2IAFA

Crystal structure of a fragment (residues 11 to 161) of l-serine dehydratase from legionella pneumophila
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
140
Chain Sequence
SSHTVGPMLAANAFLQLLEQKNLFDKTQRVKVELYGSLALTGKGHGTDKAILNGLENKAPESMIPRMHEILDSNLLNLAGKKEIPFHEATDFLFLQKELLPKHSNGMRFSAFDGNANLLIEQVYYSIGGGFITTEEDFDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein sdhL
publication title Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
total genus 39
structure length 140
sequence length 145
ec nomenclature
pdb deposition date 2006-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.90 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; D-3-phosphoglycerate dehydrogenase; domain 3 2iafA00
4RQOA 2IAFA 3DDNA 2IQQA 3DC2A 1YGYA
chains in the Genus database with same CATH superfamily
3F0DA 3S06A 2CHTA 2R6R1 1XV2A 3WJQA 3JVHA 1Q86H 2GZLA 3WPWA 3CXCF 2ALEA 1ONIA 4BVTA 4HNAB 5MN6A 1E7KA 1VQPF 5HP8A 2Z1UA 2K1SA 1RLGA 3S0YA 3OBWA 1QD9A 3PLAC 3LMEA 5JVDB 1QVFF 2UYNA 4O4LB 2Z01A 5LA6B 5IT9M 4FFBB 3RYFB 5KMGA 3HKDA 1IV3A 3JARB 4O2BB 3WGKA 2KGWA 2AMTA 1K73H 4BT6A 4C4WC 1ZWZA 4BT7A 4G4ZA 1RLUA 1YJNF 2Z1FA 5JCOC 2HP3A 3N2KB 3NK6A 2RB9A 2VGMA 2QEXF 3WGLA 3G71F 5HY0A 2CVLA 1X7PA 4HNAA 3F0GA 5LP6B 4O4IB 4BVSA 5EWRA 3F6MA 5GINC 3MQWA 3NVIB 2NMUA 3G4SF 3C9UA 3GTZA 3K12A 3RE3A 5HWEA 3P4EA 1K8AH 2CHSA 5JVDA 3I3FA 4O4LA 2VAMA 5LA6A 3MBMA 4F6RB 3IKEA 4G4WA 3RYFA 2PMPA 4C82A 1FFXB 4U3JB 5GIPC 3JARA 1W59A 4O2BA 1W2BF 3CG6A 1XBIA 3ZO8A 4X1YA 4C8GA 4BVQA 3WJPA 2L26A 3VOBA 1W581 3CCVF 3ZP7A 3CCEF 2LCAA 3JATB 2ZODA 3FFMA 3CCJF 4ZHWA 3CMEF 3JALA 1VQOF 2QA4F 4R40B 3LFOA 1NJIH 3HKCB 1FSZA 4ERHA 3TD4A 5KX5A 4EB6A 3QUWA 1H48A 3LDTA 1DT9A 5HY1A 3M84A 4ZHYB 5LP6A 4ZOLA 4O4IA 1M1KH 1QVGF 2LBXA 5JQGA 1NQ3A 3ELCA 2Q1XA 1CN7A 1FNKA 2ZVYA 4TV8B 1VQ5F 2HS3A 2RHLA 3E22A 5EZYB 1VQ9F 3VI6A 2H8CA 1W42A 3G6EF 3NMUC 2YXZA 2GVIA 4F6RA 3CC7F 1Q8RA 1FFXA 2N48A 4U3JA 4O4HB 2QI2A 5KMGB 2IAFA 1KQSF 3ERNA 4IIJB 3WGNA 4ZHVA 3HAXD 5G4UC 2QTPA 2JNBA 2AIZP 4PWTA 2OZBA 3N2GB 1X52A 1S72F 3JATA 3IEWA 2HVYD 2HS0A 5JCOA 3WPXA 3CCMF 2B33A 2RHJA 3P0ZA 3HKCA 3VYSC 3RYCA 1SZQA 3C8LA 1Z5VA 2ZAUA 4NQ3A 1GO1A 2HRUA 3S02A 3C9SA 4B46A 3KJKA 3J7AR 3GYQA 1OAPA 1U3PA 3VO8A 1QU9A 1TUBA 2DT4A 4XCQA 4TV8A 4NWOB 3VCZA 1J7HA 1CK2A 5EIBC 3NVKE 5EZYA 1IPAA 3F0FA 5HY4A 3J81M 4EI9A 3VTIC 3NK7A 3M1XA 4O4HA 4E6EA 2OTMA 3MCQA 3VOAA 3HWUA 4IIJA 3HKBA 4X1YB 1W5EA 4EI8A 1VQ6F 1RA4A 4TV9A 3RA5A 1X25A 5GONB 1W5FA 3HTNA 1XRGA 5EB1B 5EB0A 5GANK 5IJ9B 3N2GA 5CA1B 5LOVA 3JCMM 2OTJF 1KNKA 3CMAF 2H6LA 3IR9A 5FNVB 2PHNA 2VXYA 5EYPB 1ODEA 2V9YA 3K2XA 3JALB 3S0WA 3I55F 2MQEA 4X3MA 3E20B 4EI7A 5KX5B 4EB6B 1GZ0A 2DYYA 5J2TB 3MDOA 4ZOLB 1VHAA 5J2UB 3LWPC 2FC3A 4RHAA 5JQGB 4LNUA 4TUYB 1VQKF 3GHZA 1IV2A 1SA0B 5IYZB 3E22B 2Q1YA 2IG8A 5MN4A 4BT4A 5B8FA 4I4TB 2W8BC 3HKEB 1QAHA 3TD3A 3O85A 2UZHA 2VAWA 5GONA 4I50B 3VYUC 1PF5A 3SIUA 2RHHA 4WBNB 4X1IB 4ZK7A 5IJ9A 5CA1A 2I6RA 3CYQA 1UI9A 1YITF 5FNVA 4O4JB 4G4VA 1VQ7F 5EYPA 4RQOA 5IJ0B 4X20B 3KJJA 4DXDA 3RYCB 3RA6A 3KHNA 3AGKA 2HS4A 5G4VC 2UYPA 1XHOA 5J2TA 4BVRA 5J2UA 2GLZA 3DC2A 2OHWA 4TUYA 4TZZA 1JY8A 1JD1A 3F0EA 1TUBB 1R1MA 4G4YA 3FD5A 1SA0A 5JH7B 2CZWA 5IYZA 3OW2F 1W5BA 2VAPA 5C8YB 1X7OA 2YYEA 4B45A 2G9IA 4I55B 2OTLF 1W3EX 3MCAB 5DCVA 2CSLA 3C9TA 1Q82H 4I4TA 3E1YA 3ESJA 3HKEA 4BT5A 3V7QA 2UYJA 3VIUA 1OFUA 3EORA 3ZP4A 3HKBB 4ZHQA 3K14A 3IMPA 3CPWF 5HY2A 3KIZA 4TV9B 3LWRC 4I50A 1YJ9F 4C8EA 1TVKB 2WALA 4X1IA 4WBNA 1U3LA 4BW0B 2I6DA 5LOVB 3WXMB 1VQLF 3CPQA 4O4JA 1IV4A 3CC4F 5IJ0A 2ZVZA 3SIVA 4X20A 5A2QM 4BT3A 3V4DA 1K9MH 1GX1A 3UT5B 4IHJB 3V7EA 1UFYA 5ITZB 3CYPB 3T80A 5FLXM 2FGYA 2RHOA 4LNUB 3WJRA 5JH7A 3VMFB 3VYTC 1YHQF 3JASB 5C8YA 2HP0B 3CD6F 1CLIA 3B6NA 1U43A 3I7TA 4I55A 4X3LA 3JAWB 1JN1A 1YQNA 4O2AB 5LP6C 1RQ2A 4ZI7B 2IQQA 1T0KB 1TVKA 3KE1A 1W41A 1W40A 3CCLF 1JFFA 3OONA 2VGNA 5GIOC 4YJ3B 5BMVB 1KD1H 2BO1A 4X1KA 1YIJF 5EO3A 4C8IA 3K0TA 1U40A 5HP7A 3FD6A 3CCRF 3UT5A 1Q7YH 5FJ4C 4IHJA 3LWVC 2F9ZC 5HXZA 5ITZA 3JAMM 1M90H 5LYJB 5AVMA 3RYHA 3JAKB 4YJ2B 2KTUA 3CB2A 2P6YA 3C9RA 3FBAA 5EAZA 1YGYA 3RYIA 4B5CA 1GO0A 4B62A 3JASA 2HP0A 3DDNA 2EWCA 3ZOPA 3QHDA 3S0HA 2CW4A 3WGJA 3JAWA 2R751 2H8EA 5CA0B 5LXTB 2ZOVA 2HQSC 1RQ7A 3IEQA 4G88A 4O2AA 5MN5A 4ZHQB 4DRXB 2KTVA 4ZI7A 3J80M 3CCSF 3U0OA 2AIFA 3N4ZA 3Q8HA 1PXWA 3L7QA 1W57A 2HRYA 3LYBA 3R0PA 1YI2F 4YJ3A 3D54A 5BMVA 3LWOC 3PAFA 5GAPK 4FFBA 1VQVA 3D01A 1VQ4F 3ON1A 3P10A 3TD5A 4C81A 3CCUF 1FNJA 3I56F 2BTOA 3HJWC 5CB4B 5LYJA 2ZF8A 3JAKA 4YJ2A 3N4YA 1T0AA 4G4XA 1VQMF 1NMUB 3OBYA 3D00A 3N2KA 1Z5WA 1VK3A 1KNJA 5CA0A 3V3TA 5LXTA 1VQNF 3BYQA 1VQ8F 3FPIA 2LBWA 1VH8A 4DRXA 1W55A 4BT2A 1H7MA 1IV1A 2KG4A 1N8RH 3QTYA 3IKFA 1JFFB 2CWJA 4NUTA 4BY9D 4M8IA 2UYNB 2Z1EA 3CC2F 1YJWF 1JJ2F 2BTQB 1SDSA 4X1KB 3S03A 3M4SA 5EIBD 3WGMA 3HKDB 1Q81H 4KWEA 2BTUA 2Z1TA 5HXUA 5CB4A 4LCKA 1KC8H 3RYHB 1DBFA 2UYKA 3RYIB 1H47A 1W5AA 2HX0A 3LWQC 4U39A 2LBTA 3CCQF 1COMA
chains in the Genus database with same CATH topology
4RQOA 2IAFA 3DDNA 2IQQA 3DC2A 1YGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQO A;  2IAF A;  3DDN A;  2IQQ A;  3DC2 A;  1YGY A; 
#chains in the Genus database with same CATH topology
 3F0D A;  3S06 A;  2CHT A;  2R6R 1;  1XV2 A;  3WJQ A;  3JVH A;  1Q86 H;  2GZL A;  3WPW A;  3CXC F;  2ALE A;  1ONI A;  4BVT A;  4HNA B;  5MN6 A;  1E7K A;  1VQP F;  5HP8 A;  2Z1U A;  2K1S A;  1RLG A;  3S0Y A;  3OBW A;  1QD9 A;  3PLA C;  3LME A;  5JVD B;  1QVF F;  2UYN A;  4O4L B;  2Z01 A;  5LA6 B;  5IT9 M;  4FFB B;  3RYF B;  5KMG A;  3HKD A;  1IV3 A;  3JAR B;  4O2B B;  3WGK A;  2KGW A;  2AMT A;  1K73 H;  4BT6 A;  4C4W C;  1ZWZ A;  4BT7 A;  4G4Z A;  1RLU A;  1YJN F;  2Z1F A;  5JCO C;  2HP3 A;  3N2K B;  3NK6 A;  2RB9 A;  2VGM A;  2QEX F;  3WGL A;  3G71 F;  5HY0 A;  2CVL A;  1X7P A;  4HNA A;  3F0G A;  5LP6 B;  4O4I B;  4BVS A;  5EWR A;  3F6M A;  5GIN C;  3MQW A;  3NVI B;  2NMU A;  3G4S F;  3C9U A;  3GTZ A;  3K12 A;  3RE3 A;  5HWE A;  3P4E A;  1K8A H;  2CHS A;  5JVD A;  3I3F A;  4O4L A;  2VAM A;  5LA6 A;  3MBM A;  4F6R B;  3IKE A;  4G4W A;  3RYF A;  2PMP A;  4C82 A;  1FFX B;  4U3J B;  5GIP C;  3JAR A;  1W59 A;  4O2B A;  1W2B F;  3CG6 A;  1XBI A;  3ZO8 A;  4X1Y A;  4C8G A;  4BVQ A;  3WJP A;  2L26 A;  3VOB A;  1W58 1;  3CCV F;  3ZP7 A;  3CCE F;  2LCA A;  3JAT B;  2ZOD A;  3FFM A;  3CCJ F;  4ZHW A;  3CME F;  3JAL A;  1VQO F;  2QA4 F;  4R40 B;  3LFO A;  1NJI H;  3HKC B;  1FSZ A;  4ERH A;  3TD4 A;  5KX5 A;  4EB6 A;  3QUW A;  1H48 A;  3LDT A;  1DT9 A;  5HY1 A;  3M84 A;  4ZHY B;  5LP6 A;  4ZOL A;  4O4I A;  1M1K H;  1QVG F;  2LBX A;  5JQG A;  1NQ3 A;  3ELC A;  2Q1X A;  1CN7 A;  1FNK A;  2ZVY A;  4TV8 B;  1VQ5 F;  2HS3 A;  2RHL A;  3E22 A;  5EZY B;  1VQ9 F;  3VI6 A;  2H8C A;  1W42 A;  3G6E F;  3NMU C;  2YXZ A;  2GVI A;  4F6R A;  3CC7 F;  1Q8R A;  1FFX A;  2N48 A;  4U3J A;  4O4H B;  2QI2 A;  5KMG B;  2IAF A;  1KQS F;  3ERN A;  4IIJ B;  3WGN A;  4ZHV A;  3HAX D;  5G4U C;  2QTP A;  2JNB A;  2AIZ P;  4PWT A;  2OZB A;  3N2G B;  1X52 A;  1S72 F;  3JAT A;  3IEW A;  2HVY D;  2HS0 A;  5JCO A;  3WPX A;  3CCM F;  2B33 A;  2RHJ A;  3P0Z A;  3HKC A;  3VYS C;  3RYC A;  1SZQ A;  3C8L A;  1Z5V A;  2ZAU A;  4NQ3 A;  1GO1 A;  2HRU A;  3S02 A;  3C9S A;  4B46 A;  3KJK A;  3J7A R;  3GYQ A;  1OAP A;  1U3P A;  3VO8 A;  1QU9 A;  1TUB A;  2DT4 A;  4XCQ A;  4TV8 A;  4NWO B;  3VCZ A;  1J7H A;  1CK2 A;  5EIB C;  3NVK E;  5EZY A;  1IPA A;  3F0F A;  5HY4 A;  3J81 M;  4EI9 A;  3VTI C;  3NK7 A;  3M1X A;  4O4H A;  4E6E A;  2OTM A;  3MCQ A;  3VOA A;  3HWU A;  4IIJ A;  3HKB A;  4X1Y B;  1W5E A;  4EI8 A;  1VQ6 F;  1RA4 A;  4TV9 A;  3RA5 A;  1X25 A;  5GON B;  1W5F A;  3HTN A;  1XRG A;  5EB1 B;  5EB0 A;  5GAN K;  5IJ9 B;  3N2G A;  5CA1 B;  5LOV A;  3JCM M;  2OTJ F;  1KNK A;  3CMA F;  2H6L A;  3IR9 A;  5FNV B;  2PHN A;  2VXY A;  5EYP B;  1ODE A;  2V9Y A;  3K2X A;  3JAL B;  3S0W A;  3I55 F;  2MQE A;  4X3M A;  3E20 B;  4EI7 A;  5KX5 B;  4EB6 B;  1GZ0 A;  2DYY A;  5J2T B;  3MDO A;  4ZOL B;  1VHA A;  5J2U B;  3LWP C;  2FC3 A;  4RHA A;  5JQG B;  4LNU A;  4TUY B;  1VQK F;  3GHZ A;  1IV2 A;  1SA0 B;  5IYZ B;  3E22 B;  2Q1Y A;  2IG8 A;  5MN4 A;  4BT4 A;  5B8F A;  4I4T B;  2W8B C;  3HKE B;  1QAH A;  3TD3 A;  3O85 A;  2UZH A;  2VAW A;  5GON A;  4I50 B;  3VYU C;  1PF5 A;  3SIU A;  2RHH A;  4WBN B;  4X1I B;  4ZK7 A;  5IJ9 A;  5CA1 A;  2I6R A;  3CYQ A;  1UI9 A;  1YIT F;  5FNV A;  4O4J B;  4G4V A;  1VQ7 F;  5EYP A;  4RQO A;  5IJ0 B;  4X20 B;  3KJJ A;  4DXD A;  3RYC B;  3RA6 A;  3KHN A;  3AGK A;  2HS4 A;  5G4V C;  2UYP A;  1XHO A;  5J2T A;  4BVR A;  5J2U A;  2GLZ A;  3DC2 A;  2OHW A;  4TUY A;  4TZZ A;  1JY8 A;  1JD1 A;  3F0E A;  1TUB B;  1R1M A;  4G4Y A;  3FD5 A;  1SA0 A;  5JH7 B;  2CZW A;  5IYZ A;  3OW2 F;  1W5B A;  2VAP A;  5C8Y B;  1X7O A;  2YYE A;  4B45 A;  2G9I A;  4I55 B;  2OTL F;  1W3E X;  3MCA B;  5DCV A;  2CSL A;  3C9T A;  1Q82 H;  4I4T A;  3E1Y A;  3ESJ A;  3HKE A;  4BT5 A;  3V7Q A;  2UYJ A;  3VIU A;  1OFU A;  3EOR A;  3ZP4 A;  3HKB B;  4ZHQ A;  3K14 A;  3IMP A;  3CPW F;  5HY2 A;  3KIZ A;  4TV9 B;  3LWR C;  4I50 A;  1YJ9 F;  4C8E A;  1TVK B;  2WAL A;  4X1I A;  4WBN A;  1U3L A;  4BW0 B;  2I6D A;  5LOV B;  3WXM B;  1VQL F;  3CPQ A;  4O4J A;  1IV4 A;  3CC4 F;  5IJ0 A;  2ZVZ A;  3SIV A;  4X20 A;  5A2Q M;  4BT3 A;  3V4D A;  1K9M H;  1GX1 A;  3UT5 B;  4IHJ B;  3V7E A;  1UFY A;  5ITZ B;  3CYP B;  3T80 A;  5FLX M;  2FGY A;  2RHO A;  4LNU B;  3WJR A;  5JH7 A;  3VMF B;  3VYT C;  1YHQ F;  3JAS B;  5C8Y A;  2HP0 B;  3CD6 F;  1CLI A;  3B6N A;  1U43 A;  3I7T A;  4I55 A;  4X3L A;  3JAW B;  1JN1 A;  1YQN A;  4O2A B;  5LP6 C;  1RQ2 A;  4ZI7 B;  2IQQ A;  1T0K B;  1TVK A;  3KE1 A;  1W41 A;  1W40 A;  3CCL F;  1JFF A;  3OON A;  2VGN A;  5GIO C;  4YJ3 B;  5BMV B;  1KD1 H;  2BO1 A;  4X1K A;  1YIJ F;  5EO3 A;  4C8I A;  3K0T A;  1U40 A;  5HP7 A;  3FD6 A;  3CCR F;  3UT5 A;  1Q7Y H;  5FJ4 C;  4IHJ A;  3LWV C;  2F9Z C;  5HXZ A;  5ITZ A;  3JAM M;  1M90 H;  5LYJ B;  5AVM A;  3RYH A;  3JAK B;  4YJ2 B;  2KTU A;  3CB2 A;  2P6Y A;  3C9R A;  3FBA A;  5EAZ A;  1YGY A;  3RYI A;  4B5C A;  1GO0 A;  4B62 A;  3JAS A;  2HP0 A;  3DDN A;  2EWC A;  3ZOP A;  3QHD A;  3S0H A;  2CW4 A;  3WGJ A;  3JAW A;  2R75 1;  2H8E A;  5CA0 B;  5LXT B;  2ZOV A;  2HQS C;  1RQ7 A;  3IEQ A;  4G88 A;  4O2A A;  5MN5 A;  4ZHQ B;  4DRX B;  2KTV A;  4ZI7 A;  3J80 M;  3CCS F;  3U0O A;  2AIF A;  3N4Z A;  3Q8H A;  1PXW A;  3L7Q A;  1W57 A;  2HRY A;  3LYB A;  3R0P A;  1YI2 F;  4YJ3 A;  3D54 A;  5BMV A;  3LWO C;  3PAF A;  5GAP K;  4FFB A;  1VQV A;  3D01 A;  1VQ4 F;  3ON1 A;  3P10 A;  3TD5 A;  4C81 A;  3CCU F;  1FNJ A;  3I56 F;  2BTO A;  3HJW C;  5CB4 B;  5LYJ A;  2ZF8 A;  3JAK A;  4YJ2 A;  3N4Y A;  1T0A A;  4G4X A;  1VQM F;  1NMU B;  3OBY A;  3D00 A;  3N2K A;  1Z5W A;  1VK3 A;  1KNJ A;  5CA0 A;  3V3T A;  5LXT A;  1VQN F;  3BYQ A;  1VQ8 F;  3FPI A;  2LBW A;  1VH8 A;  4DRX A;  1W55 A;  4BT2 A;  1H7M A;  1IV1 A;  2KG4 A;  1N8R H;  3QTY A;  3IKF A;  1JFF B;  2CWJ A;  4NUT A;  4BY9 D;  4M8I A;  2UYN B;  2Z1E A;  3CC2 F;  1YJW F;  1JJ2 F;  2BTQ B;  1SDS A;  4X1K B;  3S03 A;  3M4S A;  5EIB D;  3WGM A;  3HKD B;  1Q81 H;  4KWE A;  2BTU A;  2Z1T A;  5HXU A;  5CB4 A;  4LCK A;  1KC8 H;  3RYH B;  1DBF A;  2UYK A;  3RYI B;  1H47 A;  1W5A A;  2HX0 A;  3LWQ C;  4U39 A;  2LBT A;  3CCQ F;  1COM A; 
#chains in the Genus database with same CATH homology
 4RQO A;  2IAF A;  3DDN A;  2IQQ A;  3DC2 A;  1YGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...