2N48A

Ec-nmr structure of escherichia coli yiad determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target er553
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid binding protein
molecule keywords Probable lipoprotein YiaD
total genus 47
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2n48A00
3S02A 4ERHA 4B5CA 4B62A 4ZHVA 3TD3A 4G4YA 4G4VA 2HQSC 4G4XA 2W8BC 2ZF8A 5EB0A 3S0WA 3S03A 2KGWA 3CYQA 4G4ZA 3S0YA 4G88A 1OAPA 3LDTA 3S0HA 3KHNA 1R1MA 2K1SA 4G4WA 3TD5A 3WPXA 2N48A 2ZOVA 2MQEA 2LCAA 3TD4A 3IMPA 4R40B 5EB1B 2AIZP 3S06A 2L26A 5EAZA 4ZHWA 2ZVYA 4RHAA 2LBTA 3CYPB 3OONA 4ZHYB 4PWTA 2ZVZA 3WPWA
chains in the Genus database with same CATH superfamily
1VQ6F 1RQ7A 4XCQA 3CCVF 1NMUB 3I3FA 3CMAF 4NQ3A 4IIJB 4G4YA 1FFXB 4O2BB 4G4XA 5LP6B 4IHJB 1TUBA 1QAHA 2KGWA 4O4LA 3S0YA 3ZP4A 2K1SA 4M8IA 2NMUA 5JH7B 2RB9A 2HS3A 4U3JA 4X1YB 4C82A 2HS0A 4RHAA 1YQNA 5KX5B 1TVKA 3OONA 4B45A 4BVTA 3LFOA 3F0GA 4BVQA 3V3TA 1YJNF 4EI9A 3VYUC 4B62A 1QVFF 3EORA 4ZHVA 4BT4A 5HP7A 1E7KA 1ONIA 5C8YA 3RYCB 5DCVA 3MDOA 5IJ0A 2CW4A 2AIFA 1IPAA 3JAWA 1VQMF 3HKBA 3WGNA 3HAXD 2OTMA 4EB6B 5GANK 3G6EF 1H7MA 5J2TB 3CB2A 4I50B 1NJIH 4LCKA 5HWEA 5LOVA 2WALA 4C81A 3CMEF 1QU9A 3MCQA 5JH7A 5EYPA 5AVMA 3CC2F 1VHAA 4O2BA 5JCOC 1KC8H 5EB0A 1VQLF 2CVLA 3IR9A 1GO1A 2VAWA 3JAKA 3JVHA 2VAPA 4KWEA 3LWOC 3M84A 5EIBD 2LCAA 3TD4A 4O4IB 1W57A 4ZHWA 3O85A 3NK6A 4DRXB 3V7QA 3FD5A 2CZWA 3RA5A 5JQGA 4ERHA 4EI7A 1YJWF 5MN4A 4X3MA 1X7OA 3VOBA 4FFBA 3LWRC 1PF5A 2KG4A 3VYTC 3VTIC 3U0OA 1YITF 1JJ2F 1W40A 3R0PA 4LNUB 5G4VC 3HKDA 2YYEA 2Q1YA 1X52A 3HKCA 2HVYD 3BYQA 5EYPB 3G71F 3E1YA 2OZBA 2CWJA 1GZ0A 5J2UA 3MQWA 3C8LA 3LMEA 4C8IA 1W3EX 2VGNA 1XBIA 1T0KB 2FGYA 3WGLA 1TUBB 3F0EA 3RYIA 5C8YB 1GX1A 4NUTA 4HNAA 3LDTA 4I4TB 3CD6F 1UFYA 2B33A 5JQGB 5LA6A 2VGMA 1GO0A 4O4HA 5IT9M 2P6YA 1W42A 5IYZB 1SA0B 3AGKA 3S06A 3F6MA 5HY4A 1W55A 2QA4F 1W41A 3DC2A 3N2KB 4I4TA 5LP6C 5JCOA 4WBNA 3LYBA 4BT5A 1W59A 3KE1A 1J7HA 5GAPK 1W5BA 3WJRA 1KD1H 5GONA 3RYHB 1XV2A 5BMVA 3CCEF 2HRUA 3C9UA 2AMTA 4BVSA 3JARA 5LXTB 3QTYA 3K2XA 4G88A 3JCMM 3RE3A 1W2BF 1R1MA 1Q82H 4NWOB 2FC3A 2N48A 3GTZA 3K14A 1NQ3A 1VQ7F 5EWRA 4IIJA 5A2QM 2AIZP 2RHLA 1H47A 3LWVC 4F6RB 1RLGA 1VQ5F 3UT5A 1IV1A 3CYPB 1KNJA 3CC7F 3JATA 3HTNA 3WPWA 3LWQC 2HS4A 2GLZA 5IJ0B 2CSLA 3IKFA 2QEXF 5HXZA 1KNKA 4O4HB 4U3JB 4X1YA 4E6EA 4TZZA 4FFBB 1QD9A 3RYIB 1Z5VA 3L7QA 2HP0A 2QTPA 1VQPF 5JVDA 1W5FA 1JFFA 2Z1FA 4BY9D 1JY8A 5LYJA 3CG6A 1K9MH 1Q7YH 3ELCA 5GONB 5HY0A 3GHZA 1DT9A 3J7AR 2BTUA 2H8EA 5KMGA 3UT5B 3VMFB 1SZQA 3E20B 3N2KA 4ZHQB 2ZVZA 5ITZB 1W5EA 3HKCB 5HY1A 1QVGF 4B46A 5CA0A 3OBYA 3ZO8A 3HJWC 4O4JA 4BW0B 5LYJB 3F0FA 3CXCF 4TV8A 5EO3A 1XRGA 4X1KA 1YIJF 4F6RA 2ZF8A 2UYJA 3B6NA 4ZI7B 2BO1A 3HKDB 3RYFA 3NVIB 4HNAB 4I50A 3S0HA 2R6R1 2Z1UA 5ITZA 1XHOA 3I7TA 2ZODA 2LBXA 2MQEA 3N2GA 3VYSC 2F9ZC 2RHOA 3DDNA 2UYNB 3G4SF 2ZVYA 3VIUA 2LBWA 3ESJA 3HKEA 3M1XA 3CCUF 2EWCA 1KQSF 1X7PA 2HRYA 1PXWA 3M4SA 5MN6A 3D00A 1YHQF 3N2GB 1Z5WA 4ZOLB 4BVRA 4YJ2A 5CA1B 3TD3A 1VK3A 3VO8A 3WGMA 3SIVA 5LP6A 3CYQA 3JARB 5LXTA 3V4DA 5EZYB 4BT7A 5FNVB 3TD5A 1ODEA 3GYQA 3WGKA 1RA4A 1YI2F 4EI8A 1VQOF 5EAZA 3I55F 3CCSF 3P4EA 3K12A 1IV4A 4TV8B 3CCLF 5LA6B 5G4UC 3D54A 3P10A 3WJQA 1JN1A 4YJ3A 1IV2A 3CCQF 4DXDA 2KTUA 3KHNA 3WJPA 3D01A 2GVIA 3C9TA 1VQ8F 1VQVA 4R40B 2I6DA 1VQNF 2G9IA 3FFMA 4U39A 1U40A 2QI2A 3ERNA 1T0AA 1CK2A 3J81M 1SA0A 5IYZA 2BTOA 2CHSA 4X1KB 1W581 5MN5A 5CA1A 3E22B 4G4ZA 4TV9A 4TUYB 3CC4F 2IQQA 2HP3A 4WBNB 3IEWA 3KIZA 1U3PA 2IG8A 4X1IB 5GIPC 2ZAUA 3LWPC 3FBAA 1JD1A 3CCRF 2UYPA 5KMGB 4I55B 2LBTA 1SDSA 5FLXM 4PWTA 3NK7A 3T80A 5HXUA 1Q81H 4O4JB 4X20B 2IAFA 3JAWB 1S72F 3K0TA 4X1IA 1COMA 2UYNA 3CCJF 5IJ9A 2H8CA 3Q8HA 2W8BC 3VI6A 4O2AA 3ZOPA 2R751 4TUYA 3S03A 3IKEA 2UYKA 5EZYA 3CPQA 4LNUA 1RLUA 4I55A 5EB1B 5J2UB 3FPIA 5GIOC 1X25A 3NMUC 2I6RA 3N4ZA 4ZI7A 1RQ2A 1JFFB 3S02A 1FNKA 2PHNA 2H6LA 3HKBB 3RYHA 3PLAC 1CLIA 2KTVA 2V9YA 3VCZA 5B8FA 4ZHQA 1FFXA 3PAFA 3WGJA 5GINC 4YJ3B 3JASB 1M90H 2VAMA 2VXYA 4TV9B 1W5AA 4X20A 4BT2A 1VQKF 1VH8A 1FSZA 3JALB 3N4YA 5FJ4C 1ZWZA 2OHWA 2PMPA 1Q86H 1TVKB 4BT3A 2Z1EA 3QHDA 3JAKB 1UI9A 3VOAA 2OTJF 4RQOA 3E22A 4O2AB 4IHJA 3C9SA 3WXMB 4O4LB 5CB4A 2HX0A 1U3LA 4G4WA 1IV3A 5CA0B 4YJ2B 4ZOLA 3J80M 3IMPA 3F0DA 2OTLF 4ZK7A 2ALEA 1YGYA 3IEQA 3C9RA 2YXZA 1U43A 4BT6A 3JATB 3ON1A 1Q8RA 4B5CA 3JALA 2Z1TA 5LOVB 5HY2A 5IJ9B 1YJ9F 2CHTA 3KJJA 3MBMA 2HQSC 5EIBC 3S0WA 1H48A 3RYFB 5CB4B 1OAPA 4DRXA 3JAMM 2RHJA 3WPXA 3CPWF 1K8AH 2ZOVA 4C8EA 2RHHA 4C8GA 4C4WC 2GZLA 2L26A 4O4IA 1K73H 5J2TA 3CCMF 3NVKE 4ZHYB 3OW2F 1VQ4F 3RA6A 3SIUA 5FNVA 3QUWA 3FD6A 1N8RH 2UZHA 2DYYA 1M1KH 4G4VA 3RYCA 2HP0B 3I56F 3KJKA 5KX5A 5JVDB 1CN7A 3JASA 2Q1XA 1VQ9F 1FNJA 3P0ZA 2Z01A 3MCAB 4EB6A 4X3LA 1OFUA 2BTQB 2JNBA 3OBWA 5HP8A 3HKEB 5BMVB 2DT4A 1DBFA 3HWUA 3V7EA 3ZP7A
chains in the Genus database with same CATH topology
3S02A 4ERHA 4B5CA 4B62A 4ZHVA 3TD3A 4G4YA 4G4VA 2HQSC 4G4XA 2W8BC 2ZF8A 5EB0A 3S0WA 3S03A 2KGWA 3CYQA 4G4ZA 3S0YA 4G88A 1OAPA 3LDTA 3S0HA 3KHNA 1R1MA 2K1SA 4G4WA 3TD5A 3WPXA 2N48A 2ZOVA 2MQEA 2LCAA 3TD4A 3IMPA 4R40B 5EB1B 2AIZP 3S06A 2L26A 5EAZA 4ZHWA 2ZVYA 4RHAA 2LBTA 3CYPB 3OONA 4ZHYB 4PWTA 2ZVZA 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S02 A;  4ERH A;  4B5C A;  4B62 A;  4ZHV A;  3TD3 A;  4G4Y A;  4G4V A;  2HQS C;  4G4X A;  2W8B C;  2ZF8 A;  5EB0 A;  3S0W A;  3S03 A;  2KGW A;  3CYQ A;  4G4Z A;  3S0Y A;  4G88 A;  1OAP A;  3LDT A;  3S0H A;  3KHN A;  1R1M A;  2K1S A;  4G4W A;  3TD5 A;  3WPX A;  2N48 A;  2ZOV A;  2MQE A;  2LCA A;  3TD4 A;  3IMP A;  4R40 B;  5EB1 B;  2AIZ P;  3S06 A;  2L26 A;  5EAZ A;  4ZHW A;  2ZVY A;  4RHA A;  2LBT A;  3CYP B;  3OON A;  4ZHY B;  4PWT A;  2ZVZ A;  3WPW A; 
#chains in the Genus database with same CATH topology
 1VQ6 F;  1RQ7 A;  4XCQ A;  3CCV F;  1NMU B;  3I3F A;  3CMA F;  4NQ3 A;  4IIJ B;  4G4Y A;  1FFX B;  4O2B B;  4G4X A;  5LP6 B;  4IHJ B;  1TUB A;  1QAH A;  2KGW A;  4O4L A;  3S0Y A;  3ZP4 A;  2K1S A;  4M8I A;  2NMU A;  5JH7 B;  2RB9 A;  2HS3 A;  4U3J A;  4X1Y B;  4C82 A;  2HS0 A;  4RHA A;  1YQN A;  5KX5 B;  1TVK A;  3OON A;  4B45 A;  4BVT A;  3LFO A;  3F0G A;  4BVQ A;  3V3T A;  1YJN F;  4EI9 A;  3VYU C;  4B62 A;  1QVF F;  3EOR A;  4ZHV A;  4BT4 A;  5HP7 A;  1E7K A;  1ONI A;  5C8Y A;  3RYC B;  5DCV A;  3MDO A;  5IJ0 A;  2CW4 A;  2AIF A;  1IPA A;  3JAW A;  1VQM F;  3HKB A;  3WGN A;  3HAX D;  2OTM A;  4EB6 B;  5GAN K;  3G6E F;  1H7M A;  5J2T B;  3CB2 A;  4I50 B;  1NJI H;  4LCK A;  5HWE A;  5LOV A;  2WAL A;  4C81 A;  3CME F;  1QU9 A;  3MCQ A;  5JH7 A;  5EYP A;  5AVM A;  3CC2 F;  1VHA A;  4O2B A;  5JCO C;  1KC8 H;  5EB0 A;  1VQL F;  2CVL A;  3IR9 A;  1GO1 A;  2VAW A;  3JAK A;  3JVH A;  2VAP A;  4KWE A;  3LWO C;  3M84 A;  5EIB D;  2LCA A;  3TD4 A;  4O4I B;  1W57 A;  4ZHW A;  3O85 A;  3NK6 A;  4DRX B;  3V7Q A;  3FD5 A;  2CZW A;  3RA5 A;  5JQG A;  4ERH A;  4EI7 A;  1YJW F;  5MN4 A;  4X3M A;  1X7O A;  3VOB A;  4FFB A;  3LWR C;  1PF5 A;  2KG4 A;  3VYT C;  3VTI C;  3U0O A;  1YIT F;  1JJ2 F;  1W40 A;  3R0P A;  4LNU B;  5G4V C;  3HKD A;  2YYE A;  2Q1Y A;  1X52 A;  3HKC A;  2HVY D;  3BYQ A;  5EYP B;  3G71 F;  3E1Y A;  2OZB A;  2CWJ A;  1GZ0 A;  5J2U A;  3MQW A;  3C8L A;  3LME A;  4C8I A;  1W3E X;  2VGN A;  1XBI A;  1T0K B;  2FGY A;  3WGL A;  1TUB B;  3F0E A;  3RYI A;  5C8Y B;  1GX1 A;  4NUT A;  4HNA A;  3LDT A;  4I4T B;  3CD6 F;  1UFY A;  2B33 A;  5JQG B;  5LA6 A;  2VGM A;  1GO0 A;  4O4H A;  5IT9 M;  2P6Y A;  1W42 A;  5IYZ B;  1SA0 B;  3AGK A;  3S06 A;  3F6M A;  5HY4 A;  1W55 A;  2QA4 F;  1W41 A;  3DC2 A;  3N2K B;  4I4T A;  5LP6 C;  5JCO A;  4WBN A;  3LYB A;  4BT5 A;  1W59 A;  3KE1 A;  1J7H A;  5GAP K;  1W5B A;  3WJR A;  1KD1 H;  5GON A;  3RYH B;  1XV2 A;  5BMV A;  3CCE F;  2HRU A;  3C9U A;  2AMT A;  4BVS A;  3JAR A;  5LXT B;  3QTY A;  3K2X A;  4G88 A;  3JCM M;  3RE3 A;  1W2B F;  1R1M A;  1Q82 H;  4NWO B;  2FC3 A;  2N48 A;  3GTZ A;  3K14 A;  1NQ3 A;  1VQ7 F;  5EWR A;  4IIJ A;  5A2Q M;  2AIZ P;  2RHL A;  1H47 A;  3LWV C;  4F6R B;  1RLG A;  1VQ5 F;  3UT5 A;  1IV1 A;  3CYP B;  1KNJ A;  3CC7 F;  3JAT A;  3HTN A;  3WPW A;  3LWQ C;  2HS4 A;  2GLZ A;  5IJ0 B;  2CSL A;  3IKF A;  2QEX F;  5HXZ A;  1KNK A;  4O4H B;  4U3J B;  4X1Y A;  4E6E A;  4TZZ A;  4FFB B;  1QD9 A;  3RYI B;  1Z5V A;  3L7Q A;  2HP0 A;  2QTP A;  1VQP F;  5JVD A;  1W5F A;  1JFF A;  2Z1F A;  4BY9 D;  1JY8 A;  5LYJ A;  3CG6 A;  1K9M H;  1Q7Y H;  3ELC A;  5GON B;  5HY0 A;  3GHZ A;  1DT9 A;  3J7A R;  2BTU A;  2H8E A;  5KMG A;  3UT5 B;  3VMF B;  1SZQ A;  3E20 B;  3N2K A;  4ZHQ B;  2ZVZ A;  5ITZ B;  1W5E A;  3HKC B;  5HY1 A;  1QVG F;  4B46 A;  5CA0 A;  3OBY A;  3ZO8 A;  3HJW C;  4O4J A;  4BW0 B;  5LYJ B;  3F0F A;  3CXC F;  4TV8 A;  5EO3 A;  1XRG A;  4X1K A;  1YIJ F;  4F6R A;  2ZF8 A;  2UYJ A;  3B6N A;  4ZI7 B;  2BO1 A;  3HKD B;  3RYF A;  3NVI B;  4HNA B;  4I50 A;  3S0H A;  2R6R 1;  2Z1U A;  5ITZ A;  1XHO A;  3I7T A;  2ZOD A;  2LBX A;  2MQE A;  3N2G A;  3VYS C;  2F9Z C;  2RHO A;  3DDN A;  2UYN B;  3G4S F;  2ZVY A;  3VIU A;  2LBW A;  3ESJ A;  3HKE A;  3M1X A;  3CCU F;  2EWC A;  1KQS F;  1X7P A;  2HRY A;  1PXW A;  3M4S A;  5MN6 A;  3D00 A;  1YHQ F;  3N2G B;  1Z5W A;  4ZOL B;  4BVR A;  4YJ2 A;  5CA1 B;  3TD3 A;  1VK3 A;  3VO8 A;  3WGM A;  3SIV A;  5LP6 A;  3CYQ A;  3JAR B;  5LXT A;  3V4D A;  5EZY B;  4BT7 A;  5FNV B;  3TD5 A;  1ODE A;  3GYQ A;  3WGK A;  1RA4 A;  1YI2 F;  4EI8 A;  1VQO F;  5EAZ A;  3I55 F;  3CCS F;  3P4E A;  3K12 A;  1IV4 A;  4TV8 B;  3CCL F;  5LA6 B;  5G4U C;  3D54 A;  3P10 A;  3WJQ A;  1JN1 A;  4YJ3 A;  1IV2 A;  3CCQ F;  4DXD A;  2KTU A;  3KHN A;  3WJP A;  3D01 A;  2GVI A;  3C9T A;  1VQ8 F;  1VQV A;  4R40 B;  2I6D A;  1VQN F;  2G9I A;  3FFM A;  4U39 A;  1U40 A;  2QI2 A;  3ERN A;  1T0A A;  1CK2 A;  3J81 M;  1SA0 A;  5IYZ A;  2BTO A;  2CHS A;  4X1K B;  1W58 1;  5MN5 A;  5CA1 A;  3E22 B;  4G4Z A;  4TV9 A;  4TUY B;  3CC4 F;  2IQQ A;  2HP3 A;  4WBN B;  3IEW A;  3KIZ A;  1U3P A;  2IG8 A;  4X1I B;  5GIP C;  2ZAU A;  3LWP C;  3FBA A;  1JD1 A;  3CCR F;  2UYP A;  5KMG B;  4I55 B;  2LBT A;  1SDS A;  5FLX M;  4PWT A;  3NK7 A;  3T80 A;  5HXU A;  1Q81 H;  4O4J B;  4X20 B;  2IAF A;  3JAW B;  1S72 F;  3K0T A;  4X1I A;  1COM A;  2UYN A;  3CCJ F;  5IJ9 A;  2H8C A;  3Q8H A;  2W8B C;  3VI6 A;  4O2A A;  3ZOP A;  2R75 1;  4TUY A;  3S03 A;  3IKE A;  2UYK A;  5EZY A;  3CPQ A;  4LNU A;  1RLU A;  4I55 A;  5EB1 B;  5J2U B;  3FPI A;  5GIO C;  1X25 A;  3NMU C;  2I6R A;  3N4Z A;  4ZI7 A;  1RQ2 A;  1JFF B;  3S02 A;  1FNK A;  2PHN A;  2H6L A;  3HKB B;  3RYH A;  3PLA C;  1CLI A;  2KTV A;  2V9Y A;  3VCZ A;  5B8F A;  4ZHQ A;  1FFX A;  3PAF A;  3WGJ A;  5GIN C;  4YJ3 B;  3JAS B;  1M90 H;  2VAM A;  2VXY A;  4TV9 B;  1W5A A;  4X20 A;  4BT2 A;  1VQK F;  1VH8 A;  1FSZ A;  3JAL B;  3N4Y A;  5FJ4 C;  1ZWZ A;  2OHW A;  2PMP A;  1Q86 H;  1TVK B;  4BT3 A;  2Z1E A;  3QHD A;  3JAK B;  1UI9 A;  3VOA A;  2OTJ F;  4RQO A;  3E22 A;  4O2A B;  4IHJ A;  3C9S A;  3WXM B;  4O4L B;  5CB4 A;  2HX0 A;  1U3L A;  4G4W A;  1IV3 A;  5CA0 B;  4YJ2 B;  4ZOL A;  3J80 M;  3IMP A;  3F0D A;  2OTL F;  4ZK7 A;  2ALE A;  1YGY A;  3IEQ A;  3C9R A;  2YXZ A;  1U43 A;  4BT6 A;  3JAT B;  3ON1 A;  1Q8R A;  4B5C A;  3JAL A;  2Z1T A;  5LOV B;  5HY2 A;  5IJ9 B;  1YJ9 F;  2CHT A;  3KJJ A;  3MBM A;  2HQS C;  5EIB C;  3S0W A;  1H48 A;  3RYF B;  5CB4 B;  1OAP A;  4DRX A;  3JAM M;  2RHJ A;  3WPX A;  3CPW F;  1K8A H;  2ZOV A;  4C8E A;  2RHH A;  4C8G A;  4C4W C;  2GZL A;  2L26 A;  4O4I A;  1K73 H;  5J2T A;  3CCM F;  3NVK E;  4ZHY B;  3OW2 F;  1VQ4 F;  3RA6 A;  3SIU A;  5FNV A;  3QUW A;  3FD6 A;  1N8R H;  2UZH A;  2DYY A;  1M1K H;  4G4V A;  3RYC A;  2HP0 B;  3I56 F;  3KJK A;  5KX5 A;  5JVD B;  1CN7 A;  3JAS A;  2Q1X A;  1VQ9 F;  1FNJ A;  3P0Z A;  2Z01 A;  3MCA B;  4EB6 A;  4X3L A;  1OFU A;  2BTQ B;  2JNB A;  3OBW A;  5HP8 A;  3HKE B;  5BMV B;  2DT4 A;  1DBF A;  3HWU A;  3V7E A;  3ZP7 A; 
#chains in the Genus database with same CATH homology
 3S02 A;  4ERH A;  4B5C A;  4B62 A;  4ZHV A;  3TD3 A;  4G4Y A;  4G4V A;  2HQS C;  4G4X A;  2W8B C;  2ZF8 A;  5EB0 A;  3S0W A;  3S03 A;  2KGW A;  3CYQ A;  4G4Z A;  3S0Y A;  4G88 A;  1OAP A;  3LDT A;  3S0H A;  3KHN A;  1R1M A;  2K1S A;  4G4W A;  3TD5 A;  3WPX A;  2N48 A;  2ZOV A;  2MQE A;  2LCA A;  3TD4 A;  3IMP A;  4R40 B;  5EB1 B;  2AIZ P;  3S06 A;  2L26 A;  5EAZ A;  4ZHW A;  2ZVY A;  4RHA A;  2LBT A;  3CYP B;  3OON A;  4ZHY B;  4PWT A;  2ZVZ A;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...