2IAFA

Crystal structure of a fragment (residues 11 to 161) of l-serine dehydratase from legionella pneumophila
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
140
Chain Sequence
b'SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein sdhL
publication title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Structural genomics, unknown function
total genus 39
structure length 140
sequence length 145
ec nomenclature
pdb deposition date 2006-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iafA00
3DC2A 2IQQA 1YGYA 4RQOA 2IAFA 3DDNA
chains in the Genus database with same CATH superfamily
4X20A 1W581 2GZLA 4ZK7A 2CHSA 5JQGB 3RYCA 4X1YB 3VOAA 5J2UA 1VQNF 1VQ7F 2ZAUA 2Q1YA 4I4TA 3LWRC 1YIJF 3R0PA 3CPQA 4TUYB 3LWPC 5EYPA 4BT6A 5LOVB 2AMTA 2OTLF 1E7KA 5IJ9B 3TD3A 2KGWA 4TV8B 1GX1A 3K0TA 3G71F 1QD9A 2BTUA 5C8YB 2OTMA 3DC2A 1VHAA 5BMVA 4NQ3A 3UT5A 3VMFB 1Q7YH 4ZHQB 3WXMB 5EIBD 3HKBB 1PXWA 3WPWA 4IIJA 2P6YA 3IR9A 1KNKA 2HS3A 4O4HB 4O4LA 2EWCA 3RYFB 3HTNA 4YJ3A 1CLIA 5J2UB 2ZF8A 5EZYA 2CSLA 2KG4A 4C8EA 4EB6A 4C8GA 4HNAA 5MN4A 5HY4A 3GHZA 4C82A 5HY0A 3JASB 3JAWB 5ITZA 2KTUA 1TVKA 2UYNB 1GO0A 1T0KB 1U40A 3KJKA 1JY8A 1T0AA 2LBXA 1FFXB 2RHHA 2RHJA 1YJ9F 1U3PA 5IT9M 3VCZA 1U3LA 1XRGA 1SA0B 1GO1A 5JH7B 2QA4F 3CCRF 2OZBA 1VQKF 4EI9A 4NWOB 4FFBA 3ZP7A 3LMEA 4O4IA 2V9YA 2HS0A 4O2AB 4BT7A 1IV1A 1Q86H 1JFFA 5EZYB 3CMAF 3S03A 3CYQA 3I7TA 2MQEA 4X3MA 1S72F 1N8RH 3ESJA 4PWTA 1TUBA 4BVRA 5HY1A 3WJRA 4HNAB 2Z1FA 4F6RA 5G4VC 5LXTA 2UYJA 5IYZA 2ZOVA 3JARB 5HY2A 5CB4B 1VQVA 1W41A 3J7AR 3CB2A 4B45A 3JAKA 1Z5VA 3D00A 1QAHA 4TZZA 3CCSF 3CC2F 3BYQA 1W5EA 1VQ9F 2UYKA 3GTZA 4E6EA 4WBNA 2YXZA 2ZVYA 3K2XA 3WGLA 2Q1XA 1X7PA 3LDTA 3U0OA 5KMGB 5LYJA 3K14A 4BT3A 5LP6C 1RA4A 2KTVA 3B6NA 2VGNA 5JCOA 3CCLF 3CCVF 3RE3A 1DT9A 1ZWZA 2DT4A 2HP0B 4F6RB 3S06A 5JVDB 1YI2F 2VAMA 3HKEB 3CYPB 1VQOF 1W3EX 1XHOA 5EIBC 5IYZB 5GANK 2GVIA 3S02A 3NK6A 1Q82H 2AIFA 3F0EA 3HKCA 2LBWA 4BT4A 3QHDA 2BTOA 2BO1A 5HXUA 1KD1H 2RB9A 3JCMM 3JVHA 2HQSC 3MDOA 3KHNA 2RHLA 1X7OA 4O4JA 3LWOC 4ZI7B 3IEWA 3N4YA 1U43A 5KX5B 4I50B 3CCQF 4I55A 4LNUA 2FGYA 2G9IA 1QVFF 3VTIC 3RYHA 1K73H 4ZHVA 3E1YA 4G4ZA 4ZHYB 2HP3A 1VQ5F 2HX0A 2Z01A 2QTPA 1OAPA 4BY9D 3FPIA 2VGMA 3ZO8A 5MN5A 3JALB 5IJ0A 5GINC 3CCEF 2H8CA 1IV3A 1H47A 3KE1A 4O2BB 3SIVA 1Z5WA 3MQWA 4X3LA 4X20B 1QVGF 1VQ8F 3NMUC 1VQLF 2H8EA 3CD6F 3RYCB 3C8LA 4U3JA 1VQ6F 3J80M 3E22A 4I4TB 5JCOC 3I3FA 1NMUB 2ZVZA 3N2KA 4X1IA 1YJNF 5CA0A 4O4JB 5EYPB 3VYUC 3PAFA 2Z1TA 3CCUF 5GIPC 2QI2A 4YJ2A 3WJQA 3V3TA 4X1KA 5BMVB 5LP6A 4LNUB 3TD4A 3UT5B 3OW2F 3S0WA 2H6LA 2JNBA 2NMUA 2K1SA 3WPXA 3G4SF 3WJPA 2Z1EA 1W55A 1OFUA 1VQPF 1VH8A 2QEXF 3N4ZA 4IIJB 4RHAA 4O4LB 2CZWA 2I6DA 1KC8H 1XV2A 3IKEA 1JJ2F 1CN7A 3MCQA 5HWEA 4YJ3B 2ALEA 3NK7A 5J2TA 1M1KH 4B5CA 3Q8HA 3E22B 3RYIA 3T80A 1W5FA 1IPAA 3OBWA 2HVYD 4EB6B 3ELCA 3ERNA 1VQMF 1UFYA 4XCQA 5CA0B 3LFOA 1YQNA 3P10A 2OTJF 2HRUA 5ITZB 3RA5A 3CCJF 1TVKB 5CA1A 4TV9A 3QTYA 1YHQF 2B33A 3N2GA 2PMPA 1X25A 5LP6B 1J7HA 3S0YA 3VIUA 2YYEA 4KWEA 5GONA 4RQOA 5HP8A 1GZ0A 4C4WC 2Z1UA 1VK3A 2WALA 3HKDA 5HXZA 4FFBB 1RLUA 1W59A 3C9RA 3LYBA 5FNVA 4O4IB 4B46A 2RHOA 5J2TB 1JD1A 5JQGA 4X1YA 1JFFB 3RYIB 3MCAB 5FJ4C 1M90H 5B8FA 3CG6A 4G4YA 1TUBB 3OBYA 2CW4A 2LCAA 2LBTA 4C8IA 1W5AA 5LXTB 1X52A 3V4DA 4BVSA 4TV9B 3E20B 3IEQA 3I55F 5G4UC 2FC3A 4U39A 2HRYA 2VAWA 5C8YA 1SZQA 2DYYA 3JAKB 5EAZA 3HKBA 3J81M 3VI6A 1DBFA 3D01A 3HKDB 1QU9A 3CMEF 4O4HA 1VQ4F 4WBNB 5DCVA 3RYFA 1CK2A 2BTQB 3TD5A 3P4EA 5LYJB 3C9SA 3QUWA 2IAFA 1COMA 3V7EA 2UZHA 2VXYA 4ERHA 1W40A 3NVKE 4G88A 4M8IA 5GAPK 1FNKA 3C9UA 4BT2A 4BVQA 1H7MA 2I6RA 3JAWA 1W42A 3JASA 1YITF 2UYNA 3O85A 3CXCF 4C81A 4G4XA 3HKCB 4NUTA 3GYQA 1FFXA 4EI7A 3CC4F 3RA6A 5EWRA 3P0ZA 5AVMA 3V7QA 2R751 3G6EF 1SA0A 5FLXM 5JH7A 1JN1A 3FD6A 3S0HA 3AGKA 3FBAA 1YGYA 3EORA 2GLZA 3CPWF 4O2AA 4I55B 3LWQC 2UYPA 3FD5A 4DXDA 3RYHB 1IV2A 3SIUA 4IHJA 1NJIH 3F0FA 3LWVC 1ODEA 5IJ0B 3PLAC 1ONIA 3D54A 3VOBA 1W57A 1RQ7A 3JARA 2R6R1 3HWUA 5CB4A 3I56F 2N48A 3M1XA 4G4VA 4U3JB 3M84A 1R1MA 1FNJA 1SDSA 1Q81H 3CC7F 4BVTA 3N2KB 5LA6A 4X1IB 3ZOPA 1YJWF 5EB1B 3ZP4A 2W8BC 3HAXD 4DRXA 1K8AH 3VYSC 4YJ2B 3ON1A 4G4WA 3VYTC 1PF5A 3F6MA 3WGJA 4R40B 4X1KB 5KMGA 2VAPA 4ZOLA 5EB0A 2CVLA 1XBIA 3JATA 2HS4A 1FSZA 4IHJB 5A2QM 1H48A 1KNJA 2HP0A 3WGKA 5JVDA 3HKEA 3IKFA 1NQ3A 3NVIB 1K9MH 1W5BA 1UI9A 3WGMA 2F9ZC 3JAMM 3OONA 5HP7A 1IV4A 3KJJA 2CHTA 1W2BF 2L26A 4EI8A 4B62A 2IG8A 4TUYA 5LA6B 3FFMA 2PHNA 1RQ2A 5LOVA 4ZI7A 4DRXB 1KQSF 3VO8A 5IJ9A 4TV8A 5CA1B 2ZODA 3DDNA 2IQQA 5GIOC 5KX5A 4I50A 3N2GB 3L7QA 5MN6A 3HJWC 4ZHQA 4ZOLB 4ZHWA 3F0DA 3MBMA 3WGNA 5GONB 5EO3A 3JATB 1RLGA 4BT5A 4LCKA 3KIZA 3C9TA 1Q8RA 4BW0B 3CCMF 3IMPA 2CWJA 2OHWA 3JALA 2AIZP 5FNVB 3F0GA 3K12A 4O2BA 3M4SA
chains in the Genus database with same CATH topology
3DC2A 2IQQA 1YGYA 4RQOA 2IAFA 3DDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DC2 A;  2IQQ A;  1YGY A;  4RQO A;  2IAF A;  3DDN A; 
#chains in the Genus database with same CATH topology
 4X20 A;  1W58 1;  2GZL A;  4ZK7 A;  2CHS A;  5JQG B;  3RYC A;  4X1Y B;  3VOA A;  5J2U A;  1VQN F;  1VQ7 F;  2ZAU A;  2Q1Y A;  4I4T A;  3LWR C;  1YIJ F;  3R0P A;  3CPQ A;  4TUY B;  3LWP C;  5EYP A;  4BT6 A;  5LOV B;  2AMT A;  2OTL F;  1E7K A;  5IJ9 B;  3TD3 A;  2KGW A;  4TV8 B;  1GX1 A;  3K0T A;  3G71 F;  1QD9 A;  2BTU A;  5C8Y B;  2OTM A;  3DC2 A;  1VHA A;  5BMV A;  4NQ3 A;  3UT5 A;  3VMF B;  1Q7Y H;  4ZHQ B;  3WXM B;  5EIB D;  3HKB B;  1PXW A;  3WPW A;  4IIJ A;  2P6Y A;  3IR9 A;  1KNK A;  2HS3 A;  4O4H B;  4O4L A;  2EWC A;  3RYF B;  3HTN A;  4YJ3 A;  1CLI A;  5J2U B;  2ZF8 A;  5EZY A;  2CSL A;  2KG4 A;  4C8E A;  4EB6 A;  4C8G A;  4HNA A;  5MN4 A;  5HY4 A;  3GHZ A;  4C82 A;  5HY0 A;  3JAS B;  3JAW B;  5ITZ A;  2KTU A;  1TVK A;  2UYN B;  1GO0 A;  1T0K B;  1U40 A;  3KJK A;  1JY8 A;  1T0A A;  2LBX A;  1FFX B;  2RHH A;  2RHJ A;  1YJ9 F;  1U3P A;  5IT9 M;  3VCZ A;  1U3L A;  1XRG A;  1SA0 B;  1GO1 A;  5JH7 B;  2QA4 F;  3CCR F;  2OZB A;  1VQK F;  4EI9 A;  4NWO B;  4FFB A;  3ZP7 A;  3LME A;  4O4I A;  2V9Y A;  2HS0 A;  4O2A B;  4BT7 A;  1IV1 A;  1Q86 H;  1JFF A;  5EZY B;  3CMA F;  3S03 A;  3CYQ A;  3I7T A;  2MQE A;  4X3M A;  1S72 F;  1N8R H;  3ESJ A;  4PWT A;  1TUB A;  4BVR A;  5HY1 A;  3WJR A;  4HNA B;  2Z1F A;  4F6R A;  5G4V C;  5LXT A;  2UYJ A;  5IYZ A;  2ZOV A;  3JAR B;  5HY2 A;  5CB4 B;  1VQV A;  1W41 A;  3J7A R;  3CB2 A;  4B45 A;  3JAK A;  1Z5V A;  3D00 A;  1QAH A;  4TZZ A;  3CCS F;  3CC2 F;  3BYQ A;  1W5E A;  1VQ9 F;  2UYK A;  3GTZ A;  4E6E A;  4WBN A;  2YXZ A;  2ZVY A;  3K2X A;  3WGL A;  2Q1X A;  1X7P A;  3LDT A;  3U0O A;  5KMG B;  5LYJ A;  3K14 A;  4BT3 A;  5LP6 C;  1RA4 A;  2KTV A;  3B6N A;  2VGN A;  5JCO A;  3CCL F;  3CCV F;  3RE3 A;  1DT9 A;  1ZWZ A;  2DT4 A;  2HP0 B;  4F6R B;  3S06 A;  5JVD B;  1YI2 F;  2VAM A;  3HKE B;  3CYP B;  1VQO F;  1W3E X;  1XHO A;  5EIB C;  5IYZ B;  5GAN K;  2GVI A;  3S02 A;  3NK6 A;  1Q82 H;  2AIF A;  3F0E A;  3HKC A;  2LBW A;  4BT4 A;  3QHD A;  2BTO A;  2BO1 A;  5HXU A;  1KD1 H;  2RB9 A;  3JCM M;  3JVH A;  2HQS C;  3MDO A;  3KHN A;  2RHL A;  1X7O A;  4O4J A;  3LWO C;  4ZI7 B;  3IEW A;  3N4Y A;  1U43 A;  5KX5 B;  4I50 B;  3CCQ F;  4I55 A;  4LNU A;  2FGY A;  2G9I A;  1QVF F;  3VTI C;  3RYH A;  1K73 H;  4ZHV A;  3E1Y A;  4G4Z A;  4ZHY B;  2HP3 A;  1VQ5 F;  2HX0 A;  2Z01 A;  2QTP A;  1OAP A;  4BY9 D;  3FPI A;  2VGM A;  3ZO8 A;  5MN5 A;  3JAL B;  5IJ0 A;  5GIN C;  3CCE F;  2H8C A;  1IV3 A;  1H47 A;  3KE1 A;  4O2B B;  3SIV A;  1Z5W A;  3MQW A;  4X3L A;  4X20 B;  1QVG F;  1VQ8 F;  3NMU C;  1VQL F;  2H8E A;  3CD6 F;  3RYC B;  3C8L A;  4U3J A;  1VQ6 F;  3J80 M;  3E22 A;  4I4T B;  5JCO C;  3I3F A;  1NMU B;  2ZVZ A;  3N2K A;  4X1I A;  1YJN F;  5CA0 A;  4O4J B;  5EYP B;  3VYU C;  3PAF A;  2Z1T A;  3CCU F;  5GIP C;  2QI2 A;  4YJ2 A;  3WJQ A;  3V3T A;  4X1K A;  5BMV B;  5LP6 A;  4LNU B;  3TD4 A;  3UT5 B;  3OW2 F;  3S0W A;  2H6L A;  2JNB A;  2NMU A;  2K1S A;  3WPX A;  3G4S F;  3WJP A;  2Z1E A;  1W55 A;  1OFU A;  1VQP F;  1VH8 A;  2QEX F;  3N4Z A;  4IIJ B;  4RHA A;  4O4L B;  2CZW A;  2I6D A;  1KC8 H;  1XV2 A;  3IKE A;  1JJ2 F;  1CN7 A;  3MCQ A;  5HWE A;  4YJ3 B;  2ALE A;  3NK7 A;  5J2T A;  1M1K H;  4B5C A;  3Q8H A;  3E22 B;  3RYI A;  3T80 A;  1W5F A;  1IPA A;  3OBW A;  2HVY D;  4EB6 B;  3ELC A;  3ERN A;  1VQM F;  1UFY A;  4XCQ A;  5CA0 B;  3LFO A;  1YQN A;  3P10 A;  2OTJ F;  2HRU A;  5ITZ B;  3RA5 A;  3CCJ F;  1TVK B;  5CA1 A;  4TV9 A;  3QTY A;  1YHQ F;  2B33 A;  3N2G A;  2PMP A;  1X25 A;  5LP6 B;  1J7H A;  3S0Y A;  3VIU A;  2YYE A;  4KWE A;  5GON A;  4RQO A;  5HP8 A;  1GZ0 A;  4C4W C;  2Z1U A;  1VK3 A;  2WAL A;  3HKD A;  5HXZ A;  4FFB B;  1RLU A;  1W59 A;  3C9R A;  3LYB A;  5FNV A;  4O4I B;  4B46 A;  2RHO A;  5J2T B;  1JD1 A;  5JQG A;  4X1Y A;  1JFF B;  3RYI B;  3MCA B;  5FJ4 C;  1M90 H;  5B8F A;  3CG6 A;  4G4Y A;  1TUB B;  3OBY A;  2CW4 A;  2LCA A;  2LBT A;  4C8I A;  1W5A A;  5LXT B;  1X52 A;  3V4D A;  4BVS A;  4TV9 B;  3E20 B;  3IEQ A;  3I55 F;  5G4U C;  2FC3 A;  4U39 A;  2HRY A;  2VAW A;  5C8Y A;  1SZQ A;  2DYY A;  3JAK B;  5EAZ A;  3HKB A;  3J81 M;  3VI6 A;  1DBF A;  3D01 A;  3HKD B;  1QU9 A;  3CME F;  4O4H A;  1VQ4 F;  4WBN B;  5DCV A;  3RYF A;  1CK2 A;  2BTQ B;  3TD5 A;  3P4E A;  5LYJ B;  3C9S A;  3QUW A;  2IAF A;  1COM A;  3V7E A;  2UZH A;  2VXY A;  4ERH A;  1W40 A;  3NVK E;  4G88 A;  4M8I A;  5GAP K;  1FNK A;  3C9U A;  4BT2 A;  4BVQ A;  1H7M A;  2I6R A;  3JAW A;  1W42 A;  3JAS A;  1YIT F;  2UYN A;  3O85 A;  3CXC F;  4C81 A;  4G4X A;  3HKC B;  4NUT A;  3GYQ A;  1FFX A;  4EI7 A;  3CC4 F;  3RA6 A;  5EWR A;  3P0Z A;  5AVM A;  3V7Q A;  2R75 1;  3G6E F;  1SA0 A;  5FLX M;  5JH7 A;  1JN1 A;  3FD6 A;  3S0H A;  3AGK A;  3FBA A;  1YGY A;  3EOR A;  2GLZ A;  3CPW F;  4O2A A;  4I55 B;  3LWQ C;  2UYP A;  3FD5 A;  4DXD A;  3RYH B;  1IV2 A;  3SIU A;  4IHJ A;  1NJI H;  3F0F A;  3LWV C;  1ODE A;  5IJ0 B;  3PLA C;  1ONI A;  3D54 A;  3VOB A;  1W57 A;  1RQ7 A;  3JAR A;  2R6R 1;  3HWU A;  5CB4 A;  3I56 F;  2N48 A;  3M1X A;  4G4V A;  4U3J B;  3M84 A;  1R1M A;  1FNJ A;  1SDS A;  1Q81 H;  3CC7 F;  4BVT A;  3N2K B;  5LA6 A;  4X1I B;  3ZOP A;  1YJW F;  5EB1 B;  3ZP4 A;  2W8B C;  3HAX D;  4DRX A;  1K8A H;  3VYS C;  4YJ2 B;  3ON1 A;  4G4W A;  3VYT C;  1PF5 A;  3F6M A;  3WGJ A;  4R40 B;  4X1K B;  5KMG A;  2VAP A;  4ZOL A;  5EB0 A;  2CVL A;  1XBI A;  3JAT A;  2HS4 A;  1FSZ A;  4IHJ B;  5A2Q M;  1H48 A;  1KNJ A;  2HP0 A;  3WGK A;  5JVD A;  3HKE A;  3IKF A;  1NQ3 A;  3NVI B;  1K9M H;  1W5B A;  1UI9 A;  3WGM A;  2F9Z C;  3JAM M;  3OON A;  5HP7 A;  1IV4 A;  3KJJ A;  2CHT A;  1W2B F;  2L26 A;  4EI8 A;  4B62 A;  2IG8 A;  4TUY A;  5LA6 B;  3FFM A;  2PHN A;  1RQ2 A;  5LOV A;  4ZI7 A;  4DRX B;  1KQS F;  3VO8 A;  5IJ9 A;  4TV8 A;  5CA1 B;  2ZOD A;  3DDN A;  2IQQ A;  5GIO C;  5KX5 A;  4I50 A;  3N2G B;  3L7Q A;  5MN6 A;  3HJW C;  4ZHQ A;  4ZOL B;  4ZHW A;  3F0D A;  3MBM A;  3WGN A;  5GON B;  5EO3 A;  3JAT B;  1RLG A;  4BT5 A;  4LCK A;  3KIZ A;  3C9T A;  1Q8R A;  4BW0 B;  3CCM F;  3IMP A;  2CWJ A;  2OHW A;  3JAL A;  2AIZ P;  5FNV B;  3F0G A;  3K12 A;  4O2B A;  3M4S A; 
#chains in the Genus database with same CATH homology
 3DC2 A;  2IQQ A;  1YGY A;  4RQO A;  2IAF A;  3DDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...