2N48A

Ec-nmr structure of escherichia coli yiad determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target er553
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid binding protein
molecule keywords Probable lipoprotein YiaD
total genus 47
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2n48A00
4B5CA 2HQSC 3S0YA 2ZOVA 2L26A 4ZHVA 3S06A 3S0WA 3S02A 4G4WA 2AIZP 4G4VA 3OONA 3IMPA 3LDTA 4ERHA 2N48A 4ZHYB 2W8BC 4R40B 4RHAA 5EB1B 2ZVZA 4PWTA 4G4YA 2LBTA 3WPWA 4B62A 4G4ZA 4G88A 4G4XA 5EAZA 3TD4A 3TD5A 1R1MA 2MQEA 3S03A 3CYPB 5EB0A 4ZHWA 3WPXA 3TD3A 1OAPA 2ZF8A 3KHNA 2LCAA 2K1SA 3S0HA 2ZVYA 2KGWA 3CYQA
chains in the Genus database with same CATH superfamily
4HNAA 1K73H 5CA0A 3JATA 4WBNA 3CCMF 1W2BF 2AIZP 4ERHA 3NMUC 2LBWA 4EI7A 5MN5A 4O4JB 2ALEA 1VK3A 5EB1B 2F9ZC 4LNUB 2Z1TA 3LWOC 3VTIC 1J7HA 1VQ6F 1UI9A 1JY8A 2R751 2EWCA 3NK7A 3VCZA 3QUWA 5DCVA 5GONB 3IR9A 5IJ9B 5JH7A 2GLZA 3MQWA 3O85A 4DRXA 4X3LA 3S0YA 3VMFB 1QD9A 3GYQA 4I55B 3CCEF 2PMPA 3C8LA 1TUBA 3RA5A 3WJQA 2HS4A 4TUYB 1GX1A 1RQ2A 3JARA 1W55A 3V7EA 3HKDB 5G4VC 1W42A 4U3JA 3ON1A 4C82A 3HKDA 4BVSA 5CA1B 4O2BB 4O4LA 2RB9A 5BMVA 1KD1H 1U43A 5CA1A 3VO8A 3R0PA 2UYNB 1IV1A 1S72F 1RQ7A 5GANK 3K12A 3S06A 1W3EX 4G4WA 3OONA 3KIZA 3M84A 2N48A 3KJKA 1TUBB 2P6YA 3KJJA 5JQGA 4IIJB 3FD5A 4YJ3A 2Q1YA 2ZODA 4ZOLA 1FFXB 5HXUA 2VAWA 4X1YA 3D00A 3G6EF 3WGJA 4BT5A 4I4TA 1ZWZA 2UYKA 4BVRA 3LWPC 5CA0B 5GINC 1ODEA 2LCAA 2QEXF 3D54A 2R6R1 2OZBA 4U39A 1Z5WA 4G4VA 3J80M 3CCJF 4X1KA 3I55F 3I56F 1QAHA 3IEWA 4TV9B 1SA0B 3F0GA 3HKCA 3WJPA 3VYTC 2IAFA 3CCLF 3AGKA 1U3PA 1N8RH 3VI6A 2DYYA 5HY2A 3JVHA 3GTZA 5EZYB 4NQ3A 1FNKA 4BY9D 5IJ0A 2K1SA 5GIOC 4BVTA 3CPQA 3LYBA 1YIJF 3I3FA 3E20B 2NMUA 1SA0A 1FNJA 1W581 4BT2A 4O4IA 1QU9A 3NVKE 5HY0A 4G4ZA 3IKFA 3WJRA 4ZK7A 5KX5A 3HKBA 3HKEB 4BT3A 1CN7A 2UZHA 4YJ2B 3VOBA 4ZHWA 2IQQA 3DDNA 5GONA 3M1XA 5IYZA 1W40A 3E1YA 2ZVYA 3CYQA 2VGMA 3N4YA 4M8IA 4I55A 4ZHVA 3VIUA 3OBWA 3NVIB 2RHLA 1T0KB 4ZHQB 3JALA 2Z1EA 2IG8A 3E22A 1VQ4F 4ZHQA 3CCSF 3Q8HA 4TZZA 2I6RA 4X1IA 2HS0A 3MCAB 3HJWC 2ZAUA 1W5BA 2KTVA 3QHDA 4X20A 3JCMM 3EORA 5EWRA 1OAPA 3KHNA 3C9SA 4O2AB 3RYFA 1TVKA 4X20B 2DT4A 2V9YA 3ZP4A 4NWOB 3CC7F 2BO1A 3HKCB 3WGLA 3JALB 2JNBA 4FFBA 1M90H 3D01A 5EIBC 3K0TA 3LDTA 3L7QA 1CK2A 4ZHYB 2QI2A 5KMGB 3JAWB 4TV8B 1H48A 4PWTA 3WGMA 5J2UA 2LBXA 1XHOA 2RHJA 3JARB 5HP8A 3S03A 5LA6B 5HXZA 3ERNA 1YGYA 2CHTA 4BVQA 5KX5B 3OBYA 2CSLA 2HP0B 1YJWF 1VQPF 5LP6C 3HKEA 3HKBB 3N4ZA 5G4UC 3K14A 1W5FA 1FFXA 5FNVB 1NJIH 5ITZB 2ZVZA 5EO3A 1RLUA 1VQLF 4XCQA 3RA6A 2OTJF 1SDSA 2CZWA 3FD6A 3HTNA 2MQEA 5FNVA 3CYPB 1DBFA 3PAFA 2H8EA 4B46A 3WPXA 3V4DA 2ZF8A 3F0FA 1YHQF 4I50B 3CG6A 3RYFB 3CCQF 2Z1UA 2CWJA 3ZP7A 2ZOVA 4I50A 1PF5A 3MCQA 3HAXD 4O4HA 5BMVB 1JFFB 1VQVA 2OTLF 4R40B 5MN6A 4ZI7A 2KG4A 5HWEA 1VH8A 4FFBB 1GZ0A 3J81M 1PXWA 1YJNF 5KMGA 3CMEF 4F6RB 5JCOA 3C9TA 2VXYA 4B45A 1IV4A 3JAKA 4IHJB 2HX0A 2WALA 3TD3A 5LYJB 2H6LA 5JVDB 3CD6F 2OTMA 4DXDA 4EB6A 4EI8A 2Q1XA 5LA6A 5A2QM 3JAKB 4IHJA 3CC4F 2G9IA 3G4SF 5EIBD 2HP0A 4O4IB 1ONIA 1X7OA 3S0WA 2QA4F 1VHAA 5LXTA 3M4SA 3SIVA 4NUTA 2RHOA 5CB4A 3PLAC 2W8BC 2HRUA 3N2GB 3JASA 5J2TA 5HY1A 1E7KA 3P0ZA 2FGYA 3ELCA 2UYJA 3N2GA 1KC8H 3G71F 4YJ3B 5EZYA 3SIUA 5CB4B 3RYHB 1JN1A 1H47A 5LYJA 3RE3A 5LOVA 3CCVF 3P10A 1YJ9F 4C4WC 1KNJA 1Q8RA 3MDOA 2AIFA 3RYCA 1CLIA 3CPWF 1VQ5F 4C8IA 4X1IB 3U0OA 2YXZA 3DC2A 3OW2F 1Q82H 4U3JB 3FPIA 2CW4A 2YYEA 3VOAA 5GAPK 3TD5A 3K2XA 3WXMB 1VQ7F 2Z1FA 1XRGA 3RYIA 1VQ8F 3JATB 4WBNB 2H8CA 1GO0A 1K9MH 2UYPA 2KGWA 1RA4A 1UFYA 5FLXM 4I4TB 4O4HB 3IKEA 5JVDA 5AVMA 3S02A 1T0AA 1FSZA 3LFOA 4ZOLB 3F6MA 3JAMM 3P4EA 3T80A 1SZQA 5LP6A 2LBTA 3JAWA 3C9RA 3BYQA 3VYUC 5EAZA 1QVGF 1YQNA 1H7MA 3GHZA 3FBAA 1M1KH 2HVYD 3C9UA 4ZI7B 1X7PA 1Q86H 2RHHA 3HWUA 1KQSF 5GIPC 3N2KA 1W59A 1QVFF 3CC2F 2Z01A 3QTYA 2L26A 1YI2F 5FJ4C 3RYCB 2UYNA 4TV8A 2B33A 3V7QA 1W5EA 1TVKB 1W5AA 5LP6B 4RHAA 3LWRC 1VQMF 1XV2A 3FFMA 2GVIA 3CCUF 3E22B 2QTPA 4G88A 5C8YA 5JQGB 1R1MA 2AMTA 5EB0A 4O2BA 1JD1A 2BTUA 2PHNA 5J2TB 3CXCF 5J2UB 3LMEA 3J7AR 5HP7A 1K8AH 4O2AA 1IV3A 2HS3A 1COMA 4DRXB 3UT5A 1IPAA 3IMPA 3ZOPA 5JCOC 3CMAF 3UT5B 3WPWA 3I7TA 2CHSA 4E6EA 4X1YB 3TD4A 1KNKA 5HY4A 3LWVC 3KE1A 2BTQB 4EB6B 1YITF 4IIJA 2KTUA 3F0EA 3IEQA 4C8GA 4HNAB 4LNUA 2VAPA 4BT6A 1Q7YH 4F6RA 4X3MA 2VGNA 1IV2A 3WGKA 4BT7A 1VQ9F 1VQNF 3VYSC 3MBMA 4B5CA 2HQSC 4TV9A 4X1KB 3LWQC 4O4JA 2GZLA 2FC3A 3B6NA 4BW0B 4C8EA 3RYHA 3ZO8A 3CCRF 1VQKF 4EI9A 1GO1A 5B8FA 5LXTB 2HP3A 1Z5VA 3NK6A 4G4XA 3CB2A 3N2KB 4TUYA 5IJ0B 1JFFA 3JASB 3RYIB 5IJ9A 5JH7B 1W41A 4YJ2A 1JJ2F 2VAMA 1XBIA 2OHWA 3S0HA 4B62A 1U3LA 1OFUA 5IYZB 3V3TA 5C8YB 2CVLA 4C81A 3F0DA 1VQOF 4G4YA 1X52A 4LCKA 2I6DA 1DT9A 5EYPA 3ESJA 4O4LB 1X25A 4BT4A 5ITZA 3WGNA 5LOVB 1NMUB 4KWEA 1NQ3A 2BTOA 5EYPB 5MN4A 1RLGA 1Q81H 2HRYA 1W57A 4RQOA 5IT9M 1U40A
chains in the Genus database with same CATH topology
4B5CA 2HQSC 3S0YA 2ZOVA 2L26A 4ZHVA 3S06A 3S0WA 3S02A 4G4WA 2AIZP 4G4VA 3OONA 3IMPA 3LDTA 4ERHA 2N48A 4ZHYB 2W8BC 4R40B 4RHAA 5EB1B 2ZVZA 4PWTA 4G4YA 2LBTA 3WPWA 4B62A 4G4ZA 4G88A 4G4XA 5EAZA 3TD4A 3TD5A 1R1MA 2MQEA 3S03A 3CYPB 5EB0A 4ZHWA 3WPXA 3TD3A 1OAPA 2ZF8A 3KHNA 2LCAA 2K1SA 3S0HA 2ZVYA 2KGWA 3CYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5C A;  2HQS C;  3S0Y A;  2ZOV A;  2L26 A;  4ZHV A;  3S06 A;  3S0W A;  3S02 A;  4G4W A;  2AIZ P;  4G4V A;  3OON A;  3IMP A;  3LDT A;  4ERH A;  2N48 A;  4ZHY B;  2W8B C;  4R40 B;  4RHA A;  5EB1 B;  2ZVZ A;  4PWT A;  4G4Y A;  2LBT A;  3WPW A;  4B62 A;  4G4Z A;  4G88 A;  4G4X A;  5EAZ A;  3TD4 A;  3TD5 A;  1R1M A;  2MQE A;  3S03 A;  3CYP B;  5EB0 A;  4ZHW A;  3WPX A;  3TD3 A;  1OAP A;  2ZF8 A;  3KHN A;  2LCA A;  2K1S A;  3S0H A;  2ZVY A;  2KGW A;  3CYQ A; 
#chains in the Genus database with same CATH topology
 4HNA A;  1K73 H;  5CA0 A;  3JAT A;  4WBN A;  3CCM F;  1W2B F;  2AIZ P;  4ERH A;  3NMU C;  2LBW A;  4EI7 A;  5MN5 A;  4O4J B;  2ALE A;  1VK3 A;  5EB1 B;  2F9Z C;  4LNU B;  2Z1T A;  3LWO C;  3VTI C;  1J7H A;  1VQ6 F;  1UI9 A;  1JY8 A;  2R75 1;  2EWC A;  3NK7 A;  3VCZ A;  3QUW A;  5DCV A;  5GON B;  3IR9 A;  5IJ9 B;  5JH7 A;  2GLZ A;  3MQW A;  3O85 A;  4DRX A;  4X3L A;  3S0Y A;  3VMF B;  1QD9 A;  3GYQ A;  4I55 B;  3CCE F;  2PMP A;  3C8L A;  1TUB A;  3RA5 A;  3WJQ A;  2HS4 A;  4TUY B;  1GX1 A;  1RQ2 A;  3JAR A;  1W55 A;  3V7E A;  3HKD B;  5G4V C;  1W42 A;  4U3J A;  3ON1 A;  4C82 A;  3HKD A;  4BVS A;  5CA1 B;  4O2B B;  4O4L A;  2RB9 A;  5BMV A;  1KD1 H;  1U43 A;  5CA1 A;  3VO8 A;  3R0P A;  2UYN B;  1IV1 A;  1S72 F;  1RQ7 A;  5GAN K;  3K12 A;  3S06 A;  1W3E X;  4G4W A;  3OON A;  3KIZ A;  3M84 A;  2N48 A;  3KJK A;  1TUB B;  2P6Y A;  3KJJ A;  5JQG A;  4IIJ B;  3FD5 A;  4YJ3 A;  2Q1Y A;  2ZOD A;  4ZOL A;  1FFX B;  5HXU A;  2VAW A;  4X1Y A;  3D00 A;  3G6E F;  3WGJ A;  4BT5 A;  4I4T A;  1ZWZ A;  2UYK A;  4BVR A;  3LWP C;  5CA0 B;  5GIN C;  1ODE A;  2LCA A;  2QEX F;  3D54 A;  2R6R 1;  2OZB A;  4U39 A;  1Z5W A;  4G4V A;  3J80 M;  3CCJ F;  4X1K A;  3I55 F;  3I56 F;  1QAH A;  3IEW A;  4TV9 B;  1SA0 B;  3F0G A;  3HKC A;  3WJP A;  3VYT C;  2IAF A;  3CCL F;  3AGK A;  1U3P A;  1N8R H;  3VI6 A;  2DYY A;  5HY2 A;  3JVH A;  3GTZ A;  5EZY B;  4NQ3 A;  1FNK A;  4BY9 D;  5IJ0 A;  2K1S A;  5GIO C;  4BVT A;  3CPQ A;  3LYB A;  1YIJ F;  3I3F A;  3E20 B;  2NMU A;  1SA0 A;  1FNJ A;  1W58 1;  4BT2 A;  4O4I A;  1QU9 A;  3NVK E;  5HY0 A;  4G4Z A;  3IKF A;  3WJR A;  4ZK7 A;  5KX5 A;  3HKB A;  3HKE B;  4BT3 A;  1CN7 A;  2UZH A;  4YJ2 B;  3VOB A;  4ZHW A;  2IQQ A;  3DDN A;  5GON A;  3M1X A;  5IYZ A;  1W40 A;  3E1Y A;  2ZVY A;  3CYQ A;  2VGM A;  3N4Y A;  4M8I A;  4I55 A;  4ZHV A;  3VIU A;  3OBW A;  3NVI B;  2RHL A;  1T0K B;  4ZHQ B;  3JAL A;  2Z1E A;  2IG8 A;  3E22 A;  1VQ4 F;  4ZHQ A;  3CCS F;  3Q8H A;  4TZZ A;  2I6R A;  4X1I A;  2HS0 A;  3MCA B;  3HJW C;  2ZAU A;  1W5B A;  2KTV A;  3QHD A;  4X20 A;  3JCM M;  3EOR A;  5EWR A;  1OAP A;  3KHN A;  3C9S A;  4O2A B;  3RYF A;  1TVK A;  4X20 B;  2DT4 A;  2V9Y A;  3ZP4 A;  4NWO B;  3CC7 F;  2BO1 A;  3HKC B;  3WGL A;  3JAL B;  2JNB A;  4FFB A;  1M90 H;  3D01 A;  5EIB C;  3K0T A;  3LDT A;  3L7Q A;  1CK2 A;  4ZHY B;  2QI2 A;  5KMG B;  3JAW B;  4TV8 B;  1H48 A;  4PWT A;  3WGM A;  5J2U A;  2LBX A;  1XHO A;  2RHJ A;  3JAR B;  5HP8 A;  3S03 A;  5LA6 B;  5HXZ A;  3ERN A;  1YGY A;  2CHT A;  4BVQ A;  5KX5 B;  3OBY A;  2CSL A;  2HP0 B;  1YJW F;  1VQP F;  5LP6 C;  3HKE A;  3HKB B;  3N4Z A;  5G4U C;  3K14 A;  1W5F A;  1FFX A;  5FNV B;  1NJI H;  5ITZ B;  2ZVZ A;  5EO3 A;  1RLU A;  1VQL F;  4XCQ A;  3RA6 A;  2OTJ F;  1SDS A;  2CZW A;  3FD6 A;  3HTN A;  2MQE A;  5FNV A;  3CYP B;  1DBF A;  3PAF A;  2H8E A;  4B46 A;  3WPX A;  3V4D A;  2ZF8 A;  3F0F A;  1YHQ F;  4I50 B;  3CG6 A;  3RYF B;  3CCQ F;  2Z1U A;  2CWJ A;  3ZP7 A;  2ZOV A;  4I50 A;  1PF5 A;  3MCQ A;  3HAX D;  4O4H A;  5BMV B;  1JFF B;  1VQV A;  2OTL F;  4R40 B;  5MN6 A;  4ZI7 A;  2KG4 A;  5HWE A;  1VH8 A;  4FFB B;  1GZ0 A;  3J81 M;  1PXW A;  1YJN F;  5KMG A;  3CME F;  4F6R B;  5JCO A;  3C9T A;  2VXY A;  4B45 A;  1IV4 A;  3JAK A;  4IHJ B;  2HX0 A;  2WAL A;  3TD3 A;  5LYJ B;  2H6L A;  5JVD B;  3CD6 F;  2OTM A;  4DXD A;  4EB6 A;  4EI8 A;  2Q1X A;  5LA6 A;  5A2Q M;  3JAK B;  4IHJ A;  3CC4 F;  2G9I A;  3G4S F;  5EIB D;  2HP0 A;  4O4I B;  1ONI A;  1X7O A;  3S0W A;  2QA4 F;  1VHA A;  5LXT A;  3M4S A;  3SIV A;  4NUT A;  2RHO A;  5CB4 A;  3PLA C;  2W8B C;  2HRU A;  3N2G B;  3JAS A;  5J2T A;  5HY1 A;  1E7K A;  3P0Z A;  2FGY A;  3ELC A;  2UYJ A;  3N2G A;  1KC8 H;  3G71 F;  4YJ3 B;  5EZY A;  3SIU A;  5CB4 B;  3RYH B;  1JN1 A;  1H47 A;  5LYJ A;  3RE3 A;  5LOV A;  3CCV F;  3P10 A;  1YJ9 F;  4C4W C;  1KNJ A;  1Q8R A;  3MDO A;  2AIF A;  3RYC A;  1CLI A;  3CPW F;  1VQ5 F;  4C8I A;  4X1I B;  3U0O A;  2YXZ A;  3DC2 A;  3OW2 F;  1Q82 H;  4U3J B;  3FPI A;  2CW4 A;  2YYE A;  3VOA A;  5GAP K;  3TD5 A;  3K2X A;  3WXM B;  1VQ7 F;  2Z1F A;  1XRG A;  3RYI A;  1VQ8 F;  3JAT B;  4WBN B;  2H8C A;  1GO0 A;  1K9M H;  2UYP A;  2KGW A;  1RA4 A;  1UFY A;  5FLX M;  4I4T B;  4O4H B;  3IKE A;  5JVD A;  5AVM A;  3S02 A;  1T0A A;  1FSZ A;  3LFO A;  4ZOL B;  3F6M A;  3JAM M;  3P4E A;  3T80 A;  1SZQ A;  5LP6 A;  2LBT A;  3JAW A;  3C9R A;  3BYQ A;  3VYU C;  5EAZ A;  1QVG F;  1YQN A;  1H7M A;  3GHZ A;  3FBA A;  1M1K H;  2HVY D;  3C9U A;  4ZI7 B;  1X7P A;  1Q86 H;  2RHH A;  3HWU A;  1KQS F;  5GIP C;  3N2K A;  1W59 A;  1QVF F;  3CC2 F;  2Z01 A;  3QTY A;  2L26 A;  1YI2 F;  5FJ4 C;  3RYC B;  2UYN A;  4TV8 A;  2B33 A;  3V7Q A;  1W5E A;  1TVK B;  1W5A A;  5LP6 B;  4RHA A;  3LWR C;  1VQM F;  1XV2 A;  3FFM A;  2GVI A;  3CCU F;  3E22 B;  2QTP A;  4G88 A;  5C8Y A;  5JQG B;  1R1M A;  2AMT A;  5EB0 A;  4O2B A;  1JD1 A;  2BTU A;  2PHN A;  5J2T B;  3CXC F;  5J2U B;  3LME A;  3J7A R;  5HP7 A;  1K8A H;  4O2A A;  1IV3 A;  2HS3 A;  1COM A;  4DRX B;  3UT5 A;  1IPA A;  3IMP A;  3ZOP A;  5JCO C;  3CMA F;  3UT5 B;  3WPW A;  3I7T A;  2CHS A;  4E6E A;  4X1Y B;  3TD4 A;  1KNK A;  5HY4 A;  3LWV C;  3KE1 A;  2BTQ B;  4EB6 B;  1YIT F;  4IIJ A;  2KTU A;  3F0E A;  3IEQ A;  4C8G A;  4HNA B;  4LNU A;  2VAP A;  4BT6 A;  1Q7Y H;  4F6R A;  4X3M A;  2VGN A;  1IV2 A;  3WGK A;  4BT7 A;  1VQ9 F;  1VQN F;  3VYS C;  3MBM A;  4B5C A;  2HQS C;  4TV9 A;  4X1K B;  3LWQ C;  4O4J A;  2GZL A;  2FC3 A;  3B6N A;  4BW0 B;  4C8E A;  3RYH A;  3ZO8 A;  3CCR F;  1VQK F;  4EI9 A;  1GO1 A;  5B8F A;  5LXT B;  2HP3 A;  1Z5V A;  3NK6 A;  4G4X A;  3CB2 A;  3N2K B;  4TUY A;  5IJ0 B;  1JFF A;  3JAS B;  3RYI B;  5IJ9 A;  5JH7 B;  1W41 A;  4YJ2 A;  1JJ2 F;  2VAM A;  1XBI A;  2OHW A;  3S0H A;  4B62 A;  1U3L A;  1OFU A;  5IYZ B;  3V3T A;  5C8Y B;  2CVL A;  4C81 A;  3F0D A;  1VQO F;  4G4Y A;  1X52 A;  4LCK A;  2I6D A;  1DT9 A;  5EYP A;  3ESJ A;  4O4L B;  1X25 A;  4BT4 A;  5ITZ A;  3WGN A;  5LOV B;  1NMU B;  4KWE A;  1NQ3 A;  2BTO A;  5EYP B;  5MN4 A;  1RLG A;  1Q81 H;  2HRY A;  1W57 A;  4RQO A;  5IT9 M;  1U40 A; 
#chains in the Genus database with same CATH homology
 4B5C A;  2HQS C;  3S0Y A;  2ZOV A;  2L26 A;  4ZHV A;  3S06 A;  3S0W A;  3S02 A;  4G4W A;  2AIZ P;  4G4V A;  3OON A;  3IMP A;  3LDT A;  4ERH A;  2N48 A;  4ZHY B;  2W8B C;  4R40 B;  4RHA A;  5EB1 B;  2ZVZ A;  4PWT A;  4G4Y A;  2LBT A;  3WPW A;  4B62 A;  4G4Z A;  4G88 A;  4G4X A;  5EAZ A;  3TD4 A;  3TD5 A;  1R1M A;  2MQE A;  3S03 A;  3CYP B;  5EB0 A;  4ZHW A;  3WPX A;  3TD3 A;  1OAP A;  2ZF8 A;  3KHN A;  2LCA A;  2K1S A;  3S0H A;  2ZVY A;  2KGW A;  3CYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...