2IAFA

Crystal structure of a fragment (residues 11 to 161) of l-serine dehydratase from legionella pneumophila
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
140
Chain Sequence
SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein sdhL
publication title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Structural genomics, unknown function
total genus 39
structure length 140
sequence length 145
ec nomenclature
pdb deposition date 2006-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iafA00
3DC2A 4RQOA 1YGYA 2IQQA 3DDNA 2IAFA
chains in the Genus database with same CATH superfamily
1IPAA 2BTOA 4ZOLA 1OFUA 5EO3A 2UYNB 3L7QA 3D01A 5JH7B 1S72F 2IAFA 4O4HA 3F6MA 3JAWA 3P0ZA 3RYIA 2AIFA 4M8IA 3VYTC 4X20B 4BT7A 5C8YB 5LA6B 4X1KA 1Q86H 4I55B 2Z1UA 1JJ2F 2AMTA 5EB1B 1FSZA 2HX0A 5HP8A 1COMA 4BVQA 3K2XA 2GVIA 5EZYB 4C82A 2PMPA 3FFMA 1VQ6F 4TV8B 3FPIA 3NVKE 4EI8A 3U0OA 1W41A 2Z1FA 2ZAUA 1W2BF 4LNUA 1M90H 3HKDB 5EAZA 4IHJA 3VO8A 3CC4F 3VOBA 2KTVA 1R1MA 1SA0A 3VTIC 4BY9D 3K14A 1W5FA 3RA5A 5HP7A 4FFBA 2RB9A 1TVKA 3LWVC 1XV2A 3MQWA 1QVFF 4DRXB 3N2GA 3SIVA 3NK7A 4BT6A 4EI9A 3JASB 1QAHA 1W59A 4X1IB 4B46A 3VIUA 2FGYA 1QU9A 1H47A 2CWJA 3LMEA 4ZOLB 1GX1A 4X3LA 1SZQA 2QEXF 2F9ZC 5B8FA 3LWPC 3LWOC 3WJRA 3B6NA 4O4HB 4XCQA 3IEWA 3JAWB 4I50A 3RYIB 2RHOA 3I7TA 3F0FA 4X1KB 1XBIA 3LYBA 3I55F 2R751 2V9YA 1W5EA 3Q8HA 5FLXM 4C8IA 4ZI7A 3WGJA 2UYJA 5LXTA 1E7KA 3IKFA 1YJWF 2G9IA 1W5BA 2BTUA 3CXCF 2RHHA 5EIBC 1DBFA 2OZBA 1GZ0A 3CC7F 5CA0A 4G4YA 3BYQA 1W42A 2HRYA 2K1SA 2UYPA 1QD9A 1YITF 3JAMM 4LNUB 2BTQB 4IHJB 3CPQA 1T0KB 2HP3A 3QUWA 3O85A 3PAFA 1N8RH 2JNBA 3RE3A 5EYPA 1RQ7A 3D00A 4FFBB 1TVKB 5AVMA 2CW4A 3CYPB 3N2GB 4X1YA 3HAXD 3MBMA 1TUBA 3HKBA 2OTJF 3N4ZA 5IYZA 3NVIB 1NJIH 2UZHA 3PLAC 1RLUA 3ON1A 5MN5A 2Z1EA 5GINC 5LYJA 2KTUA 1PXWA 2HVYD 3ELCA 3D54A 4O2BA 2IQQA 2CVLA 4I50B 4EB6A 5HXZA 4ZHQA 4R40B 4C4WC 3VOAA 4I4TA 1Q81H 1K73H 1Z5VA 3CC2F 3JALA 4O4LA 4G4VA 4ZI7B 3KJKA 2P6YA 2H6LA 4BW0B 5LXTB 5MN6A 3CCVF 3C9SA 3I3FA 1PF5A 2HRUA 5J2UB 5CA0B 2VGNA 3ZO8A 4YJ3A 3JAKA 1H7MA 2ZVYA 1ZWZA 3IR9A 2AIZP 4C8EA 2VAPA 5GAPK 2CZWA 1KC8H 5JVDA 4PWTA 1VQ9F 3HKCB 5MN4A 3G4SF 5LP6C 4IIJA 4DXDA 1Q82H 3S0WA 1W57A 3WGKA 1DT9A 5EYPB 3CMAF 2LBXA 2VXYA 5JQGA 3F0EA 1JN1A 4G4XA 4X1YB 4TV9A 1Q8RA 1TUBB 3HKBB 5KX5A 5IYZB 2ZVZA 1VQ5F 3RYHA 1CLIA 2GZLA 4O2AB 5HWEA 3V4DA 5HY1A 1UFYA 1CK2A 5LYJB 3P4EA 1VQVA 4ZK7A 4RQOA 4O4IA 3FD5A 3JVHA 5LOVA 4O2BB 5HY0A 4TZZA 4ZHWA 5J2TA 5EIBD 1IV3A 1U3LA 4EB6B 5ITZA 4ZHQB 1CN7A 4I4TB 5KMGA 2VGMA 4WBNA 3CCQF 3V3TA 5G4UC 2Q1YA 3ZP4A 4C8GA 2YXZA 3JALB 4O4LB 3OW2F 1VQKF 2GLZA 1H48A 3NMUC 3C8LA 4BVSA 3LWRC 1VHAA 3OONA 1YIJF 4YJ3B 3JAKB 3CCRF 4LCKA 5G4VC 4BT2A 1VQMF 2LCAA 2DYYA 5BMVA 5JVDB 5A2QM 3G71F 1Q7YH 3AGKA 3WPWA 5GIPC 4IIJB 3SIUA 4YJ2A 3C9TA 1VQ8F 4TUYA 1M1KH 3IKEA 4ZHYB 3GYQA 5GIOC 5LP6A 4G88A 5JQGB 2VAMA 3S0HA 1ODEA 3R0PA 2Q1XA 3LWQC 1J7HA 4TV9B 2WALA 3HJWC 5KX5B 1YQNA 5JCOC 3RYHB 3KE1A 1X7PA 1SA0B 3WJQA 1X25A 1RQ2A 3CCSF 3EORA 4O4IB 1IV4A 1YI2F 5LOVB 3LDTA 3E1YA 3ZP7A 1KQSF 5J2TB 2H8CA 3N4YA 3F0GA 2I6RA 3VI6A 5HY4A 5ITZB 4I55A 5KMGB 3WGLA 3J80M 4WBNB 1VK3A 3C9UA 3E20B 3GTZA 1W5AA 5FNVA 1GO0A 3G6EF 2QA4F 3ERNA 2RHJA 2ALEA 3J7AR 1X52A 3QHDA 1U40A 5EWRA 4F6RA 4HNAA 3M1XA 1YHQF 3CYQA 3WXMB 3CPWF 3LFOA 2LBWA 3S02A 2EWCA 2ZODA 5BMVB 1OAPA 3HKEA 3WJPA 2QI2A 4TUYB 5GONA 5LP6B 1U3PA 5FJ4C 1VQ4F 3VYUC 3I56F 1T0AA 5GANK 2HP0A 4G4WA 1VQLF 5EB0A 3ZOPA 5IJ9A 3RYCA 2RHLA 1JY8A 1YGYA 3M84A 2MQEA 3MCAB 3DDNA 5JCOA 1KNJA 1W40A 4U3JA 1YJ9F 2FC3A 3JARA 1IV1A 3IMPA 2CHTA 1NQ3A 3WPXA 2I6DA 1VQPF 3UT5A 5CA1A 1RA4A 3TD5A 2DT4A 2HS3A 1XRGA 5HY2A 2ZF8A 2HS0A 3WGNA 1K9MH 4BVTA 5FNVB 3OBWA 5IJ0A 1K8AH 3N2KA 1FFXA 4X3MA 5HXUA 2NMUA 4BT4A 3CCEF 4U39A 3FD6A 3JCMM 3S0YA 4F6RB 4HNAB 1JFFA 1FNKA 3JATA 2HQSC 2B33A 4KWEA 4EI7A 3GHZA 3FBAA 3J81M 3CCJF 1ONIA 3CCMF 4G4ZA 3HKEB 4O4JA 5CB4A 1XHOA 3KJJA 3RYFA 4ZHVA 5GONB 4B5CA 1IV2A 2HP0B 2OHWA 1Z5WA 3E22A 5IJ9B 3V7EA 2HS4A 3RYCB 2Z1TA 3VCZA 1W55A 2H8EA 3KHNA 4U3JB 3DC2A 2IG8A 3JARB 1VQNF 4NQ3A 3ESJA 3CCUF 4NWOB 1UI9A 3KIZA 3UT5B 2W8BC 2KGWA 5CA1B 1YJNF 4ERHA 3HTNA 3IEQA 3K12A 1W3EX 5IJ0B 2UYNA 3N2KB 1FFXB 3NK6A 5JH7A 4BVRA 4BT5A 4E6EA 1JD1A 1GO1A 2KG4A 4X20A 5C8YA 5J2UA 1RLGA 3TD4A 5LA6A 4B45A 2LBTA 3C9RA 1JFFB 3F0DA 4C81A 3JATB 2L26A 5IT9M 3VMFB 2CSLA 4RHAA 4BT3A 3P10A 3RA6A 2Z01A 3S06A 3V7QA 1NMUB 1FNJA 3HKCA 3MCQA 5EZYA 3QTYA 3CG6A 4O4JB 3CB2A 1VQ7F 5CB4B 4B62A 4TV8A 3RYFB 2VAWA 3CD6F 2R6R1 3T80A 3HKDA 2UYKA 1KD1H 3VYSC 1QVGF 3CMEF 3HWUA 3CCLF 3MDOA 2OTMA 3E22B 2CHSA 1U43A 4O2AA 3TD3A 3S03A 1W581 1VH8A 4YJ2B 2PHNA 1VQOF 2OTLF 5DCVA 2ZOVA 3K0TA 3OBYA 2QTPA 1KNKA 4DRXA 2YYEA 4NUTA 1X7OA 3JASA 3WGMA 1SDSA 2N48A 4X1IA 2BO1A 3M4SA
chains in the Genus database with same CATH topology
3DC2A 4RQOA 1YGYA 2IQQA 3DDNA 2IAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DC2 A;  4RQO A;  1YGY A;  2IQQ A;  3DDN A;  2IAF A; 
#chains in the Genus database with same CATH topology
 1IPA A;  2BTO A;  4ZOL A;  1OFU A;  5EO3 A;  2UYN B;  3L7Q A;  3D01 A;  5JH7 B;  1S72 F;  2IAF A;  4O4H A;  3F6M A;  3JAW A;  3P0Z A;  3RYI A;  2AIF A;  4M8I A;  3VYT C;  4X20 B;  4BT7 A;  5C8Y B;  5LA6 B;  4X1K A;  1Q86 H;  4I55 B;  2Z1U A;  1JJ2 F;  2AMT A;  5EB1 B;  1FSZ A;  2HX0 A;  5HP8 A;  1COM A;  4BVQ A;  3K2X A;  2GVI A;  5EZY B;  4C82 A;  2PMP A;  3FFM A;  1VQ6 F;  4TV8 B;  3FPI A;  3NVK E;  4EI8 A;  3U0O A;  1W41 A;  2Z1F A;  2ZAU A;  1W2B F;  4LNU A;  1M90 H;  3HKD B;  5EAZ A;  4IHJ A;  3VO8 A;  3CC4 F;  3VOB A;  2KTV A;  1R1M A;  1SA0 A;  3VTI C;  4BY9 D;  3K14 A;  1W5F A;  3RA5 A;  5HP7 A;  4FFB A;  2RB9 A;  1TVK A;  3LWV C;  1XV2 A;  3MQW A;  1QVF F;  4DRX B;  3N2G A;  3SIV A;  3NK7 A;  4BT6 A;  4EI9 A;  3JAS B;  1QAH A;  1W59 A;  4X1I B;  4B46 A;  3VIU A;  2FGY A;  1QU9 A;  1H47 A;  2CWJ A;  3LME A;  4ZOL B;  1GX1 A;  4X3L A;  1SZQ A;  2QEX F;  2F9Z C;  5B8F A;  3LWP C;  3LWO C;  3WJR A;  3B6N A;  4O4H B;  4XCQ A;  3IEW A;  3JAW B;  4I50 A;  3RYI B;  2RHO A;  3I7T A;  3F0F A;  4X1K B;  1XBI A;  3LYB A;  3I55 F;  2R75 1;  2V9Y A;  1W5E A;  3Q8H A;  5FLX M;  4C8I A;  4ZI7 A;  3WGJ A;  2UYJ A;  5LXT A;  1E7K A;  3IKF A;  1YJW F;  2G9I A;  1W5B A;  2BTU A;  3CXC F;  2RHH A;  5EIB C;  1DBF A;  2OZB A;  1GZ0 A;  3CC7 F;  5CA0 A;  4G4Y A;  3BYQ A;  1W42 A;  2HRY A;  2K1S A;  2UYP A;  1QD9 A;  1YIT F;  3JAM M;  4LNU B;  2BTQ B;  4IHJ B;  3CPQ A;  1T0K B;  2HP3 A;  3QUW A;  3O85 A;  3PAF A;  1N8R H;  2JNB A;  3RE3 A;  5EYP A;  1RQ7 A;  3D00 A;  4FFB B;  1TVK B;  5AVM A;  2CW4 A;  3CYP B;  3N2G B;  4X1Y A;  3HAX D;  3MBM A;  1TUB A;  3HKB A;  2OTJ F;  3N4Z A;  5IYZ A;  3NVI B;  1NJI H;  2UZH A;  3PLA C;  1RLU A;  3ON1 A;  5MN5 A;  2Z1E A;  5GIN C;  5LYJ A;  2KTU A;  1PXW A;  2HVY D;  3ELC A;  3D54 A;  4O2B A;  2IQQ A;  2CVL A;  4I50 B;  4EB6 A;  5HXZ A;  4ZHQ A;  4R40 B;  4C4W C;  3VOA A;  4I4T A;  1Q81 H;  1K73 H;  1Z5V A;  3CC2 F;  3JAL A;  4O4L A;  4G4V A;  4ZI7 B;  3KJK A;  2P6Y A;  2H6L A;  4BW0 B;  5LXT B;  5MN6 A;  3CCV F;  3C9S A;  3I3F A;  1PF5 A;  2HRU A;  5J2U B;  5CA0 B;  2VGN A;  3ZO8 A;  4YJ3 A;  3JAK A;  1H7M A;  2ZVY A;  1ZWZ A;  3IR9 A;  2AIZ P;  4C8E A;  2VAP A;  5GAP K;  2CZW A;  1KC8 H;  5JVD A;  4PWT A;  1VQ9 F;  3HKC B;  5MN4 A;  3G4S F;  5LP6 C;  4IIJ A;  4DXD A;  1Q82 H;  3S0W A;  1W57 A;  3WGK A;  1DT9 A;  5EYP B;  3CMA F;  2LBX A;  2VXY A;  5JQG A;  3F0E A;  1JN1 A;  4G4X A;  4X1Y B;  4TV9 A;  1Q8R A;  1TUB B;  3HKB B;  5KX5 A;  5IYZ B;  2ZVZ A;  1VQ5 F;  3RYH A;  1CLI A;  2GZL A;  4O2A B;  5HWE A;  3V4D A;  5HY1 A;  1UFY A;  1CK2 A;  5LYJ B;  3P4E A;  1VQV A;  4ZK7 A;  4RQO A;  4O4I A;  3FD5 A;  3JVH A;  5LOV A;  4O2B B;  5HY0 A;  4TZZ A;  4ZHW A;  5J2T A;  5EIB D;  1IV3 A;  1U3L A;  4EB6 B;  5ITZ A;  4ZHQ B;  1CN7 A;  4I4T B;  5KMG A;  2VGM A;  4WBN A;  3CCQ F;  3V3T A;  5G4U C;  2Q1Y A;  3ZP4 A;  4C8G A;  2YXZ A;  3JAL B;  4O4L B;  3OW2 F;  1VQK F;  2GLZ A;  1H48 A;  3NMU C;  3C8L A;  4BVS A;  3LWR C;  1VHA A;  3OON A;  1YIJ F;  4YJ3 B;  3JAK B;  3CCR F;  4LCK A;  5G4V C;  4BT2 A;  1VQM F;  2LCA A;  2DYY A;  5BMV A;  5JVD B;  5A2Q M;  3G71 F;  1Q7Y H;  3AGK A;  3WPW A;  5GIP C;  4IIJ B;  3SIU A;  4YJ2 A;  3C9T A;  1VQ8 F;  4TUY A;  1M1K H;  3IKE A;  4ZHY B;  3GYQ A;  5GIO C;  5LP6 A;  4G88 A;  5JQG B;  2VAM A;  3S0H A;  1ODE A;  3R0P A;  2Q1X A;  3LWQ C;  1J7H A;  4TV9 B;  2WAL A;  3HJW C;  5KX5 B;  1YQN A;  5JCO C;  3RYH B;  3KE1 A;  1X7P A;  1SA0 B;  3WJQ A;  1X25 A;  1RQ2 A;  3CCS F;  3EOR A;  4O4I B;  1IV4 A;  1YI2 F;  5LOV B;  3LDT A;  3E1Y A;  3ZP7 A;  1KQS F;  5J2T B;  2H8C A;  3N4Y A;  3F0G A;  2I6R A;  3VI6 A;  5HY4 A;  5ITZ B;  4I55 A;  5KMG B;  3WGL A;  3J80 M;  4WBN B;  1VK3 A;  3C9U A;  3E20 B;  3GTZ A;  1W5A A;  5FNV A;  1GO0 A;  3G6E F;  2QA4 F;  3ERN A;  2RHJ A;  2ALE A;  3J7A R;  1X52 A;  3QHD A;  1U40 A;  5EWR A;  4F6R A;  4HNA A;  3M1X A;  1YHQ F;  3CYQ A;  3WXM B;  3CPW F;  3LFO A;  2LBW A;  3S02 A;  2EWC A;  2ZOD A;  5BMV B;  1OAP A;  3HKE A;  3WJP A;  2QI2 A;  4TUY B;  5GON A;  5LP6 B;  1U3P A;  5FJ4 C;  1VQ4 F;  3VYU C;  3I56 F;  1T0A A;  5GAN K;  2HP0 A;  4G4W A;  1VQL F;  5EB0 A;  3ZOP A;  5IJ9 A;  3RYC A;  2RHL A;  1JY8 A;  1YGY A;  3M84 A;  2MQE A;  3MCA B;  3DDN A;  5JCO A;  1KNJ A;  1W40 A;  4U3J A;  1YJ9 F;  2FC3 A;  3JAR A;  1IV1 A;  3IMP A;  2CHT A;  1NQ3 A;  3WPX A;  2I6D A;  1VQP F;  3UT5 A;  5CA1 A;  1RA4 A;  3TD5 A;  2DT4 A;  2HS3 A;  1XRG A;  5HY2 A;  2ZF8 A;  2HS0 A;  3WGN A;  1K9M H;  4BVT A;  5FNV B;  3OBW A;  5IJ0 A;  1K8A H;  3N2K A;  1FFX A;  4X3M A;  5HXU A;  2NMU A;  4BT4 A;  3CCE F;  4U39 A;  3FD6 A;  3JCM M;  3S0Y A;  4F6R B;  4HNA B;  1JFF A;  1FNK A;  3JAT A;  2HQS C;  2B33 A;  4KWE A;  4EI7 A;  3GHZ A;  3FBA A;  3J81 M;  3CCJ F;  1ONI A;  3CCM F;  4G4Z A;  3HKE B;  4O4J A;  5CB4 A;  1XHO A;  3KJJ A;  3RYF A;  4ZHV A;  5GON B;  4B5C A;  1IV2 A;  2HP0 B;  2OHW A;  1Z5W A;  3E22 A;  5IJ9 B;  3V7E A;  2HS4 A;  3RYC B;  2Z1T A;  3VCZ A;  1W55 A;  2H8E A;  3KHN A;  4U3J B;  3DC2 A;  2IG8 A;  3JAR B;  1VQN F;  4NQ3 A;  3ESJ A;  3CCU F;  4NWO B;  1UI9 A;  3KIZ A;  3UT5 B;  2W8B C;  2KGW A;  5CA1 B;  1YJN F;  4ERH A;  3HTN A;  3IEQ A;  3K12 A;  1W3E X;  5IJ0 B;  2UYN A;  3N2K B;  1FFX B;  3NK6 A;  5JH7 A;  4BVR A;  4BT5 A;  4E6E A;  1JD1 A;  1GO1 A;  2KG4 A;  4X20 A;  5C8Y A;  5J2U A;  1RLG A;  3TD4 A;  5LA6 A;  4B45 A;  2LBT A;  3C9R A;  1JFF B;  3F0D A;  4C81 A;  3JAT B;  2L26 A;  5IT9 M;  3VMF B;  2CSL A;  4RHA A;  4BT3 A;  3P10 A;  3RA6 A;  2Z01 A;  3S06 A;  3V7Q A;  1NMU B;  1FNJ A;  3HKC A;  3MCQ A;  5EZY A;  3QTY A;  3CG6 A;  4O4J B;  3CB2 A;  1VQ7 F;  5CB4 B;  4B62 A;  4TV8 A;  3RYF B;  2VAW A;  3CD6 F;  2R6R 1;  3T80 A;  3HKD A;  2UYK A;  1KD1 H;  3VYS C;  1QVG F;  3CME F;  3HWU A;  3CCL F;  3MDO A;  2OTM A;  3E22 B;  2CHS A;  1U43 A;  4O2A A;  3TD3 A;  3S03 A;  1W58 1;  1VH8 A;  4YJ2 B;  2PHN A;  1VQO F;  2OTL F;  5DCV A;  2ZOV A;  3K0T A;  3OBY A;  2QTP A;  1KNK A;  4DRX A;  2YYE A;  4NUT A;  1X7O A;  3JAS A;  3WGM A;  1SDS A;  2N48 A;  4X1I A;  2BO1 A;  3M4S A; 
#chains in the Genus database with same CATH homology
 3DC2 A;  4RQO A;  1YGY A;  2IQQ A;  3DDN A;  2IAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...