2IAFA

Crystal structure of a fragment (residues 11 to 161) of l-serine dehydratase from legionella pneumophila
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
140
Chain Sequence
SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein sdhL
total genus 39
structure length 140
sequence length 145
ec nomenclature
pdb deposition date 2006-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iafA00
2IAFA 3DC2A 2IQQA 3DDNA 1YGYA 4RQOA
chains in the Genus database with same CATH superfamily
3JAMM 5EZYB 3K14A 3NVKE 5EO3A 4I50B 3I55F 3F6MA 3CCSF 4C82A 2AIFA 4X1YB 1FFXA 2Z1UA 4IHJB 3VMFB 2GVIA 3N4YA 4U39A 3F0DA 3CB2A 5HY0A 5BMVB 3SIVA 4F6RA 5KMGA 5IJ9B 5EAZA 3F0FA 3P0ZA 3RYCA 3P10A 4ZHYB 4TUYA 2DYYA 5HY2A 1W5BA 3HKCA 4G4XA 3N2KA 3CCRF 5LYJA 4LNUB 4F6RB 1T0KB 1U43A 5CA0A 2BO1A 4C4WC 1X52A 3B6NA 4ZHVA 1KQSF 2IQQA 3N2GA 3I7TA 5EB0A 5HP8A 2GLZA 1W55A 1IV4A 3VTIC 1VQ7F 1TVKB 3RA6A 5EWRA 1W40A 1Z5VA 5HY4A 1YJNF 5HWEA 1Q7YH 2LBXA 4I50A 2KTUA 1CLIA 1W59A 3FBAA 3U0OA 1IV2A 1X25A 1Q82H 2F9ZC 4BT2A 3OW2F 1H47A 1NMUB 3LWOC 1M90H 2CWJA 3MQWA 1Z5WA 4BVSA 3E20B 3OBWA 2HP0A 4O4IB 3N2GB 3JAWB 1JD1A 3UT5B 5IYZA 3M4SA 3WPXA 3N2KB 5FJ4C 1QU9A 1VH8A 5JVDB 3VYTC 1JJ2F 2CHSA 2YXZA 3JATB 3QTYA 3I3FA 5A2QM 1U3LA 5MN4A 1K8AH 3G4SF 2HQSC 5IJ9A 5J2TA 2ZODA 4PWTA 4ZHWA 3RYFA 2IG8A 3GTZA 5GIPC 5G4UC 1FFXB 3CYPB 5J2TB 3ZO8A 2HX0A 4O4HB 5CB4B 3KHNA 4ZHQB 3NK6A 3FD6A 5JVDA 4YJ3A 5EZYA 1Q81H 3GHZA 2MQEA 1RQ2A 3HKEB 3WXMB 4WBNA 3R0PA 5LP6C 5MN5A 4E6EA 3CMAF 2ZOVA 1YITF 2HVYD 2G9IA 4BT5A 3ESJA 5CA1B 3ZP4A 2CW4A 2OHWA 3ON1A 3RYIA 5JCOC 1TUBA 5LYJB 3TD4A 4O2AA 1XV2A 3NK7A 1CK2A 4U3JA 1W581 3VOBA 4BVRA 1KNJA 3HKBB 4O2BA 1XHOA 2ALEA 2BTQB 3ELCA 5IJ0B 1GX1A 5KX5B 5LP6A 3RYFB 3DDNA 1YI2F 2VXYA 2ZVYA 3JALA 5DCVA 5KX5A 3OBYA 1SZQA 4EB6B 3WGKA 3WJRA 2NMUA 2YYEA 2QI2A 2Z01A 4B5CA 5EIBC 3ZOPA 1OAPA 2I6DA 3HKCB 1W3EX 1TVKA 1W41A 5IYZB 1J7HA 2KG4A 1GO1A 3S06A 3G71F 3CCQF 3LWVC 1QVGF 4IIJA 2P6YA 1QD9A 3CCMF 4C8IA 4X20B 2PMPA 3FFMA 3JARA 4LCKA 1VQNF 5JQGA 1YHQF 3CCEF 2UZHA 1K73H 4X1KA 5C8YB 5LOVB 1NJIH 2AIZP 1E7KA 2JNBA 2RHHA 3Q8HA 3IKEA 3JAKA 4YJ2A 3WGNA 1VQ5F 3JALB 3JAKB 3KJKA 5HP7A 1RQ7A 3QHDA 3NVIB 1VQ9F 4G88A 3WGMA 2UYNA 5GINC 3VIUA 2VAPA 3RYIB 3V7QA 1ONIA 1RLGA 2K1SA 2VAWA 1IV1A 2CVLA 2H6LA 2LBTA 4X3LA 3HAXD 3ERNA 1NQ3A 4ZOLA 3S03A 2L26A 2RHOA 3GYQA 3C8LA 2V9YA 3BYQA 3J80M 4O4HA 2DT4A 1UFYA 5LA6A 4ZHQA 2RHLA 4ERHA 3C9RA 1QAHA 2VAMA 5JH7A 1X7OA 1ZWZA 1OFUA 3CCJF 4EB6A 2HRUA 3CYQA 3CMEF 2VGNA 4C8GA 4EI8A 3TD5A 1VQ8F 4R40B 2IAFA 5HXZA 2HS3A 1UI9A 4TV9B 1VHAA 4TUYB 3HKDB 3K2XA 2Q1YA 3UT5A 1VK3A 2FGYA 3EORA 4C8EA 3JASB 1W5EA 4TV9A 4DXDA 5BMVA 2W8BC 3IR9A 1JFFA 3K0TA 2UYPA 4IIJB 3WJQA 1FSZA 3C9SA 2HP3A 4BT4A 5EYPA 3CD6F 4X1YA 4ZI7A 1W42A 3MCAB 1VQ6F 5G4VC 2R6R1 2UYJA 4X1KB 5C8YA 4HNAB 3FPIA 5LOVA 4B46A 5LXTB 3CCVF 4G4WA 3M1XA 4XCQA 1QVFF 2Z1FA 5GONB 2QEXF 2VGMA 3JARB 4X3MA 5CA0B 3WPWA 4X20A 3D54A 1W5FA 2OTLF 1M1KH 1SA0B 1W57A 1YGYA 2OTMA 2QTPA 3CC4F 5JQGB 3HKDA 3JASA 1R1MA 3RYCB 3RYHA 5KMGB 5ITZA 4NQ3A 1N8RH 4X1IB 3IMPA 1PF5A 1IV3A 3E1YA 4ZK7A 3T80A 3IKFA 1U3PA 5J2UB 3VYSC 3CXCF 4G4VA 1JY8A 3LYBA 1VQ4F 5EIBD 1ODEA 5CB4A 4HNAA 3WJPA 5LXTA 2LCAA 3IEWA 5MN6A 5LA6B 1VQLF 3DC2A 2QA4F 4I4TA 3S0YA 3F0EA 5HY1A 3D01A 2PHNA 4G4YA 3RA5A 2Z1TA 1K9MH 5GIOC 2ZF8A 1T0AA 2R751 3C9TA 4WBNB 4O2AB 3P4EA 1FNJA 3WGLA 3O85A 1XRGA 4BT6A 3FD5A 1SDSA 5B8FA 3J7AR 4KWEA 1IPAA 5FNVB 1YJWF 5CA1A 2GZLA 5AVMA 4EI7A 3NMUC 3KE1A 2RHJA 4I4TB 3JCMM 4TZZA 2AMTA 5JCOA 4BW0B 3MCQA 1GZ0A 3WGJA 1Q8RA 3VI6A 4O4LB 4YJ2B 3F0GA 4BY9D 3HKBA 1COMA 3ZP7A 4C81A 4X1IA 4O4JA 3L7QA 3LMEA 1YIJF 1H7MA 4B45A 4BT3A 2EWCA 3KIZA 1TUBB 4EI9A 3VCZA 5J2UA 3D00A 2I6RA 3I56F 1SA0A 3CPQA 1JFFB 1PXWA 3QUWA 1VQMF 3S0WA 1S72F 3JVHA 3JATA 5ITZB 2HS0A 3VOAA 3LWRC 3PLAC 4B62A 1JN1A 2OZBA 5HXUA 4FFBB 4TV8B 1KNKA 3HJWC 3JAWA 1FNKA 1GO0A 4O4LA 4I55B 5FLXM 3CPWF 3V7EA 3CC7F 1RA4A 3HWUA 3V3TA 1W5AA 2HRYA 2LBWA 4G4ZA 3CG6A 1H48A 4RHAA 3HTNA 1VQVA 5EYPB 2CSLA 1CN7A 2H8EA 4I55A 5LP6B 3LFOA 5FNVA 2BTUA 4DRXB 2RB9A 4M8IA 4RQOA 4U3JB 3S02A 2CZWA 4LNUA 5GAPK 3KJJA 3SIUA 4O2BB 2HS4A 5EB1B 2ZAUA 3RYHB 1VQKF 3N4ZA 1KC8H 4FFBA 4TV8A 4BT7A 2N48A 1W2BF 4ZOLB 1VQOF 3E22A 4NUTA 3OONA 2HP0B 5GANK 2CHTA 2H8CA 3M84A 3RE3A 4YJ3B 1Q86H 4O4JB 2Z1EA 3G6EF 3MBMA 2KTVA 3HKEA 2FC3A 5JH7B 2B33A 3MDOA 4NWOB 4BVTA 3VYUC 4BVQA 2OTJF 3LDTA 3TD3A 4DRXA 3CCLF 2Q1XA 5IT9M 4ZI7B 2KGWA 1U40A 1DBFA 3V4DA 1X7PA 1YJ9F 3J81M 1RLUA 3VO8A 3CC2F 3S0HA 2WALA 5IJ0A 3PAFA 3CCUF 3IEQA 1YQNA 1DT9A 3AGKA 1VQPF 2UYNB 3C9UA 2ZVZA 2BTOA 3E22B 5GONA 2UYKA 3K12A 3LWQC 3LWPC 1XBIA 4O4IA 1KD1H 4IHJA
chains in the Genus database with same CATH topology
2IAFA 3DC2A 2IQQA 3DDNA 1YGYA 4RQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAF A;  3DC2 A;  2IQQ A;  3DDN A;  1YGY A;  4RQO A; 
#chains in the Genus database with same CATH topology
 3JAM M;  5EZY B;  3K14 A;  3NVK E;  5EO3 A;  4I50 B;  3I55 F;  3F6M A;  3CCS F;  4C82 A;  2AIF A;  4X1Y B;  1FFX A;  2Z1U A;  4IHJ B;  3VMF B;  2GVI A;  3N4Y A;  4U39 A;  3F0D A;  3CB2 A;  5HY0 A;  5BMV B;  3SIV A;  4F6R A;  5KMG A;  5IJ9 B;  5EAZ A;  3F0F A;  3P0Z A;  3RYC A;  3P10 A;  4ZHY B;  4TUY A;  2DYY A;  5HY2 A;  1W5B A;  3HKC A;  4G4X A;  3N2K A;  3CCR F;  5LYJ A;  4LNU B;  4F6R B;  1T0K B;  1U43 A;  5CA0 A;  2BO1 A;  4C4W C;  1X52 A;  3B6N A;  4ZHV A;  1KQS F;  2IQQ A;  3N2G A;  3I7T A;  5EB0 A;  5HP8 A;  2GLZ A;  1W55 A;  1IV4 A;  3VTI C;  1VQ7 F;  1TVK B;  3RA6 A;  5EWR A;  1W40 A;  1Z5V A;  5HY4 A;  1YJN F;  5HWE A;  1Q7Y H;  2LBX A;  4I50 A;  2KTU A;  1CLI A;  1W59 A;  3FBA A;  3U0O A;  1IV2 A;  1X25 A;  1Q82 H;  2F9Z C;  4BT2 A;  3OW2 F;  1H47 A;  1NMU B;  3LWO C;  1M90 H;  2CWJ A;  3MQW A;  1Z5W A;  4BVS A;  3E20 B;  3OBW A;  2HP0 A;  4O4I B;  3N2G B;  3JAW B;  1JD1 A;  3UT5 B;  5IYZ A;  3M4S A;  3WPX A;  3N2K B;  5FJ4 C;  1QU9 A;  1VH8 A;  5JVD B;  3VYT C;  1JJ2 F;  2CHS A;  2YXZ A;  3JAT B;  3QTY A;  3I3F A;  5A2Q M;  1U3L A;  5MN4 A;  1K8A H;  3G4S F;  2HQS C;  5IJ9 A;  5J2T A;  2ZOD A;  4PWT A;  4ZHW A;  3RYF A;  2IG8 A;  3GTZ A;  5GIP C;  5G4U C;  1FFX B;  3CYP B;  5J2T B;  3ZO8 A;  2HX0 A;  4O4H B;  5CB4 B;  3KHN A;  4ZHQ B;  3NK6 A;  3FD6 A;  5JVD A;  4YJ3 A;  5EZY A;  1Q81 H;  3GHZ A;  2MQE A;  1RQ2 A;  3HKE B;  3WXM B;  4WBN A;  3R0P A;  5LP6 C;  5MN5 A;  4E6E A;  3CMA F;  2ZOV A;  1YIT F;  2HVY D;  2G9I A;  4BT5 A;  3ESJ A;  5CA1 B;  3ZP4 A;  2CW4 A;  2OHW A;  3ON1 A;  3RYI A;  5JCO C;  1TUB A;  5LYJ B;  3TD4 A;  4O2A A;  1XV2 A;  3NK7 A;  1CK2 A;  4U3J A;  1W58 1;  3VOB A;  4BVR A;  1KNJ A;  3HKB B;  4O2B A;  1XHO A;  2ALE A;  2BTQ B;  3ELC A;  5IJ0 B;  1GX1 A;  5KX5 B;  5LP6 A;  3RYF B;  3DDN A;  1YI2 F;  2VXY A;  2ZVY A;  3JAL A;  5DCV A;  5KX5 A;  3OBY A;  1SZQ A;  4EB6 B;  3WGK A;  3WJR A;  2NMU A;  2YYE A;  2QI2 A;  2Z01 A;  4B5C A;  5EIB C;  3ZOP A;  1OAP A;  2I6D A;  3HKC B;  1W3E X;  1TVK A;  1W41 A;  5IYZ B;  1J7H A;  2KG4 A;  1GO1 A;  3S06 A;  3G71 F;  3CCQ F;  3LWV C;  1QVG F;  4IIJ A;  2P6Y A;  1QD9 A;  3CCM F;  4C8I A;  4X20 B;  2PMP A;  3FFM A;  3JAR A;  4LCK A;  1VQN F;  5JQG A;  1YHQ F;  3CCE F;  2UZH A;  1K73 H;  4X1K A;  5C8Y B;  5LOV B;  1NJI H;  2AIZ P;  1E7K A;  2JNB A;  2RHH A;  3Q8H A;  3IKE A;  3JAK A;  4YJ2 A;  3WGN A;  1VQ5 F;  3JAL B;  3JAK B;  3KJK A;  5HP7 A;  1RQ7 A;  3QHD A;  3NVI B;  1VQ9 F;  4G88 A;  3WGM A;  2UYN A;  5GIN C;  3VIU A;  2VAP A;  3RYI B;  3V7Q A;  1ONI A;  1RLG A;  2K1S A;  2VAW A;  1IV1 A;  2CVL A;  2H6L A;  2LBT A;  4X3L A;  3HAX D;  3ERN A;  1NQ3 A;  4ZOL A;  3S03 A;  2L26 A;  2RHO A;  3GYQ A;  3C8L A;  2V9Y A;  3BYQ A;  3J80 M;  4O4H A;  2DT4 A;  1UFY A;  5LA6 A;  4ZHQ A;  2RHL A;  4ERH A;  3C9R A;  1QAH A;  2VAM A;  5JH7 A;  1X7O A;  1ZWZ A;  1OFU A;  3CCJ F;  4EB6 A;  2HRU A;  3CYQ A;  3CME F;  2VGN A;  4C8G A;  4EI8 A;  3TD5 A;  1VQ8 F;  4R40 B;  2IAF A;  5HXZ A;  2HS3 A;  1UI9 A;  4TV9 B;  1VHA A;  4TUY B;  3HKD B;  3K2X A;  2Q1Y A;  3UT5 A;  1VK3 A;  2FGY A;  3EOR A;  4C8E A;  3JAS B;  1W5E A;  4TV9 A;  4DXD A;  5BMV A;  2W8B C;  3IR9 A;  1JFF A;  3K0T A;  2UYP A;  4IIJ B;  3WJQ A;  1FSZ A;  3C9S A;  2HP3 A;  4BT4 A;  5EYP A;  3CD6 F;  4X1Y A;  4ZI7 A;  1W42 A;  3MCA B;  1VQ6 F;  5G4V C;  2R6R 1;  2UYJ A;  4X1K B;  5C8Y A;  4HNA B;  3FPI A;  5LOV A;  4B46 A;  5LXT B;  3CCV F;  4G4W A;  3M1X A;  4XCQ A;  1QVF F;  2Z1F A;  5GON B;  2QEX F;  2VGM A;  3JAR B;  4X3M A;  5CA0 B;  3WPW A;  4X20 A;  3D54 A;  1W5F A;  2OTL F;  1M1K H;  1SA0 B;  1W57 A;  1YGY A;  2OTM A;  2QTP A;  3CC4 F;  5JQG B;  3HKD A;  3JAS A;  1R1M A;  3RYC B;  3RYH A;  5KMG B;  5ITZ A;  4NQ3 A;  1N8R H;  4X1I B;  3IMP A;  1PF5 A;  1IV3 A;  3E1Y A;  4ZK7 A;  3T80 A;  3IKF A;  1U3P A;  5J2U B;  3VYS C;  3CXC F;  4G4V A;  1JY8 A;  3LYB A;  1VQ4 F;  5EIB D;  1ODE A;  5CB4 A;  4HNA A;  3WJP A;  5LXT A;  2LCA A;  3IEW A;  5MN6 A;  5LA6 B;  1VQL F;  3DC2 A;  2QA4 F;  4I4T A;  3S0Y A;  3F0E A;  5HY1 A;  3D01 A;  2PHN A;  4G4Y A;  3RA5 A;  2Z1T A;  1K9M H;  5GIO C;  2ZF8 A;  1T0A A;  2R75 1;  3C9T A;  4WBN B;  4O2A B;  3P4E A;  1FNJ A;  3WGL A;  3O85 A;  1XRG A;  4BT6 A;  3FD5 A;  1SDS A;  5B8F A;  3J7A R;  4KWE A;  1IPA A;  5FNV B;  1YJW F;  5CA1 A;  2GZL A;  5AVM A;  4EI7 A;  3NMU C;  3KE1 A;  2RHJ A;  4I4T B;  3JCM M;  4TZZ A;  2AMT A;  5JCO A;  4BW0 B;  3MCQ A;  1GZ0 A;  3WGJ A;  1Q8R A;  3VI6 A;  4O4L B;  4YJ2 B;  3F0G A;  4BY9 D;  3HKB A;  1COM A;  3ZP7 A;  4C81 A;  4X1I A;  4O4J A;  3L7Q A;  3LME A;  1YIJ F;  1H7M A;  4B45 A;  4BT3 A;  2EWC A;  3KIZ A;  1TUB B;  4EI9 A;  3VCZ A;  5J2U A;  3D00 A;  2I6R A;  3I56 F;  1SA0 A;  3CPQ A;  1JFF B;  1PXW A;  3QUW A;  1VQM F;  3S0W A;  1S72 F;  3JVH A;  3JAT A;  5ITZ B;  2HS0 A;  3VOA A;  3LWR C;  3PLA C;  4B62 A;  1JN1 A;  2OZB A;  5HXU A;  4FFB B;  4TV8 B;  1KNK A;  3HJW C;  3JAW A;  1FNK A;  1GO0 A;  4O4L A;  4I55 B;  5FLX M;  3CPW F;  3V7E A;  3CC7 F;  1RA4 A;  3HWU A;  3V3T A;  1W5A A;  2HRY A;  2LBW A;  4G4Z A;  3CG6 A;  1H48 A;  4RHA A;  3HTN A;  1VQV A;  5EYP B;  2CSL A;  1CN7 A;  2H8E A;  4I55 A;  5LP6 B;  3LFO A;  5FNV A;  2BTU A;  4DRX B;  2RB9 A;  4M8I A;  4RQO A;  4U3J B;  3S02 A;  2CZW A;  4LNU A;  5GAP K;  3KJJ A;  3SIU A;  4O2B B;  2HS4 A;  5EB1 B;  2ZAU A;  3RYH B;  1VQK F;  3N4Z A;  1KC8 H;  4FFB A;  4TV8 A;  4BT7 A;  2N48 A;  1W2B F;  4ZOL B;  1VQO F;  3E22 A;  4NUT A;  3OON A;  2HP0 B;  5GAN K;  2CHT A;  2H8C A;  3M84 A;  3RE3 A;  4YJ3 B;  1Q86 H;  4O4J B;  2Z1E A;  3G6E F;  3MBM A;  2KTV A;  3HKE A;  2FC3 A;  5JH7 B;  2B33 A;  3MDO A;  4NWO B;  4BVT A;  3VYU C;  4BVQ A;  2OTJ F;  3LDT A;  3TD3 A;  4DRX A;  3CCL F;  2Q1X A;  5IT9 M;  4ZI7 B;  2KGW A;  1U40 A;  1DBF A;  3V4D A;  1X7P A;  1YJ9 F;  3J81 M;  1RLU A;  3VO8 A;  3CC2 F;  3S0H A;  2WAL A;  5IJ0 A;  3PAF A;  3CCU F;  3IEQ A;  1YQN A;  1DT9 A;  3AGK A;  1VQP F;  2UYN B;  3C9U A;  2ZVZ A;  2BTO A;  3E22 B;  5GON A;  2UYK A;  3K12 A;  3LWQ C;  3LWP C;  1XBI A;  4O4I A;  1KD1 H;  4IHJ A; 
#chains in the Genus database with same CATH homology
 2IAF A;  3DC2 A;  2IQQ A;  3DDN A;  1YGY A;  4RQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...