2N48A

Ec-nmr structure of escherichia coli yiad determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target er553
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Probable lipoprotein YiaD
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 47
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2n48A00
4RHAA 2ZVZA 3S0HA 5EB1B 3WPWA 4ZHWA 2L26A 3S03A 3IMPA 5EB0A 3S0WA 3TD3A 4G4ZA 1OAPA 3S0YA 2W8BC 3KHNA 4G4VA 2ZOVA 3S02A 4G4XA 4ZHYB 1R1MA 4B5CA 3WPXA 2LCAA 3CYPB 4G4WA 3OONA 4B62A 4PWTA 2KGWA 2ZF8A 3CYQA 2N48A 2K1SA 4ZHVA 4G88A 4R40B 5EAZA 3S06A 2MQEA 2LBTA 3TD5A 2ZVYA 3TD4A 3LDTA 2AIZP 4G4YA 4ERHA 2HQSC
chains in the Genus database with same CATH superfamily
5CB4B 2Z01A 4O2BB 3CCRF 4BVRA 3HJWC 1RA4A 3V4DA 1SZQA 5GANK 5LYJA 4C81A 3LWRC 3BYQA 2QEXF 5DCVA 1Q81H 1JFFA 3N4ZA 3UT5A 1KNKA 3HAXD 4U3JB 4G4WA 1GX1A 1VQPF 3M4SA 4X1IB 5EAZA 3JAWA 5CB4A 2OTMA 4ERHA 4WBNA 1X7OA 4B45A 1VH8A 2HP0B 1NMUB 4BY9D 3ERNA 5IYZA 5B8FA 3WGJA 3MDOA 5CA1B 1OAPA 4C8GA 3KHNA 5IJ9B 3WGNA 2ZOVA 3ZO8A 1FFXB 1DBFA 3FPIA 3OONA 4TUYB 1RQ2A 2PHNA 4ZHVA 4G88A 5AVMA 4BT5A 5HP8A 3D54A 2QA4F 1FNJA 4I4TA 1YI2F 1W55A 3E20B 1DT9A 5G4VC 2BTUA 1YJWF 4LCKA 3O85A 4KWEA 3NVKE 3P4EA 2OTJF 2VXYA 2VGMA 3NVIB 3VCZA 3M1XA 1VQOF 5ITZA 4I55B 1YIJF 3HKDB 4DRXB 2HVYD 1RLUA 4C8IA 3RYFB 2VAWA 5FLXM 2OZBA 2AMTA 2UZHA 4ZK7A 2BTQB 4E6EA 3S06A 3HKCA 4F6RB 4B46A 1Z5VA 3N2KB 1CN7A 4IIJB 3J81M 1IPAA 1VQ7F 5KMGB 1W42A 2CZWA 3VIUA 1X52A 2I6DA 4TV8B 3JAKA 4I55A 4ZOLB 3JCMM 5JCOC 3PAFA 5HP7A 3JALB 2RHHA 4M8IA 2R751 4O4IA 3G4SF 1IV1A 5BMVB 5LOVB 3CG6A 2B33A 3CPQA 4PWTA 3HWUA 4EI9A 1H48A 5EYPA 2KTUA 1JN1A 2KG4A 5EIBC 1H47A 3RYHB 1J7HA 3FBAA 2HS3A 1TVKA 4TV8A 1KQSF 4ZOLA 3WPWA 3JALA 1JJ2F 1W2BF 1Z5WA 4G4ZA 4C4WC 5GONB 2QI2A 5BMVA 1U3LA 3E22A 1QVFF 3WGLA 4C82A 1KD1H 1U40A 1VHAA 3CYPB 3QUWA 2Z1TA 1W41A 3C9RA 3J80M 3CCMF 1IV4A 3C9TA 3UT5B 5JVDA 2R6R1 2RHJA 2MQEA 3OW2F 3JASB 3MBMA 4ZHQA 5LXTA 3F0EA 5MN6A 3CCVF 3JAWB 4RHAA 2ZODA 3VOAA 2CVLA 3S0HA 3PLAC 1T0KB 4WBNB 3CCQF 5GONA 3D00A 1VQ5F 1XV2A 3LFOA 1RLGA 2LBXA 5HY0A 2NMUA 1W40A 3MCQA 5IYZB 5CA0A 1U3PA 1R1MA 3WGMA 3VMFB 4ZI7A 1OFUA 3JASA 1QD9A 3CPWF 2IG8A 3HKEA 2RHOA 3V7EA 2EWCA 2VGNA 1XRGA 4BVTA 2F9ZC 4I4TB 1QU9A 2UYNB 3I55F 5EO3A 1ZWZA 3GHZA 3RA5A 4BVQA 1GO0A 1GO1A 3TD3A 3N2GA 4BT3A 3CCUF 2YYEA 1W59A 2IAFA 3GTZA 3WGKA 3KIZA 3P0ZA 4G4XA 4NQ3A 5FJ4C 4EI8A 1YITF 3CC7F 4TZZA 2H8EA 5ITZB 2UYKA 5FNVA 2N48A 3U0OA 1YHQF 3WJQA 1W5BA 4O2AA 3IEWA 2HQSC 2UYNA 2PMPA 3LMEA 5HY4A 3HKCB 3VYTC 1X7PA 4YJ2B 1VQVA 3CCJF 3DC2A 1IV3A 2ALEA 3IKFA 3CC4F 2OTLF 5G4UC 3C9SA 3JAMM 3I56F 2KTVA 1NQ3A 2UYJA 3JAKB 2UYPA 1FNKA 1UI9A 1S72F 4O4IB 1JY8A 4RQOA 5LP6A 3CCSF 1RQ7A 4YJ2A 1TUBA 2DT4A 1N8RH 3SIUA 5EYPB 1VK3A 2WALA 4X3LA 2DYYA 2CWJA 1W581 1W3EX 3S03A 3KJKA 4FFBA 4O4JA 2G9IA 2RHLA 3S0WA 5JH7B 1TVKB 3HTNA 2HS4A 3CXCF 3CMEF 1VQMF 3S02A 2GLZA 1VQ6F 2LCAA 1XHOA 4B62A 3R0PA 1PXWA 3FD6A 4X1KA 3E22B 1QAHA 3K14A 5J2UA 1CK2A 3J7AR 2ZVYA 2AIZP 2HS0A 5MN5A 1W5AA 2GVIA 4I50A 1GZ0A 3LWVC 3K0TA 3RYCA 5JVDB 3ZOPA 5JH7A 4ZHQB 4O4HA 2BO1A 3IMPA 3M84A 5LXTB 2P6YA 4TV9A 3JATA 3OBYA 5HY2A 3K12A 1QVGF 3NMUC 5MN4A 3I7TA 3CC2F 5CA0B 3CMAF 2YXZA 4EI7A 1SA0B 3AGKA 3LYBA 3K2XA 4ZI7B 4X3MA 5GIPC 3L7QA 1VQLF 1K8AH 5HY1A 3HKEB 5C8YA 4O4LA 1YJNF 4DXDA 5EB1B 5EIBD 2IQQA 2V9YA 3ZP4A 2I6RA 3RYIA 3Q8HA 3VTIC 5IJ0A 5HXZA 3NK6A 4BT6A 2QTPA 1VQKF 3JARA 3N2GB 1CLIA 3T80A 1SA0A 3LWPC 3IEQA 3IR9A 1VQ8F 5J2TA 3LWQC 5FNVB 3G6EF 2VAMA 3NK7A 3B6NA 3MQWA 2CSLA 3V7QA 2HP3A 2ZVZA 3C8LA 4X20A 2BTOA 4IHJB 2H6LA 4O2AB 4YJ3A 3ESJA 5A2QM 4X1YA 2CHSA 3CD6F 3HKBB 3RE3A 4ZHYB 3WPXA 3VOBA 5KX5A 1VQNF 2ZF8A 3CYQA 3F6MA 4O2BA 1JD1A 1KNJA 4IHJA 4EB6B 3SIVA 1ONIA 2Q1YA 5LP6B 3C9UA 1Q82H 4LNUB 5HXUA 1TUBB 2L26A 4BW0B 2CHTA 3HKBA 3F0GA 2Z1FA 3CCLF 1YQNA 3E1YA 4U3JA 5JCOA 2W8BC 3KE1A 4FFBB 4O4JB 4C8EA 5GAPK 4X1IA 1Q8RA 4B5CA 1IV2A 1W5FA 3RA6A 1FSZA 4NUTA 3JVHA 1Q7YH 4U39A 4R40B 5GIOC 4EB6A 2LBWA 1PF5A 1UFYA 5EWRA 3TD4A 4X1KB 4G4YA 1T0AA 5EZYB 2HP0A 4LNUA 5J2UB 3ON1A 2CW4A 3VYUC 3VO8A 5CA1A 2VAPA 4I50B 4XCQA 3RYCB 5IJ9A 1K73H 4BT4A 3EORA 1FFXA 1U43A 4O4HB 4TUYA 1COMA 4G4VA 4TV9B 4NWOB 2ZAUA 2HRYA 3JATB 1E7KA 1SDSA 1X25A 3MCAB 3QHDA 3VI6A 5HWEA 5IT9M 2K1SA 1NJIH 5EZYA 3DDNA 3IKEA 3WJRA 2GZLA 1XBIA 1W57A 2HX0A 5LA6B 2Q1XA 5EB0A 2RB9A 3I3FA 4BT2A 3QTYA 3HKDA 4HNAB 3P10A 4DRXA 4O4LB 1H7MA 5C8YB 1YJ9F 3RYFA 3RYIB 2JNBA 3FFMA 5IJ0B 3G71F 2AIFA 2Z1EA 5JQGB 3V3TA 4F6RA 1K9MH 5LP6C 1Q86H 3JARB 3N2KA 3LWOC 3N4YA 4IIJA 1VQ9F 2LBTA 3TD5A 1M1KH 5KMGA 4BVSA 3ZP7A 1YGYA 3GYQA 5LA6A 5J2TB 1W5EA 2OHWA 3CB2A 4HNAA 4ZHWA 3F0DA 2Z1UA 3WXMB 3CCEF 4X20B 5LOVA 4YJ3B 3S0YA 2H8CA 1ODEA 3KJJA 3D01A 5JQGA 3FD5A 5LYJB 4X1YB 5GINC 1VQ4F 3ELCA 1JFFB 1M90H 2KGWA 4BT7A 2FGYA 3RYHA 3F0FA 3OBWA 2HRUA 3VYSC 5KX5B 3LDTA 2FC3A 3WJPA 1KC8H
chains in the Genus database with same CATH topology
4RHAA 2ZVZA 3S0HA 5EB1B 3WPWA 4ZHWA 2L26A 3S03A 3IMPA 5EB0A 3S0WA 3TD3A 4G4ZA 1OAPA 3S0YA 2W8BC 3KHNA 4G4VA 2ZOVA 3S02A 4G4XA 4ZHYB 1R1MA 4B5CA 3WPXA 2LCAA 3CYPB 4G4WA 3OONA 4B62A 4PWTA 2KGWA 2ZF8A 3CYQA 2N48A 2K1SA 4ZHVA 4G88A 4R40B 5EAZA 3S06A 2MQEA 2LBTA 3TD5A 2ZVYA 3TD4A 3LDTA 2AIZP 4G4YA 4ERHA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHA A;  2ZVZ A;  3S0H A;  5EB1 B;  3WPW A;  4ZHW A;  2L26 A;  3S03 A;  3IMP A;  5EB0 A;  3S0W A;  3TD3 A;  4G4Z A;  1OAP A;  3S0Y A;  2W8B C;  3KHN A;  4G4V A;  2ZOV A;  3S02 A;  4G4X A;  4ZHY B;  1R1M A;  4B5C A;  3WPX A;  2LCA A;  3CYP B;  4G4W A;  3OON A;  4B62 A;  4PWT A;  2KGW A;  2ZF8 A;  3CYQ A;  2N48 A;  2K1S A;  4ZHV A;  4G88 A;  4R40 B;  5EAZ A;  3S06 A;  2MQE A;  2LBT A;  3TD5 A;  2ZVY A;  3TD4 A;  3LDT A;  2AIZ P;  4G4Y A;  4ERH A;  2HQS C; 
#chains in the Genus database with same CATH topology
 5CB4 B;  2Z01 A;  4O2B B;  3CCR F;  4BVR A;  3HJW C;  1RA4 A;  3V4D A;  1SZQ A;  5GAN K;  5LYJ A;  4C81 A;  3LWR C;  3BYQ A;  2QEX F;  5DCV A;  1Q81 H;  1JFF A;  3N4Z A;  3UT5 A;  1KNK A;  3HAX D;  4U3J B;  4G4W A;  1GX1 A;  1VQP F;  3M4S A;  4X1I B;  5EAZ A;  3JAW A;  5CB4 A;  2OTM A;  4ERH A;  4WBN A;  1X7O A;  4B45 A;  1VH8 A;  2HP0 B;  1NMU B;  4BY9 D;  3ERN A;  5IYZ A;  5B8F A;  3WGJ A;  3MDO A;  5CA1 B;  1OAP A;  4C8G A;  3KHN A;  5IJ9 B;  3WGN A;  2ZOV A;  3ZO8 A;  1FFX B;  1DBF A;  3FPI A;  3OON A;  4TUY B;  1RQ2 A;  2PHN A;  4ZHV A;  4G88 A;  5AVM A;  4BT5 A;  5HP8 A;  3D54 A;  2QA4 F;  1FNJ A;  4I4T A;  1YI2 F;  1W55 A;  3E20 B;  1DT9 A;  5G4V C;  2BTU A;  1YJW F;  4LCK A;  3O85 A;  4KWE A;  3NVK E;  3P4E A;  2OTJ F;  2VXY A;  2VGM A;  3NVI B;  3VCZ A;  3M1X A;  1VQO F;  5ITZ A;  4I55 B;  1YIJ F;  3HKD B;  4DRX B;  2HVY D;  1RLU A;  4C8I A;  3RYF B;  2VAW A;  5FLX M;  2OZB A;  2AMT A;  2UZH A;  4ZK7 A;  2BTQ B;  4E6E A;  3S06 A;  3HKC A;  4F6R B;  4B46 A;  1Z5V A;  3N2K B;  1CN7 A;  4IIJ B;  3J81 M;  1IPA A;  1VQ7 F;  5KMG B;  1W42 A;  2CZW A;  3VIU A;  1X52 A;  2I6D A;  4TV8 B;  3JAK A;  4I55 A;  4ZOL B;  3JCM M;  5JCO C;  3PAF A;  5HP7 A;  3JAL B;  2RHH A;  4M8I A;  2R75 1;  4O4I A;  3G4S F;  1IV1 A;  5BMV B;  5LOV B;  3CG6 A;  2B33 A;  3CPQ A;  4PWT A;  3HWU A;  4EI9 A;  1H48 A;  5EYP A;  2KTU A;  1JN1 A;  2KG4 A;  5EIB C;  1H47 A;  3RYH B;  1J7H A;  3FBA A;  2HS3 A;  1TVK A;  4TV8 A;  1KQS F;  4ZOL A;  3WPW A;  3JAL A;  1JJ2 F;  1W2B F;  1Z5W A;  4G4Z A;  4C4W C;  5GON B;  2QI2 A;  5BMV A;  1U3L A;  3E22 A;  1QVF F;  3WGL A;  4C82 A;  1KD1 H;  1U40 A;  1VHA A;  3CYP B;  3QUW A;  2Z1T A;  1W41 A;  3C9R A;  3J80 M;  3CCM F;  1IV4 A;  3C9T A;  3UT5 B;  5JVD A;  2R6R 1;  2RHJ A;  2MQE A;  3OW2 F;  3JAS B;  3MBM A;  4ZHQ A;  5LXT A;  3F0E A;  5MN6 A;  3CCV F;  3JAW B;  4RHA A;  2ZOD A;  3VOA A;  2CVL A;  3S0H A;  3PLA C;  1T0K B;  4WBN B;  3CCQ F;  5GON A;  3D00 A;  1VQ5 F;  1XV2 A;  3LFO A;  1RLG A;  2LBX A;  5HY0 A;  2NMU A;  1W40 A;  3MCQ A;  5IYZ B;  5CA0 A;  1U3P A;  1R1M A;  3WGM A;  3VMF B;  4ZI7 A;  1OFU A;  3JAS A;  1QD9 A;  3CPW F;  2IG8 A;  3HKE A;  2RHO A;  3V7E A;  2EWC A;  2VGN A;  1XRG A;  4BVT A;  2F9Z C;  4I4T B;  1QU9 A;  2UYN B;  3I55 F;  5EO3 A;  1ZWZ A;  3GHZ A;  3RA5 A;  4BVQ A;  1GO0 A;  1GO1 A;  3TD3 A;  3N2G A;  4BT3 A;  3CCU F;  2YYE A;  1W59 A;  2IAF A;  3GTZ A;  3WGK A;  3KIZ A;  3P0Z A;  4G4X A;  4NQ3 A;  5FJ4 C;  4EI8 A;  1YIT F;  3CC7 F;  4TZZ A;  2H8E A;  5ITZ B;  2UYK A;  5FNV A;  2N48 A;  3U0O A;  1YHQ F;  3WJQ A;  1W5B A;  4O2A A;  3IEW A;  2HQS C;  2UYN A;  2PMP A;  3LME A;  5HY4 A;  3HKC B;  3VYT C;  1X7P A;  4YJ2 B;  1VQV A;  3CCJ F;  3DC2 A;  1IV3 A;  2ALE A;  3IKF A;  3CC4 F;  2OTL F;  5G4U C;  3C9S A;  3JAM M;  3I56 F;  2KTV A;  1NQ3 A;  2UYJ A;  3JAK B;  2UYP A;  1FNK A;  1UI9 A;  1S72 F;  4O4I B;  1JY8 A;  4RQO A;  5LP6 A;  3CCS F;  1RQ7 A;  4YJ2 A;  1TUB A;  2DT4 A;  1N8R H;  3SIU A;  5EYP B;  1VK3 A;  2WAL A;  4X3L A;  2DYY A;  2CWJ A;  1W58 1;  1W3E X;  3S03 A;  3KJK A;  4FFB A;  4O4J A;  2G9I A;  2RHL A;  3S0W A;  5JH7 B;  1TVK B;  3HTN A;  2HS4 A;  3CXC F;  3CME F;  1VQM F;  3S02 A;  2GLZ A;  1VQ6 F;  2LCA A;  1XHO A;  4B62 A;  3R0P A;  1PXW A;  3FD6 A;  4X1K A;  3E22 B;  1QAH A;  3K14 A;  5J2U A;  1CK2 A;  3J7A R;  2ZVY A;  2AIZ P;  2HS0 A;  5MN5 A;  1W5A A;  2GVI A;  4I50 A;  1GZ0 A;  3LWV C;  3K0T A;  3RYC A;  5JVD B;  3ZOP A;  5JH7 A;  4ZHQ B;  4O4H A;  2BO1 A;  3IMP A;  3M84 A;  5LXT B;  2P6Y A;  4TV9 A;  3JAT A;  3OBY A;  5HY2 A;  3K12 A;  1QVG F;  3NMU C;  5MN4 A;  3I7T A;  3CC2 F;  5CA0 B;  3CMA F;  2YXZ A;  4EI7 A;  1SA0 B;  3AGK A;  3LYB A;  3K2X A;  4ZI7 B;  4X3M A;  5GIP C;  3L7Q A;  1VQL F;  1K8A H;  5HY1 A;  3HKE B;  5C8Y A;  4O4L A;  1YJN F;  4DXD A;  5EB1 B;  5EIB D;  2IQQ A;  2V9Y A;  3ZP4 A;  2I6R A;  3RYI A;  3Q8H A;  3VTI C;  5IJ0 A;  5HXZ A;  3NK6 A;  4BT6 A;  2QTP A;  1VQK F;  3JAR A;  3N2G B;  1CLI A;  3T80 A;  1SA0 A;  3LWP C;  3IEQ A;  3IR9 A;  1VQ8 F;  5J2T A;  3LWQ C;  5FNV B;  3G6E F;  2VAM A;  3NK7 A;  3B6N A;  3MQW A;  2CSL A;  3V7Q A;  2HP3 A;  2ZVZ A;  3C8L A;  4X20 A;  2BTO A;  4IHJ B;  2H6L A;  4O2A B;  4YJ3 A;  3ESJ A;  5A2Q M;  4X1Y A;  2CHS A;  3CD6 F;  3HKB B;  3RE3 A;  4ZHY B;  3WPX A;  3VOB A;  5KX5 A;  1VQN F;  2ZF8 A;  3CYQ A;  3F6M A;  4O2B A;  1JD1 A;  1KNJ A;  4IHJ A;  4EB6 B;  3SIV A;  1ONI A;  2Q1Y A;  5LP6 B;  3C9U A;  1Q82 H;  4LNU B;  5HXU A;  1TUB B;  2L26 A;  4BW0 B;  2CHT A;  3HKB A;  3F0G A;  2Z1F A;  3CCL F;  1YQN A;  3E1Y A;  4U3J A;  5JCO A;  2W8B C;  3KE1 A;  4FFB B;  4O4J B;  4C8E A;  5GAP K;  4X1I A;  1Q8R A;  4B5C A;  1IV2 A;  1W5F A;  3RA6 A;  1FSZ A;  4NUT A;  3JVH A;  1Q7Y H;  4U39 A;  4R40 B;  5GIO C;  4EB6 A;  2LBW A;  1PF5 A;  1UFY A;  5EWR A;  3TD4 A;  4X1K B;  4G4Y A;  1T0A A;  5EZY B;  2HP0 A;  4LNU A;  5J2U B;  3ON1 A;  2CW4 A;  3VYU C;  3VO8 A;  5CA1 A;  2VAP A;  4I50 B;  4XCQ A;  3RYC B;  5IJ9 A;  1K73 H;  4BT4 A;  3EOR A;  1FFX A;  1U43 A;  4O4H B;  4TUY A;  1COM A;  4G4V A;  4TV9 B;  4NWO B;  2ZAU A;  2HRY A;  3JAT B;  1E7K A;  1SDS A;  1X25 A;  3MCA B;  3QHD A;  3VI6 A;  5HWE A;  5IT9 M;  2K1S A;  1NJI H;  5EZY A;  3DDN A;  3IKE A;  3WJR A;  2GZL A;  1XBI A;  1W57 A;  2HX0 A;  5LA6 B;  2Q1X A;  5EB0 A;  2RB9 A;  3I3F A;  4BT2 A;  3QTY A;  3HKD A;  4HNA B;  3P10 A;  4DRX A;  4O4L B;  1H7M A;  5C8Y B;  1YJ9 F;  3RYF A;  3RYI B;  2JNB A;  3FFM A;  5IJ0 B;  3G71 F;  2AIF A;  2Z1E A;  5JQG B;  3V3T A;  4F6R A;  1K9M H;  5LP6 C;  1Q86 H;  3JAR B;  3N2K A;  3LWO C;  3N4Y A;  4IIJ A;  1VQ9 F;  2LBT A;  3TD5 A;  1M1K H;  5KMG A;  4BVS A;  3ZP7 A;  1YGY A;  3GYQ A;  5LA6 A;  5J2T B;  1W5E A;  2OHW A;  3CB2 A;  4HNA A;  4ZHW A;  3F0D A;  2Z1U A;  3WXM B;  3CCE F;  4X20 B;  5LOV A;  4YJ3 B;  3S0Y A;  2H8C A;  1ODE A;  3KJJ A;  3D01 A;  5JQG A;  3FD5 A;  5LYJ B;  4X1Y B;  5GIN C;  1VQ4 F;  3ELC A;  1JFF B;  1M90 H;  2KGW A;  4BT7 A;  2FGY A;  3RYH A;  3F0F A;  3OBW A;  2HRU A;  3VYS C;  5KX5 B;  3LDT A;  2FC3 A;  3WJP A;  1KC8 H; 
#chains in the Genus database with same CATH homology
 4RHA A;  2ZVZ A;  3S0H A;  5EB1 B;  3WPW A;  4ZHW A;  2L26 A;  3S03 A;  3IMP A;  5EB0 A;  3S0W A;  3TD3 A;  4G4Z A;  1OAP A;  3S0Y A;  2W8B C;  3KHN A;  4G4V A;  2ZOV A;  3S02 A;  4G4X A;  4ZHY B;  1R1M A;  4B5C A;  3WPX A;  2LCA A;  3CYP B;  4G4W A;  3OON A;  4B62 A;  4PWT A;  2KGW A;  2ZF8 A;  3CYQ A;  2N48 A;  2K1S A;  4ZHV A;  4G88 A;  4R40 B;  5EAZ A;  3S06 A;  2MQE A;  2LBT A;  3TD5 A;  2ZVY A;  3TD4 A;  3LDT A;  2AIZ P;  4G4Y A;  4ERH A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...