2IAFA

Crystal structure of a fragment (residues 11 to 161) of l-serine dehydratase from legionella pneumophila
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
140
Chain Sequence
SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein sdhL
total genus 39
structure length 140
sequence length 145
ec nomenclature
pdb deposition date 2006-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iafA00
4RQOA 1YGYA 2IQQA 3DDNA 3DC2A 2IAFA
chains in the Genus database with same CATH superfamily
4ZHYB 3WGLA 3VYUC 1Q86H 1N8RH 1JFFB 3N2GB 1ODEA 2OTMA 2GZLA 4F6RB 3JVHA 3F0FA 1NMUB 2HS3A 1H47A 3N2KA 4O4LA 5C8YB 2BO1A 1RLGA 3MCQA 3JATB 4LNUB 2B33A 2H6LA 5EZYB 1W5FA 5KMGA 3IKFA 2CVLA 2Q1XA 3RYCB 3WGNA 3DC2A 1DT9A 1IPAA 3WJQA 4E6EA 1Z5WA 4O4JB 1RA4A 4BY9D 3CCEF 1TVKB 1JD1A 3LMEA 2LCAA 3CG6A 1IV2A 3F0DA 3CCMF 3RE3A 3K2XA 2ZOVA 3N4ZA 5A2QM 4LNUA 5EWRA 3CCSF 3CPQA 4EB6B 2HS4A 5J2UA 3QTYA 4G88A 4WBNB 5BMVA 3TD5A 3VO8A 3IKEA 3JAMM 3C8LA 3VIUA 2ZAUA 3WPWA 1TUBA 1NQ3A 4BT4A 5JQGA 4X1KA 5JCOA 3J81M 1TVKA 3GYQA 2Z1TA 3IEWA 4X1YA 5GANK 2CSLA 3N2KB 5EAZA 5LP6C 3M4SA 1CK2A 4G4WA 1W5EA 5KMGB 3HKBA 3KJJA 5J2UB 4EB6A 3G4SF 5HP7A 5BMVB 3WXMB 5G4UC 1R1MA 5LXTA 1QVGF 5GONB 3LWQC 3R0PA 1JN1A 1RQ7A 4C8GA 1VQKF 3RYHB 5IYZA 1VQMF 2QI2A 1M1KH 1JJ2F 3ZO8A 3C9RA 4RHAA 3K0TA 2CZWA 2LBWA 1VK3A 2UYJA 3KJKA 3NMUC 2UZHA 4X1IB 3VCZA 4G4ZA 5J2TA 1W3EX 4O4IA 3WJPA 1GZ0A 1W581 4X1KB 4BVRA 2H8CA 5GIOC 1KNKA 4ZHQB 3CYQA 4C8IA 4PWTA 5IJ0A 2AIFA 2ZODA 3RYIB 4B62A 4TUYA 3S03A 3P0ZA 1QAHA 1CN7A 2EWCA 3J80M 4ZOLA 3LFOA 5GAPK 4TV8A 2RHJA 4BW0B 3ZOPA 5EO3A 4IHJA 3V7QA 4BT7A 5LXTB 2Z1UA 4O4IB 3ON1A 1UI9A 4O2AA 1VHAA 3JAWA 5IYZB 3QHDA 1GO0A 4O4HB 5EB1B 5IT9M 2LBTA 1J7HA 1W41A 1KD1H 2KGWA 3G6EF 5HXUA 3NVIB 1FNKA 1H7MA 3HKEB 2F9ZC 2CWJA 1VQ5F 5LYJB 1E7KA 4I55B 4IHJB 3C9UA 3VMFB 2GVIA 3I55F 3ESJA 4YJ3A 2QEXF 4O2BB 3IEQA 5LA6B 3S0YA 1GO1A 3BYQA 3NK7A 3L7QA 1PF5A 4TUYB 3CC4F 4HNAA 2CHSA 1VQ8F 2N48A 4ZOLB 1X7PA 4X3MA 1X52A 3VTIC 1YIJF 5HP8A 1K73H 4TV8B 3HKDA 5LOVA 1YHQF 2HVYD 3HAXD 3KE1A 3HKCA 4I55A 3RA6A 4DRXB 4G4VA 4I4TB 3WJRA 4G4YA 1U3LA 4EI7A 2CHTA 1QU9A 3E22B 5ITZA 1DBFA 2QA4F 1VQ7F 3V4DA 4ERHA 1K8AH 5LA6A 3VOBA 2OZBA 2RB9A 2YXZA 4FFBA 2UYKA 2OTJF 1X25A 5G4VC 5DCVA 4X20A 5CA0B 3V3TA 5CA1B 3CXCF 1H48A 3HKEA 5IJ9B 2DT4A 1IV1A 1ONIA 3HJWC 3OONA 3KHNA 1VH8A 2PMPA 3LYBA 3CCUF 5MN6A 5LP6A 1VQPF 4BT5A 1U40A 3JAKA 4B45A 2CW4A 4X3LA 2HP0A 2BTOA 2I6RA 3O85A 1YI2F 3VOAA 1T0KB 5KX5B 5CA1A 3K12A 3JCMM 3LWVC 3ERNA 3C9TA 1T0AA 4U3JB 3S02A 2RHHA 5ITZB 1IV3A 5EB0A 3SIVA 2VGMA 4G4XA 4IIJA 5LP6B 2Z1EA 3MCAB 3JAKB 3CPWF 1Z5VA 3CCLF 1W42A 4C81A 5JCOC 3RYCA 2IQQA 3JALA 1KNJA 2Z01A 2AMTA 1XBIA 5JQGB 2FC3A 1QVFF 2UYPA 3CCVF 3FD6A 1OFUA 2HP0B 2VAWA 1YITF 4R40B 4ZHWA 2KTVA 2OHWA 2Q1YA 3E20B 3HWUA 3IR9A 3LDTA 3M84A 4U39A 3QUWA 1TUBB 5CB4B 1XRGA 3I56F 2BTQB 5FNVB 2FGYA 2R6R1 4U3JA 3C9SA 3RYHA 5JVDA 4X1YB 1W55A 4TV9B 2HX0A 3DDNA 3RYFA 4I50B 3OW2F 1SA0B 2JNBA 2K1SA 3OBWA 4YJ2A 3CCJF 1M90H 3JASA 5FLXM 2G9IA 4X1IA 3M1XA 2HRUA 2QTPA 3CMAF 1JFFA 3N2GA 2RHOA 3IMPA 2HRYA 1K9MH 1CLIA 3N4YA 4ZHQA 3WGKA 2DYYA 1W57A 1XHOA 3WGJA 4BVTA 3CD6F 4I50A 5EZYA 5HWEA 1VQ6F 1SA0A 2VXYA 4YJ2B 1SDSA 3CB2A 2HP3A 3U0OA 3VYSC 2I6DA 1Q82H 3TD4A 5EIBC 5J2TB 3HTNA 1W5AA 4O4JA 5FNVA 3LWOC 2RHLA 3D01A 2PHNA 2MQEA 3MQWA 1XV2A 2R751 3ZP7A 4TV9A 3S0HA 3T80A 3RYFB 2P6YA 3CYPB 3NVKE 1KQSF 3FD5A 3JASB 3HKBB 4WBNA 1ZWZA 1X7OA 3JARB 2H8EA 1FSZA 4XCQA 5HY1A 5GONA 4O2AB 1YJNF 1RLUA 4BT2A 1W40A 3MBMA 5JH7A 3OBYA 3Q8HA 1YJ9F 4O4HA 4BT3A 2UYNB 2L26A 3UT5B 4BVSA 2VAPA 4C82A 4EI9A 4DXDA 3HKDB 5LOVB 1Q7YH 3JARA 4LCKA 3PLAC 1S72F 2HS0A 3FFMA 4DRXA 4EI8A 1GX1A 2ZVZA 3GTZA 4O2BA 4C4WC 2KTUA 2ALEA 5IJ0B 1U3PA 2NMUA 3MDOA 4HNAB 2WALA 2UYNA 1UFYA 5MN5A 3UT5A 2GLZA 2LBXA 3CCQF 3P4EA 4B46A 1VQLF 3HKCB 2OTLF 3K14A 5HY4A 2HQSC 1NJIH 1FFXA 3WPXA 3FBAA 1RQ2A 5JH7B 3E22A 3CC2F 3KIZA 4BT6A 3EORA 3VYTC 1W2BF 3B6NA 1KC8H 3JAWB 3F0EA 4M8IA 3D54A 3WGMA 4BVQA 3RYIA 1PXWA 3RA5A 1COMA 3ELCA 4X20B 3LWRC 1Q81H 5KX5A 4NWOB 5MN4A 3SIUA 3F6MA 3AGKA 3J7AR 5LYJA 1YJWF 3V7EA 1FFXB 3TD3A 1Q8RA 3GHZA 4YJ3B 5HXZA 3CC7F 4NQ3A 2YYEA 3E1YA 3I3FA 3S06A 5GINC 1YQNA 2AIZP 1W5BA 3S0WA 2VAMA 2W8BC 3ZP4A 2V9YA 4ZI7A 3JALB 1IV4A 4KWEA 4ZK7A 5GIPC 1VQVA 5FJ4C 3VI6A 5AVMA 3FPIA 5B8FA 5HY0A 4F6RA 1VQOF 3G71F 4I4TA 3D00A 4O4LB 4IIJB 4ZHVA 3LWPC 5EYPA 2Z1FA 4C8EA 5HY2A 2VGNA 1VQ9F 4FFBB 1W59A 2IG8A 3I7TA 2IAFA 1VQ4F 5IJ9A 2KG4A 1VQNF 4TZZA 2ZF8A 2ZVYA 3F0GA 1OAPA 3NK6A 4ZI7B 5CB4A 3P10A 1JY8A 2BTUA 5EIBD 1YGYA 5JVDB 5C8YA 4B5CA 1FNJA 1QD9A 4RQOA 3JATA 3CMEF 5EYPB 1U43A 1SZQA 4NUTA 3CCRF 5CA0A 3PAFA
chains in the Genus database with same CATH topology
4RQOA 1YGYA 2IQQA 3DDNA 3DC2A 2IAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQO A;  1YGY A;  2IQQ A;  3DDN A;  3DC2 A;  2IAF A; 
#chains in the Genus database with same CATH topology
 4ZHY B;  3WGL A;  3VYU C;  1Q86 H;  1N8R H;  1JFF B;  3N2G B;  1ODE A;  2OTM A;  2GZL A;  4F6R B;  3JVH A;  3F0F A;  1NMU B;  2HS3 A;  1H47 A;  3N2K A;  4O4L A;  5C8Y B;  2BO1 A;  1RLG A;  3MCQ A;  3JAT B;  4LNU B;  2B33 A;  2H6L A;  5EZY B;  1W5F A;  5KMG A;  3IKF A;  2CVL A;  2Q1X A;  3RYC B;  3WGN A;  3DC2 A;  1DT9 A;  1IPA A;  3WJQ A;  4E6E A;  1Z5W A;  4O4J B;  1RA4 A;  4BY9 D;  3CCE F;  1TVK B;  1JD1 A;  3LME A;  2LCA A;  3CG6 A;  1IV2 A;  3F0D A;  3CCM F;  3RE3 A;  3K2X A;  2ZOV A;  3N4Z A;  5A2Q M;  4LNU A;  5EWR A;  3CCS F;  3CPQ A;  4EB6 B;  2HS4 A;  5J2U A;  3QTY A;  4G88 A;  4WBN B;  5BMV A;  3TD5 A;  3VO8 A;  3IKE A;  3JAM M;  3C8L A;  3VIU A;  2ZAU A;  3WPW A;  1TUB A;  1NQ3 A;  4BT4 A;  5JQG A;  4X1K A;  5JCO A;  3J81 M;  1TVK A;  3GYQ A;  2Z1T A;  3IEW A;  4X1Y A;  5GAN K;  2CSL A;  3N2K B;  5EAZ A;  5LP6 C;  3M4S A;  1CK2 A;  4G4W A;  1W5E A;  5KMG B;  3HKB A;  3KJJ A;  5J2U B;  4EB6 A;  3G4S F;  5HP7 A;  5BMV B;  3WXM B;  5G4U C;  1R1M A;  5LXT A;  1QVG F;  5GON B;  3LWQ C;  3R0P A;  1JN1 A;  1RQ7 A;  4C8G A;  1VQK F;  3RYH B;  5IYZ A;  1VQM F;  2QI2 A;  1M1K H;  1JJ2 F;  3ZO8 A;  3C9R A;  4RHA A;  3K0T A;  2CZW A;  2LBW A;  1VK3 A;  2UYJ A;  3KJK A;  3NMU C;  2UZH A;  4X1I B;  3VCZ A;  4G4Z A;  5J2T A;  1W3E X;  4O4I A;  3WJP A;  1GZ0 A;  1W58 1;  4X1K B;  4BVR A;  2H8C A;  5GIO C;  1KNK A;  4ZHQ B;  3CYQ A;  4C8I A;  4PWT A;  5IJ0 A;  2AIF A;  2ZOD A;  3RYI B;  4B62 A;  4TUY A;  3S03 A;  3P0Z A;  1QAH A;  1CN7 A;  2EWC A;  3J80 M;  4ZOL A;  3LFO A;  5GAP K;  4TV8 A;  2RHJ A;  4BW0 B;  3ZOP A;  5EO3 A;  4IHJ A;  3V7Q A;  4BT7 A;  5LXT B;  2Z1U A;  4O4I B;  3ON1 A;  1UI9 A;  4O2A A;  1VHA A;  3JAW A;  5IYZ B;  3QHD A;  1GO0 A;  4O4H B;  5EB1 B;  5IT9 M;  2LBT A;  1J7H A;  1W41 A;  1KD1 H;  2KGW A;  3G6E F;  5HXU A;  3NVI B;  1FNK A;  1H7M A;  3HKE B;  2F9Z C;  2CWJ A;  1VQ5 F;  5LYJ B;  1E7K A;  4I55 B;  4IHJ B;  3C9U A;  3VMF B;  2GVI A;  3I55 F;  3ESJ A;  4YJ3 A;  2QEX F;  4O2B B;  3IEQ A;  5LA6 B;  3S0Y A;  1GO1 A;  3BYQ A;  3NK7 A;  3L7Q A;  1PF5 A;  4TUY B;  3CC4 F;  4HNA A;  2CHS A;  1VQ8 F;  2N48 A;  4ZOL B;  1X7P A;  4X3M A;  1X52 A;  3VTI C;  1YIJ F;  5HP8 A;  1K73 H;  4TV8 B;  3HKD A;  5LOV A;  1YHQ F;  2HVY D;  3HAX D;  3KE1 A;  3HKC A;  4I55 A;  3RA6 A;  4DRX B;  4G4V A;  4I4T B;  3WJR A;  4G4Y A;  1U3L A;  4EI7 A;  2CHT A;  1QU9 A;  3E22 B;  5ITZ A;  1DBF A;  2QA4 F;  1VQ7 F;  3V4D A;  4ERH A;  1K8A H;  5LA6 A;  3VOB A;  2OZB A;  2RB9 A;  2YXZ A;  4FFB A;  2UYK A;  2OTJ F;  1X25 A;  5G4V C;  5DCV A;  4X20 A;  5CA0 B;  3V3T A;  5CA1 B;  3CXC F;  1H48 A;  3HKE A;  5IJ9 B;  2DT4 A;  1IV1 A;  1ONI A;  3HJW C;  3OON A;  3KHN A;  1VH8 A;  2PMP A;  3LYB A;  3CCU F;  5MN6 A;  5LP6 A;  1VQP F;  4BT5 A;  1U40 A;  3JAK A;  4B45 A;  2CW4 A;  4X3L A;  2HP0 A;  2BTO A;  2I6R A;  3O85 A;  1YI2 F;  3VOA A;  1T0K B;  5KX5 B;  5CA1 A;  3K12 A;  3JCM M;  3LWV C;  3ERN A;  3C9T A;  1T0A A;  4U3J B;  3S02 A;  2RHH A;  5ITZ B;  1IV3 A;  5EB0 A;  3SIV A;  2VGM A;  4G4X A;  4IIJ A;  5LP6 B;  2Z1E A;  3MCA B;  3JAK B;  3CPW F;  1Z5V A;  3CCL F;  1W42 A;  4C81 A;  5JCO C;  3RYC A;  2IQQ A;  3JAL A;  1KNJ A;  2Z01 A;  2AMT A;  1XBI A;  5JQG B;  2FC3 A;  1QVF F;  2UYP A;  3CCV F;  3FD6 A;  1OFU A;  2HP0 B;  2VAW A;  1YIT F;  4R40 B;  4ZHW A;  2KTV A;  2OHW A;  2Q1Y A;  3E20 B;  3HWU A;  3IR9 A;  3LDT A;  3M84 A;  4U39 A;  3QUW A;  1TUB B;  5CB4 B;  1XRG A;  3I56 F;  2BTQ B;  5FNV B;  2FGY A;  2R6R 1;  4U3J A;  3C9S A;  3RYH A;  5JVD A;  4X1Y B;  1W55 A;  4TV9 B;  2HX0 A;  3DDN A;  3RYF A;  4I50 B;  3OW2 F;  1SA0 B;  2JNB A;  2K1S A;  3OBW A;  4YJ2 A;  3CCJ F;  1M90 H;  3JAS A;  5FLX M;  2G9I A;  4X1I A;  3M1X A;  2HRU A;  2QTP A;  3CMA F;  1JFF A;  3N2G A;  2RHO A;  3IMP A;  2HRY A;  1K9M H;  1CLI A;  3N4Y A;  4ZHQ A;  3WGK A;  2DYY A;  1W57 A;  1XHO A;  3WGJ A;  4BVT A;  3CD6 F;  4I50 A;  5EZY A;  5HWE A;  1VQ6 F;  1SA0 A;  2VXY A;  4YJ2 B;  1SDS A;  3CB2 A;  2HP3 A;  3U0O A;  3VYS C;  2I6D A;  1Q82 H;  3TD4 A;  5EIB C;  5J2T B;  3HTN A;  1W5A A;  4O4J A;  5FNV A;  3LWO C;  2RHL A;  3D01 A;  2PHN A;  2MQE A;  3MQW A;  1XV2 A;  2R75 1;  3ZP7 A;  4TV9 A;  3S0H A;  3T80 A;  3RYF B;  2P6Y A;  3CYP B;  3NVK E;  1KQS F;  3FD5 A;  3JAS B;  3HKB B;  4WBN A;  1ZWZ A;  1X7O A;  3JAR B;  2H8E A;  1FSZ A;  4XCQ A;  5HY1 A;  5GON A;  4O2A B;  1YJN F;  1RLU A;  4BT2 A;  1W40 A;  3MBM A;  5JH7 A;  3OBY A;  3Q8H A;  1YJ9 F;  4O4H A;  4BT3 A;  2UYN B;  2L26 A;  3UT5 B;  4BVS A;  2VAP A;  4C82 A;  4EI9 A;  4DXD A;  3HKD B;  5LOV B;  1Q7Y H;  3JAR A;  4LCK A;  3PLA C;  1S72 F;  2HS0 A;  3FFM A;  4DRX A;  4EI8 A;  1GX1 A;  2ZVZ A;  3GTZ A;  4O2B A;  4C4W C;  2KTU A;  2ALE A;  5IJ0 B;  1U3P A;  2NMU A;  3MDO A;  4HNA B;  2WAL A;  2UYN A;  1UFY A;  5MN5 A;  3UT5 A;  2GLZ A;  2LBX A;  3CCQ F;  3P4E A;  4B46 A;  1VQL F;  3HKC B;  2OTL F;  3K14 A;  5HY4 A;  2HQS C;  1NJI H;  1FFX A;  3WPX A;  3FBA A;  1RQ2 A;  5JH7 B;  3E22 A;  3CC2 F;  3KIZ A;  4BT6 A;  3EOR A;  3VYT C;  1W2B F;  3B6N A;  1KC8 H;  3JAW B;  3F0E A;  4M8I A;  3D54 A;  3WGM A;  4BVQ A;  3RYI A;  1PXW A;  3RA5 A;  1COM A;  3ELC A;  4X20 B;  3LWR C;  1Q81 H;  5KX5 A;  4NWO B;  5MN4 A;  3SIU A;  3F6M A;  3AGK A;  3J7A R;  5LYJ A;  1YJW F;  3V7E A;  1FFX B;  3TD3 A;  1Q8R A;  3GHZ A;  4YJ3 B;  5HXZ A;  3CC7 F;  4NQ3 A;  2YYE A;  3E1Y A;  3I3F A;  3S06 A;  5GIN C;  1YQN A;  2AIZ P;  1W5B A;  3S0W A;  2VAM A;  2W8B C;  3ZP4 A;  2V9Y A;  4ZI7 A;  3JAL B;  1IV4 A;  4KWE A;  4ZK7 A;  5GIP C;  1VQV A;  5FJ4 C;  3VI6 A;  5AVM A;  3FPI A;  5B8F A;  5HY0 A;  4F6R A;  1VQO F;  3G71 F;  4I4T A;  3D00 A;  4O4L B;  4IIJ B;  4ZHV A;  3LWP C;  5EYP A;  2Z1F A;  4C8E A;  5HY2 A;  2VGN A;  1VQ9 F;  4FFB B;  1W59 A;  2IG8 A;  3I7T A;  2IAF A;  1VQ4 F;  5IJ9 A;  2KG4 A;  1VQN F;  4TZZ A;  2ZF8 A;  2ZVY A;  3F0G A;  1OAP A;  3NK6 A;  4ZI7 B;  5CB4 A;  3P10 A;  1JY8 A;  2BTU A;  5EIB D;  1YGY A;  5JVD B;  5C8Y A;  4B5C A;  1FNJ A;  1QD9 A;  4RQO A;  3JAT A;  3CME F;  5EYP B;  1U43 A;  1SZQ A;  4NUT A;  3CCR F;  5CA0 A;  3PAF A; 
#chains in the Genus database with same CATH homology
 4RQO A;  1YGY A;  2IQQ A;  3DDN A;  3DC2 A;  2IAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...