTUA 4LHUG 1NGYA 5F7NC 4FDWA 2LLLA 3QUZD 3T04D 3D3VE 5AW3B 3HJWC 4R2GB 1GR7A 2W9EL 2LGNA 2R7EA 5A3ID 1FRGL 3QZWA 3RNKB 4PRIA 3MLTA 4LCCB 1SQ2N 4BFGA 1A6WH 5A2FA 2IPKB 5HYJD 5TDPB 1GAFH 2EH7H 2QKIA 1RIVL 1NKRA 3DDNA 3B7SA 3ROLA 3U1SH 1DBML 3OAYH 5ESQB 4HH9A 3PDOB 2A74B 4IIQA 2V9TA 3WKML 2ZCHL 4DW2H 4JDZA 1M9SA 1HL5A 2V17H 4DEPB 1FO0A 3SJVB 2KZ1B 3H7BB 3BQVA 2WZ0A 2ZXBA 5FA4B 2RH0A 4GSDH 3S3SA 1AJ7L 2L04A 4CC0A 3SE8L 1MY7A 4M5ZH 4KNUA 2YUVA 3ARFB 4XCYA 1H6EA 2Y06H 4XE0A 2HS3A 3EOYG 2PYFA 1VCAA 2OULB 2YFNA 4NXKA 4PRPB 3MCLL 5K93A 3U79A 5ID1A 3VSUA 3T0BA 2XWEA 5HI5C 2V2XA 5J89A 5IR1B 1GOHA 2ESVE 3CDZB 1GIGL 1NFIB 1X4YA 2BVTA 3KEDA 1TR7A 4HMCA 1FIGH 3TM6A 4R97B 5E1HB 2EJ1A 4PJXB 5K1VA 4PJFF 3ZKNC 1Q9OA 3TTYA 5E4OA 3LMJL 4JFEA 3RYMA 4X42A 3FHQA 4ONHA 4YN3A 3U36A 4BQ8A 4U1MB 3Q06A 1UT9A 1AKJA 3LXCA 4MMXC 4ORGB 2ZF8A 1G6VK 3NBNA 2IDTA 4TSAL 5H35B 3T08A 3W39A 3RIAK 3WNNA 3H2PA 1E5BA 3U48A 2BNQE 3D7PA 3WIAA 5SWSE 4K5PA 1T1XB 6PCYA 4LLAA 2Y5TA 4CNIA 4I0KA 3A4AA 3JWNG 1DBKH 3TBWB 3BZ5A 4G70B 2EVGA 5IB4B 1PF5A 2VC2B 2VKWA 5JHDD 2NPLX 1E4JA 2NY1D 3VOBA 3PWVB 1XTLA 1E2WA 2R4RH 2AK4A 4Q2ZB 2NYYC 2A83B 1QQDA 2P5WE 3SKMA 2VDPB 1CS6A 3T4YA 4QIRA 4E68A 1JFFA 1KIRA 1R3LA 1SXBA 4PWIA 3PP3K 4YVNA 1M1XA 3UBFA 2X12A 1FC2D 1LO3L 1MFEL 1P5UC 3WJJA 5F3BB 3MLZL 3AWFA 4KI5F 3BVXA 1SDAB 3NMEA 4OD3H 5LP6A 4F7PB 2BC4B 4PYGA 1ZVNA 2JLPA 3HC0A 3KH4A 3LH8A 1KPVA 3Q8BA 3BAJA 4HIHB 1Z9LA 4PY7B 5EZOH 4L29A 2R9HD 2FR4A 3QXWA 2MCPH 4BFJA 2GBAA 2N7AA 4PGDB 1S7RA 4FD0A 1I7RA 3ERNA 1QSFD 1SYSA 1MFBL 2YN3A 2F58H 4NM8L 1N8OE 2PMZA 3VMPA 3ARVA 3R7QA 3J7HA 4OLYH 2OMNA 5JUEL 3HI5H 5GSRA 4XNQB 4P46B 4OI7A 4JBSA 2XWZA 2XDHA 2LE9A 3EKCA 5ESVA 2JB6B 4LSPH 5I5JA 1JNLH 2W0PA 3FUFA 5MP6H 3QIWB 4Q9BA 3RI5F 2XHNA 4L3CB 1IIKA 4JFDE 4XNXH 3E8UL 2R56H 4KJYA 2O6FA 1U36A 3PL6C 3T6VA 4DTGL 2G75B 3GRGA 5IVXE 3FU5A 5T1LB 3HC4H 3VA6A 5F0JB 5DVMA 1QZ1A 2Q8BL 4MNHA 3MOAH 4N1CA 4GSQA 4G8FB 2Z92A 5CEXB 3UJTL 43C9B 1KCSH 3MBEC 3HE7A 7FABH 1AQDA 4RAVA 2ZWYA 3VXRA 2YRLA 4PRNA 3C6LA 1RHFA 2GITB 5H37A 4Z7AA 1EZVX 5CCKH 4Y2DA 5EF3A 2EDNA 5CJXC 2EAEA 1DT9A 1HQRB 5CLXA 4QY8A 5CF3A 1I1AA 4N0YL 4KX7A 4XOAA 1DQLL 1DANU 3ABLB 4O2CA 1MCDA 3V5DA 2FWLB 2R8SH 5EEUA 4GEIA 1I31A 3ZZ1A 1NLBH 2X6AA 5AOKA 5FO8A 4ACTA 2ZWNA 4BQ6A 4NQEE 3P9LB 5CFHA 2NX5D 2UZXA 3OZLA 1IE4A 4GFXA 4ANWA 3RVVC 1QO3A 1ZA3B 5GRXG 5IJDC 4OFKA 5EUOA 3GMLA 2QPFA 2PR4L 2C8NA 3HKCA 5IMLB 5AALA 5KUKA 1AIZA 4LP4A 3RDTA 2J5LB 3WFDH 4Y9BA 4XWOD 2H8PA 2FD6L 2A2QT 5EIIA 3FUNA 4WU7A 5C0EB 4MJID 4QRPB 2DM4A 4TVSa 1AOZA 4BVTA 1IQDB 5J11C 3GB7B 3BP6B 2GEEA 4MRBA 2RR3A 3WNLA 3QO0B 4MB5A 4JN1H 3W81A 2J6EH 1RXLA 3H53A 5HI4C 4XTRC 1NUNB 1QRNE 3RZWA 3BP4B 1GYAA 2DYPA 1RUKH 2H1XA 3VXMD 4MB1A 4HCIA 4IBQA 4ZUUA 1K4DB 2E9BA 2MH4A 4QYOA 5D1ZB 3HG5A 3M07A 1BOGA 4WSGA 4I1NB 3AS2A 1N8ZA 1C7TA 3B9EA 4UQ2B 4PREB 1HZKA 3HUJE 1YC8A 2WSKA 1I9IH 3WHXB 2EZ0D 2OMWA 1BQUA 1ITBB 4U05A 4QNPF 4NJ9L 3U0PB 1ZA6A 1W8EA 1G7IA 1YY9D 2BW4A 3D01A 5KSUB 1FLTX 4BDVA 3D12B 4PJHE 2ZSVA 3N40P 3UYPA 3RUGB 1KSRA 1VGEL 4AYFA 1PX8A 2NNFA 1ORQB 2WW8A 2FO8A 4FL4C 4NO5A 1Z0MA 3BQUA 3PP4L 3TVMB 2XJLA 3Q43A 4Z3FA 4ALAH 4D3CH 5IWLA 1MWAB 4LPCA 5HGDA 5EB1B 3VOAA 3L3GB 1FGVL 4N87A 2X0UA 3VQ2C 1NEZB 1OK8A 1ONQA 3F0DA 4RSVA 4X3LA 4N68A 5DRNA 4E0RA 3H9HA 4JB9L 2AQ1A 1JWUA 3BKJL 1E8ZA 4QHMA 4TQIA 1FAIL 5LLIC 1F4XL 4K3DL 4ZJ9A 1XX9C 3G6JE 1NUDA 4KV5F 1UA3A 2FGYA 3O0RL 1M90H 3MV8D 3K46A 1BG9A 5EN3A 1G7QA 4LARH 3ZRCC 5AAPA 2FSDA 5KANG 1W15A 4LLVA 4YXKH 2MKLC 3KPSB 3AQXA 2DWTA 4KKNA 1CDBA 2FLRT 4HIIA 4OGYH 3FU7A 4PWFA 3VI4A 4F91B 1EO8L 2BOCA 4P4KC 2WAHA 1A4BA 3EFOA 3V6FB 2IBZX 2AI0H 1NH6A 5C71A 2A77L 4PJXF 4ONOA 2X89A 3JVFC 1BQHA 3ZDYE 3FTSA 3DC0A 2CPCA 3VFUA 1N70A 1SXZA 1CTOA 1ZS8A 1PAZA 4LCWE 3DI3B 4OCLC 3ARXA 1U8MA 2JJSA 3LQAL 4KNTA 2XX1A 2CMRH 3L7FB 1JK8A 4J3WA 3ULUF 3BGMB 1ZOXA 4CC4C 2AJZA 3VFMA 4W4OC 3WNPA 2D7PA 5EZJB 1SF3A 2Y1VA 3CFUA 1ZGLB 5DS2A 1GC1H 3V5KA 3LRSB 4PS7A 2DMGA 4MB3A 4F2EA 3WXMB 1T1YA 4ETQB 3VD2A 1QR1B 3ESNA 4HZLB 4N25A 3CMOL 4LSTL 3UTZB 1CLYL 1RA4A 3UG4A 3P3TA 3STZA 4IRSB 3IJ7A 3QJSB 2BTQB 3MV9D 3SY0B 1O6TA 4TTDC 3IDNB 4XNMB 5TF1L 4JANB 1MIEL 5MHSD 2C9XA 2VXQA 2YD7A 3JAKA 1B6DA 4HQQL 1FFOA 2Z6FA 4R5VA 2WQ8A 3GSNH 5IROC 3TV8A 1WT5A 3N4ZA 1H0DB 2Z34A 4OGXH 2AQRA 2BXZA 2PYEA 4U6XA 1SBSL 1KCUH 2IQ9L 5KN5B 3KM1A 4U6VH 3QAZC 2EEXA 1MKFA 1KFAL 1N7MH 3EOTL 3QULB 2WBJB 4XBPB 3UERA 1J5OH 2TAAA 4N0RA 4XMPH 4WEBH 3VACA 1KT2A 1ZIBA 4XNAA 3DMMD 3SBRA 3VB9A 4YHZH 3WEMA 1SJXA 2QPEB 3QJHA 5IY5B 3WGMA 1VERA 5AVQB 4EOWL 1ZT1A 1Y6NR 2EDYA 4V1DA 1OCWH 5CR1A 4HGMA 4PG2C 5AZEH 1HTYA 3K1KC 3PAFA 2XFGB 4OU3A 2PXYA 2H32A 1YHQF 3QUYC 1ORSB 2DQFA 2WXGA 2ZX8A 1TLKA 4WUUA 4XE5B 1AD0A 1OKEA 4K5NA 4UDUB 1QSED 5AW8B 1R19A 4GI6A 5DFAA 5EFIB 5FA3B 2Y9RT 3QNZB 1X5FA 2CJUL 5DYFA 2VLJE 5GS1C 3H7LA 5I8OH 4AQZA 1YC7A 2MIZA 1EJOL 4OV5A 2F2HA 3IFLL 3UC2A 2X6UA 2YAHA 1WGOA 5HY0A 2PWEA 2UV3A 3MLRL 3KPQA 3HR6A 1KCKA 3HMXL 1DQVA 4JRWA 1R47A 4KU1A 4PRHB 5EN2B 3L9BA 4GY4A 1ZLWH 4OSUL 3HKEA 3WDHA 3QYCA 4NSKB 4NQXA 1G9ML 4X80H 4EI5A 2GSIA 1D6EB 2QPUA 2N1KA 3DPBA 4XR8C 4LXFA 5EBMA 5D2NE 1U30A 3DTXA 1M9WA 2KG4A 1AMXA 2IH3B 3DUUB 2W80C 1KFGA 5B7MA 5HY9A 5C7XL 2XV0A 3K1DA 4HKJB 3SGDH 3MLPA 4O58L 4DPRA 1BWWA 1JNNH 4ZAKB 1TZOA 5JH7A 2VQ1B 1KBKA 4RMBA 4DN4L 1TCRA 2QV2A 3QUXC 3L4TA 4LDCA 5I1DB 1U8JB 2CO1A 1ZTXE 3ZRFC 4WWKD 2MOGA 2VXVH 1KCWA 1EZLA 1ED3A 5E8OA 4BJLA 4WHTA 2GBTA 2HXAA 2BMKA 2OYLA 1E6OH 4OZHF 4KJQD 4C8IA 3VGHA 3W2DH 2QQKL 5E00B 3EFDH 3JXAA 4C59B 1GC1C 5I1CH 4S1RH 3GYQA 3OKOB 5KX5B 3IBEA 4O2EB 2A9ML 1QVGF 1FVCB 3GMRB 5FYKH 1IBZA 3EOAB 1GVIA 2GJZA 4ZQTA 4HBQA 1UOLA 5B39B 2BVOB 4RGOL 4J6RH 2UX7A 5KYYB 3FKUS 3QQ4B 1RUML 2OJEB 3HRZA 4L3EA 2RA1A 1MDAA 1NUGA 5HHMD 1LNUA 1IBHA 2AEIT 4AM0A 2NXYC 4GNKB 4QRSB 4TSBH 2VDOL 1H3GA 1ND0A 3IN2A 4H0LC 4JKMA 3QUMB 1HEZB 3PU7A 3QXAB 1F1GA 3NUKA 5EWIH 3RFRA 2XQYG 2BHUA 4OAWB 2M26A 4ANUA 4CBZA 3IDYC 1LP9F 1YYMH 3KPRB 3EG9B 2IQAA 3VFSA 1NLDL 2GFBA 5E99H 3NCYP 2X05A 7PAZA 1O7DC 4LIQH 5DT1L 4BK5C 1TZAA 2AK4D 5KTEH 1RK0A 4AIZA 2P8LA 3F6MA 4QRRA 5KSAD 3QEHB 1A4KB 4JPWH 1SMDA 4GRWH 3DYMA 1BW8A 4NGHL 4DRXB 2NT0A 3T3PB 3CUPB 1JSYA 2WXLA 3UJJH 2FB4H 3QI9B 1HHJA 3O2WL 5IYZA 1AZUA 2AJUH 3MODH 2Q1EA 3L1GA 5CSZA 4JFQA 5D7JC 4F7KA 4JRXD 3UZEA 3LZQA 4DAGL 3DROB 4AV4A 1CDHA 3EF4A 5EG6C 5LCVH 4NC2B 2A4CA 2L7UA 4CDHA 1MZZA 1RMFL 4A04A 5JYLA 1UXLA 2ZXGA 4KQ3L 4KC3B 1MELA 3MRPB 3TBTB 5L0QC 1PAMA 2ZT9C 3CZUB 5HI3D 4I4WB 3W0WD 5EC2B 1X5LA 2LU5A 1C5CH 1A6ZB 5GANK 1OTTD 4S1QL 4NO0B 1ZK9A 4X99B 3O6LH 4LFHG 4NZUL 3FT9A 2XN1A 1TEYA 3QYNA 3AY4A 4RRPA 1YNKL 1L9OA 3GMPA 4C58B 3ZHNA 3CHRA 1WIOA 1NMBH 1U8IB 2X3BA 4U7SA 4XNZC 2XQBH 4KXDA 4L8DB 5FUZL 4WGKA 2HG0A 5GONA 2ZAGA 1HE7A 5JOPE 3KPPB 1W5BA 1WFOA 1ODAA 1CFVL 5KW9L 1UXWA 3VFNA 1HYSC 1HH9A 1NWOA 4DP2X 4JHWL 5H94B 2EDTA 2P5EB 4YR6B 3CXDH 5E95B 4ETYA 1TQTA 3L3OA 1G94A 3AGVA 3VWKA 3KYOA 3KL5A 4BH7A 1IV2A 4OF3A 3CN0A 4Y4FB 1HJCA 2VW7A 5C0AE 2VITB 4RNRA 3JCMM 4Y2OB 4YX2L 2KGWA 4JQVA 4QGYA 4LSVH 2YAQA 1WBXB 5F1NB 4GO8A 2WZPA 4ZNCD 4JHAH 5KOVC 1PTZA 2NYKA 4M00A 1QW9A 1BVLA 3QS3A 4XNYL 3GBEA 4F3FA 4UIMA 1IE5A 2YZ8A 4L8BA 5DWPA 1NC2A 4U7KA 4A2HA 1MVUB 4OI9A 3H3PL 2W94A 3TEYA 2ICES 1P6FA 4M5SA 1UQSB 1I1AD 4XPAH 4L9LA 1CB4A 2G2RA 2VLKE 5D7IE 4JRYD 2WPGA 3NMUC 4TV9B 2RBLA 4PS4L 4ZW7A 2XTJB 1VACA 1V3MA 4F5CE 1FE8H 3ZZSA 2Y7MA 2DMCA 1B0IA 2VN6A 1F13A 1RU9H 1OW0C 3GI8L 4ZMZA 1EHNA 4ZS7L 1YPZE 1U58B 3O2VH 4F58H 5D7LD 2XIDA 3U4KA 4OZGB 4H25A 4I3SH 4X98B 5E8EB 5IJCC 1KPRA 3RY6A 1T04A 4N0UB 3S9DB 2GTWA 4GSXA 4ODWB 3FT4A 4WFEE 2WVUA 1HEHC 1ZANH 2V9RA 4DWHA 1KLUB 1E90A 2HLEB 3PHQB 4FP8H 4PGBA 4WW2A 5KOMC 5JO5A 1HZLA 3O6ML 4OBSA 3MFFB 3SDXB 3GEWB 3IR9A 1WBZA 1RHHB 3SZKC 1IL1A 3ORJA 3NZ8B 2AZUA 5TE7H 4K5MA 4YHMH 4C47A 2NMSA 2HG5A 4I5BA 2XV2A 4KKLD 1EVTC 4FJ6A 2AV1B 4X20A 3HNSL 5LXGL 1IVTA 4ZTEA 2CLRA 3FXIC 2OTMA 35C8L 3KXFD 4K7FB 2Q2EB 2CSPA 5JW4Q 3QAQA 1KTLB 2I32A 1TO5A 4HHAA 1E4HA 1OAKH 2YBRB 1YG9A 4QLWA 1JPSL 1VK3A 3VCLB 3FPIA 1FSKB 2C3VA 1UJTA 4E41A 4XP6L 1PZ5A 4UTCA 5D55A 4O02H 5AKSA 4HV8B 1TUPA 2XN9A 5BJTB 3FB7B 5CILL 1BX2B 3LZOA 4ELDA 2FGWH 2X87A 4M1CD 2J2ZA 3KCPB 1JMZA 1LD9B 1UJ3B 1MUJA 3CN1A 2FBJL 1I9JL 2VUYA 4HP5A 1ETZB 1S7UB 1T1WA 1T83C 3ELQA 4ZFOB 4XP1L 4ODTL 4X20B 4PPTA 3GHZA 1ZHNA 3RU8L 1AP2B 2DJ4A 3WS3A 3L17A 2NY2C 1HSAA 3QQDB 1SQMA 5EOTA 3OM3B 3ESMA 5EEZA 1S9XA 1T0MB 1WV7T 2BIPA 2YJLA 4RH4A 2WUBL 2JI1A 4UQDA 1KJ3H 4G7QB 1L9MA 4I8DA 4FQLL 4JFUA 3CG8A 1L6ZA 3QORB 5KYNA 4I0PC 4X6FA 1K4CA 1WHPA 1MDTA 1BQRA 5FM5O 1MG3C 3DRQA 3A6OA 1A14L 3M7FB 3NDZE 1ZTMA 4YHIA 4CAGA 5E2VL 1VFUA 5G5DB 4GIAA 1CFQB 2ZX6A 3MX0A 5FUOH 1H9DA 2P7TB 1MFAL 2R2EA 4KO6A 4NQVA 5IBTL 5K33A 3O6FD 1XR8B 4GO9A 4KK8C 4DH2A 4FQJL 4OD2B 1RQ5A 3REWA 3S3JA 4TV8B 1OLZA 4TQPA 1FGNH 4F37F 3HN3A 1W57A 3BIKA 1SNRA 2FJHB 4XP5H 5D1QC 5INDA 1PDKB 2VDMB 3SPVB 1OGAE 1JDCA 2EDJA 2NRDA 1D7FA 4RSYA 3U83A 3PGDB 3AB0C 4RIRB 3EXLA 3CBRA 1IGIL 1IAKB 1MFNA 3LJ3A 5J6HA 5L88L 3B9KC 3T6QC 4JFFA 4PJEF 4P5SA 1FFQA 4KQ0A 2BINA 4X9HA 3DGGB 3B7UX 4XCEB 3HBPA 1I8LC 2ZCLL 2D7TL 1V7NL 5BS0E 3G5ZA 1F11A 4A7UA 2DZEA 1L0YA 3N40F 4R96A 1EXUA 4UYQA 5E4EB 3T3PF 3CPQA 5HGHB 1ZXQA 4QXWA 4LVNB 4HBCH 1BAFL 4JVWA 3OLIA 5C0JB 3N2GA 3K8MA 2NY7L 1E3ZA 2CU9A 3UDWA 2PYED 4UBDD 1KC5L 2QPSA 3ME0A 4JFYA 4ERSH 3NP3A 1X5AA 1YN6B 1SFDA 1OAUL 1XRGA 4QTIL 4BHUA 2UYLA 1S7WA 3S34H 3QUZC 3PHAA 4QAMB 1NCJA 4YBLB 3ZDZE 5DUJA 5EA0H 4IJTA 4Y1AB 4IHJA 1FNFA 3VXPB 1E9OB 1GOFA 3ULSB 4DFHA 3RWJB 4F1SA 1SF5A 3O2DL 2Q6WB 3BESR 4J1UB 4M1GL 1NSNH 4TULL 4NS0A 1N67A 2XZQL 4LCYA 1QZNA 3NT0A 3O9WC 1UYWH