2N48A

Ec-nmr structure of escherichia coli yiad determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target er553
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable lipoprotein YiaD
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid binding protein
total genus 47
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2n48A00
2ZOVA 4ZHVA 2LCAA 2MQEA 2L26A 3S0WA 3S06A 2K1SA 4ZHWA 2ZF8A 5EB1B 3S0YA 2W8BC 3OONA 2KGWA 4G4XA 4G4VA 4G4YA 5EAZA 4G88A 4R40B 3CYQA 1R1MA 3WPXA 4ERHA 3S03A 3LDTA 1OAPA 3S0HA 3WPWA 3IMPA 3TD3A 4B5CA 4ZHYB 2HQSC 2ZVZA 3KHNA 2N48A 4G4ZA 4PWTA 3TD4A 4G4WA 3CYPB 4RHAA 2AIZP 2LBTA 3S02A 5EB0A 3TD5A 4B62A 2ZVYA
chains in the Genus database with same CATH superfamily
1JFFA 3HTNA 1FFXB 5LYJA 3RYHA 2HX0A 3FFMA 2HS4A 2LCAA 3QHDA 4NWOB 4B45A 2K1SA 4TV8A 5HY2A 3C8LA 1PXWA 2CHTA 2IAFA 3N2GA 1SA0B 3KJKA 3BYQA 4BT5A 5GANK 4B5CA 1ODEA 1DT9A 2HQSC 4F6RB 1K73H 3JARB 1M90H 2GLZA 1Q81H 3ZP7A 3HKDB 2R6R1 2KTUA 4O2AB 4BVTA 3LWVC 5JQGA 2RHOA 3QUWA 4O4HA 5KMGB 4TUYA 5MN4A 2H8CA 1XV2A 1X52A 5FJ4C 1GO1A 2MQEA 1JJ2F 1IV1A 3CCEF 1VQVA 5HY4A 3CC2F 2BTOA 2W8BC 5GONB 2KGWA 2RHLA 3K12A 4IHJB 4ZOLB 1VQKF 4I4TA 1R1MA 4I55B 1W41A 1OAPA 4IIJA 4DXDA 5LA6A 3WXMB 3E20B 3G6EF 4WBNB 3CYPB 3K0TA 4YJ2A 5G4UC 4KWEA 5J2UA 4B62A 2BTUA 3C9RA 4U3JB 3GYQA 3JALA 1YITF 3VCZA 5G4VC 3MBMA 3CMAF 5J2TA 1H47A 1VQ8F 3DDNA 3S0YA 1GX1A 5BMVA 1U40A 3M84A 4TV8B 3LWQC 3I55F 3F6MA 4EI9A 5FLXM 2RHHA 3CB2A 2Z01A 3KJJA 1T0KB 3CXCF 5C8YB 2OTMA 4G4ZA 3RA5A 4G4WA 1Q8RA 2BTQB 1FFXA 3JVHA 3IEQA 5JQGB 1IV4A 1W55A 3SIUA 1YQNA 3WJQA 4TUYB 1IPAA 5JCOC 1X7OA 1XRGA 4NUTA 5LP6A 2VAMA 3LYBA 1Q82H 2KTVA 2B33A 4EI7A 1YJWF 3VYUC 2LBWA 1SA0A 1W2BF 3VI6A 3F0DA 4I4TB 3JARA 2ZVZA 1DBFA 4IIJB 2ZAUA 4O2AA 4BT3A 1NJIH 5LA6B 2CHSA 3I56F 3R0PA 2EWCA 5HXUA 2RHJA 1KNJA 4BW0B 2OHWA 2QTPA 3RA6A 1K9MH 1RLUA 3S0WA 3ZOPA 5CA0A 5EB1B 2KG4A 2OZBA 5GONA 4O4JB 4LNUA 5J2TB 2Q1XA 1W57A 4ZOLA 1Z5WA 2CW4A 1SZQA 1W42A 4G88A 4RQOA 5EO3A 5ITZA 3CCJF 3F0EA 4ZHYB 3ZP4A 5HY0A 1W5BA 1SDSA 1TVKB 3SIVA 3JASB 5EIBC 2AIZP 1Z5VA 5A2QM 4U3JA 5DCVA 5GAPK 3I7TA 1RQ7A 5LOVB 5CA1B 3RYCB 3K14A 4ZHVA 3VO8A 4C4WC 4U39A 2L26A 3FD5A 1RQ2A 4ZI7A 1ONIA 3OBYA 3FPIA 2DYYA 2UZHA 5LP6B 1NQ3A 4G4VA 4G4YA 2P6YA 4X1IB 1J7HA 5IT9M 3ON1A 5C8YA 3P0ZA 3RE3A 4PWTA 3VIUA 1KQSF 4RHAA 5FNVB 4X1KA 4O4LB 3CMEF 3FD6A 3V4DA 1UI9A 3LWOC 1W3EX 3OW2F 2RB9A 3MCQA 2YXZA 2QI2A 2DT4A 1CN7A 2ZF8A 4XCQA 5CA0B 5EIBD 3M4SA 2HVYD 3HWUA 4LNUB 1XBIA 2HP0A 5JCOA 3CC4F 5ITZB 3MCAB 4BVQA 5GIPC 1IV2A 3P10A 1W5AA 5EB0A 5GIOC 3VTIC 1VQ4F 3D54A 4BT4A 3HJWC 5JH7A 1KD1H 1YHQF 2V9YA 4O4JA 1M1KH 2VGNA 2FC3A 4ZI7B 1VQ6F 5MN6A 1YIJF 1E7KA 3F0FA 1VK3A 2Q1YA 3OBWA 3CCQF 4C82A 1TVKA 4BT7A 1QVGF 5CB4B 3JASA 3RYFB 4E6EA 3WJPA 3VOAA 2H6LA 5LOVA 5CA1A 3VMFB 4X1KB 3FBAA 3RYCA 3RYIA 1W5EA 2PHNA 1GO0A 3V3TA 3IKFA 2H8EA 5IYZB 4NQ3A 3UT5A 3JAMM 2UYKA 1VHAA 2ALEA 5HY1A 1COMA 5EAZA 4X1IA 3DC2A 5JVDB 4EI8A 1FNJA 2LBXA 3WGJA 2HP0B 3EORA 4O4IA 4C8EA 3HKCB 5FNVA 5GINC 4BVRA 4O4LA 1VQNF 5EZYB 5IJ9B 3P4EA 3T80A 2QEXF 1UFYA 4BT6A 2ZOVA 1YJNF 4FFBB 4YJ3B 3LWRC 3E22A 4ZHWA 5JH7B 3G4SF 3ELCA 5EYPB 5HWEA 3CD6F 3LMEA 1JY8A 3JAKA 5B8FA 3CCMF 4ZK7A 3K2XA 3CG6A 3WPWA 3C9SA 5EWRA 2N48A 1VQ7F 1VQLF 5LXTA 4ZHQB 3O85A 2LBTA 3LWPC 3KIZA 3N4ZA 3TD5A 1QU9A 2CSLA 2HRUA 2NMUA 5IJ0B 2UYPA 3RYIB 3V7QA 1T0AA 1U43A 3WGLA 1VQOF 4I50A 1VH8A 4DRXA 3UT5B 1W5FA 3PAFA 3ESJA 2WALA 3LFOA 2JNBA 3MDOA 3WPXA 2AIFA 3S03A 4BY9D 4X3MA 2VGMA 3JAWB 4M8IA 5CB4A 4EB6B 3HKEA 4TV9B 3RYFA 5MN5A 5KX5A 4C8IA 4O4IB 3S02A 1VQ9F 4X20A 3HKBB 3N2KB 1CK2A 3KE1A 5IYZA 2I6RA 4HNAB 1RA4A 3IR9A 1W59A 3E22B 3VYTC 4BVSA 2CWJA 2VAPA 1W581 2UYJA 1VQPF 1N8RH 3AGKA 5JVDA 1YGYA 3JAKB 2I6DA 3NK7A 2HRYA 3C9TA 5HP7A 1VQ5F 3HKCA 2ZODA 5EZYA 3HAXD 5IJ9A 3V7EA 1JN1A 1W40A 2R751 5LXTB 2QA4F 3E1YA 1FSZA 3JATB 4FFBA 4YJ3A 4C81A 4X1YA 3B6NA 3S06A 3NVIB 4BT2A 3C9UA 5EYPA 2OTJF 2GZLA 2HS0A 4B46A 3D00A 3OONA 4G4XA 1QVFF 4I50B 4DRXB 2Z1UA 4ERHA 1RLGA 3S0HA 3F0GA 1S72F 3J80M 3PLAC 3ERNA 1H7MA 4ZHQA 5AVMA 3HKEB 5KX5B 1FNKA 1QD9A 5IJ0A 1ZWZA 2ZVYA 4X3LA 4X20B 1JFFB 2G9IA 3M1XA 5LYJB 3RYHB 4O2BA 3U0OA 3L7QA 2YYEA 3J7AR 1U3LA 2VAWA 1XHOA 3N2GB 1YI2F 1KC8H 3JAWA 1KNKA 3TD3A 4C8GA 4EB6A 4TZZA 4TV9A 1TUBA 2GVIA 2UYNA 1X7PA 3TD4A 3CCLF 3CPQA 1JD1A 3HKBA 3N2KA 3N4YA 3WJRA 3I3FA 4O4HB 5HXZA 2CZWA 1VQMF 4HNAA 4LCKA 1U3PA 3NMUC 2Z1EA 3GHZA 3CCVF 4X1YB 5HP8A 1GZ0A 4R40B 1K8AH 4F6RA 3Q8HA 3J81M 1Q86H 2PMPA 3HKDA 2IG8A 3QTYA 3VOBA 3KHNA 2VXYA 2OTLF 2F9ZC 3NK6A 3CCUF 3CCRF 3JCMM 1CLIA 5KMGA 3IKEA 1H48A 1X25A 4YJ2B 1IV3A 5J2UB 3JATA 3G71F 3JALB 2IQQA 1Q7YH 2CVLA 3VYSC 3D01A 3CC7F 3ZO8A 4O2BB 1QAHA 3WGKA 4IHJA 1NMUB 2Z1FA 4I55A 3CCSF 2Z1TA 5BMVB 3MQWA 1OFUA 3CYQA 1PF5A 2HS3A 3LDTA 2FGYA 3IEWA 3IMPA 3NVKE 3CPWF 4WBNA 2AMTA 1YJ9F 3WGNA 2HP3A 1TUBB 2BO1A 5LP6C 2UYNB 3WGMA 3GTZA
chains in the Genus database with same CATH topology
2ZOVA 4ZHVA 2LCAA 2MQEA 2L26A 3S0WA 3S06A 2K1SA 4ZHWA 2ZF8A 5EB1B 3S0YA 2W8BC 3OONA 2KGWA 4G4XA 4G4VA 4G4YA 5EAZA 4G88A 4R40B 3CYQA 1R1MA 3WPXA 4ERHA 3S03A 3LDTA 1OAPA 3S0HA 3WPWA 3IMPA 3TD3A 4B5CA 4ZHYB 2HQSC 2ZVZA 3KHNA 2N48A 4G4ZA 4PWTA 3TD4A 4G4WA 3CYPB 4RHAA 2AIZP 2LBTA 3S02A 5EB0A 3TD5A 4B62A 2ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOV A;  4ZHV A;  2LCA A;  2MQE A;  2L26 A;  3S0W A;  3S06 A;  2K1S A;  4ZHW A;  2ZF8 A;  5EB1 B;  3S0Y A;  2W8B C;  3OON A;  2KGW A;  4G4X A;  4G4V A;  4G4Y A;  5EAZ A;  4G88 A;  4R40 B;  3CYQ A;  1R1M A;  3WPX A;  4ERH A;  3S03 A;  3LDT A;  1OAP A;  3S0H A;  3WPW A;  3IMP A;  3TD3 A;  4B5C A;  4ZHY B;  2HQS C;  2ZVZ A;  3KHN A;  2N48 A;  4G4Z A;  4PWT A;  3TD4 A;  4G4W A;  3CYP B;  4RHA A;  2AIZ P;  2LBT A;  3S02 A;  5EB0 A;  3TD5 A;  4B62 A;  2ZVY A; 
#chains in the Genus database with same CATH topology
 1JFF A;  3HTN A;  1FFX B;  5LYJ A;  3RYH A;  2HX0 A;  3FFM A;  2HS4 A;  2LCA A;  3QHD A;  4NWO B;  4B45 A;  2K1S A;  4TV8 A;  5HY2 A;  3C8L A;  1PXW A;  2CHT A;  2IAF A;  3N2G A;  1SA0 B;  3KJK A;  3BYQ A;  4BT5 A;  5GAN K;  4B5C A;  1ODE A;  1DT9 A;  2HQS C;  4F6R B;  1K73 H;  3JAR B;  1M90 H;  2GLZ A;  1Q81 H;  3ZP7 A;  3HKD B;  2R6R 1;  2KTU A;  4O2A B;  4BVT A;  3LWV C;  5JQG A;  2RHO A;  3QUW A;  4O4H A;  5KMG B;  4TUY A;  5MN4 A;  2H8C A;  1XV2 A;  1X52 A;  5FJ4 C;  1GO1 A;  2MQE A;  1JJ2 F;  1IV1 A;  3CCE F;  1VQV A;  5HY4 A;  3CC2 F;  2BTO A;  2W8B C;  5GON B;  2KGW A;  2RHL A;  3K12 A;  4IHJ B;  4ZOL B;  1VQK F;  4I4T A;  1R1M A;  4I55 B;  1W41 A;  1OAP A;  4IIJ A;  4DXD A;  5LA6 A;  3WXM B;  3E20 B;  3G6E F;  4WBN B;  3CYP B;  3K0T A;  4YJ2 A;  5G4U C;  4KWE A;  5J2U A;  4B62 A;  2BTU A;  3C9R A;  4U3J B;  3GYQ A;  3JAL A;  1YIT F;  3VCZ A;  5G4V C;  3MBM A;  3CMA F;  5J2T A;  1H47 A;  1VQ8 F;  3DDN A;  3S0Y A;  1GX1 A;  5BMV A;  1U40 A;  3M84 A;  4TV8 B;  3LWQ C;  3I55 F;  3F6M A;  4EI9 A;  5FLX M;  2RHH A;  3CB2 A;  2Z01 A;  3KJJ A;  1T0K B;  3CXC F;  5C8Y B;  2OTM A;  4G4Z A;  3RA5 A;  4G4W A;  1Q8R A;  2BTQ B;  1FFX A;  3JVH A;  3IEQ A;  5JQG B;  1IV4 A;  1W55 A;  3SIU A;  1YQN A;  3WJQ A;  4TUY B;  1IPA A;  5JCO C;  1X7O A;  1XRG A;  4NUT A;  5LP6 A;  2VAM A;  3LYB A;  1Q82 H;  2KTV A;  2B33 A;  4EI7 A;  1YJW F;  3VYU C;  2LBW A;  1SA0 A;  1W2B F;  3VI6 A;  3F0D A;  4I4T B;  3JAR A;  2ZVZ A;  1DBF A;  4IIJ B;  2ZAU A;  4O2A A;  4BT3 A;  1NJI H;  5LA6 B;  2CHS A;  3I56 F;  3R0P A;  2EWC A;  5HXU A;  2RHJ A;  1KNJ A;  4BW0 B;  2OHW A;  2QTP A;  3RA6 A;  1K9M H;  1RLU A;  3S0W A;  3ZOP A;  5CA0 A;  5EB1 B;  2KG4 A;  2OZB A;  5GON A;  4O4J B;  4LNU A;  5J2T B;  2Q1X A;  1W57 A;  4ZOL A;  1Z5W A;  2CW4 A;  1SZQ A;  1W42 A;  4G88 A;  4RQO A;  5EO3 A;  5ITZ A;  3CCJ F;  3F0E A;  4ZHY B;  3ZP4 A;  5HY0 A;  1W5B A;  1SDS A;  1TVK B;  3SIV A;  3JAS B;  5EIB C;  2AIZ P;  1Z5V A;  5A2Q M;  4U3J A;  5DCV A;  5GAP K;  3I7T A;  1RQ7 A;  5LOV B;  5CA1 B;  3RYC B;  3K14 A;  4ZHV A;  3VO8 A;  4C4W C;  4U39 A;  2L26 A;  3FD5 A;  1RQ2 A;  4ZI7 A;  1ONI A;  3OBY A;  3FPI A;  2DYY A;  2UZH A;  5LP6 B;  1NQ3 A;  4G4V A;  4G4Y A;  2P6Y A;  4X1I B;  1J7H A;  5IT9 M;  3ON1 A;  5C8Y A;  3P0Z A;  3RE3 A;  4PWT A;  3VIU A;  1KQS F;  4RHA A;  5FNV B;  4X1K A;  4O4L B;  3CME F;  3FD6 A;  3V4D A;  1UI9 A;  3LWO C;  1W3E X;  3OW2 F;  2RB9 A;  3MCQ A;  2YXZ A;  2QI2 A;  2DT4 A;  1CN7 A;  2ZF8 A;  4XCQ A;  5CA0 B;  5EIB D;  3M4S A;  2HVY D;  3HWU A;  4LNU B;  1XBI A;  2HP0 A;  5JCO A;  3CC4 F;  5ITZ B;  3MCA B;  4BVQ A;  5GIP C;  1IV2 A;  3P10 A;  1W5A A;  5EB0 A;  5GIO C;  3VTI C;  1VQ4 F;  3D54 A;  4BT4 A;  3HJW C;  5JH7 A;  1KD1 H;  1YHQ F;  2V9Y A;  4O4J A;  1M1K H;  2VGN A;  2FC3 A;  4ZI7 B;  1VQ6 F;  5MN6 A;  1YIJ F;  1E7K A;  3F0F A;  1VK3 A;  2Q1Y A;  3OBW A;  3CCQ F;  4C82 A;  1TVK A;  4BT7 A;  1QVG F;  5CB4 B;  3JAS A;  3RYF B;  4E6E A;  3WJP A;  3VOA A;  2H6L A;  5LOV A;  5CA1 A;  3VMF B;  4X1K B;  3FBA A;  3RYC A;  3RYI A;  1W5E A;  2PHN A;  1GO0 A;  3V3T A;  3IKF A;  2H8E A;  5IYZ B;  4NQ3 A;  3UT5 A;  3JAM M;  2UYK A;  1VHA A;  2ALE A;  5HY1 A;  1COM A;  5EAZ A;  4X1I A;  3DC2 A;  5JVD B;  4EI8 A;  1FNJ A;  2LBX A;  3WGJ A;  2HP0 B;  3EOR A;  4O4I A;  4C8E A;  3HKC B;  5FNV A;  5GIN C;  4BVR A;  4O4L A;  1VQN F;  5EZY B;  5IJ9 B;  3P4E A;  3T80 A;  2QEX F;  1UFY A;  4BT6 A;  2ZOV A;  1YJN F;  4FFB B;  4YJ3 B;  3LWR C;  3E22 A;  4ZHW A;  5JH7 B;  3G4S F;  3ELC A;  5EYP B;  5HWE A;  3CD6 F;  3LME A;  1JY8 A;  3JAK A;  5B8F A;  3CCM F;  4ZK7 A;  3K2X A;  3CG6 A;  3WPW A;  3C9S A;  5EWR A;  2N48 A;  1VQ7 F;  1VQL F;  5LXT A;  4ZHQ B;  3O85 A;  2LBT A;  3LWP C;  3KIZ A;  3N4Z A;  3TD5 A;  1QU9 A;  2CSL A;  2HRU A;  2NMU A;  5IJ0 B;  2UYP A;  3RYI B;  3V7Q A;  1T0A A;  1U43 A;  3WGL A;  1VQO F;  4I50 A;  1VH8 A;  4DRX A;  3UT5 B;  1W5F A;  3PAF A;  3ESJ A;  2WAL A;  3LFO A;  2JNB A;  3MDO A;  3WPX A;  2AIF A;  3S03 A;  4BY9 D;  4X3M A;  2VGM A;  3JAW B;  4M8I A;  5CB4 A;  4EB6 B;  3HKE A;  4TV9 B;  3RYF A;  5MN5 A;  5KX5 A;  4C8I A;  4O4I B;  3S02 A;  1VQ9 F;  4X20 A;  3HKB B;  3N2K B;  1CK2 A;  3KE1 A;  5IYZ A;  2I6R A;  4HNA B;  1RA4 A;  3IR9 A;  1W59 A;  3E22 B;  3VYT C;  4BVS A;  2CWJ A;  2VAP A;  1W58 1;  2UYJ A;  1VQP F;  1N8R H;  3AGK A;  5JVD A;  1YGY A;  3JAK B;  2I6D A;  3NK7 A;  2HRY A;  3C9T A;  5HP7 A;  1VQ5 F;  3HKC A;  2ZOD A;  5EZY A;  3HAX D;  5IJ9 A;  3V7E A;  1JN1 A;  1W40 A;  2R75 1;  5LXT B;  2QA4 F;  3E1Y A;  1FSZ A;  3JAT B;  4FFB A;  4YJ3 A;  4C81 A;  4X1Y A;  3B6N A;  3S06 A;  3NVI B;  4BT2 A;  3C9U A;  5EYP A;  2OTJ F;  2GZL A;  2HS0 A;  4B46 A;  3D00 A;  3OON A;  4G4X A;  1QVF F;  4I50 B;  4DRX B;  2Z1U A;  4ERH A;  1RLG A;  3S0H A;  3F0G A;  1S72 F;  3J80 M;  3PLA C;  3ERN A;  1H7M A;  4ZHQ A;  5AVM A;  3HKE B;  5KX5 B;  1FNK A;  1QD9 A;  5IJ0 A;  1ZWZ A;  2ZVY A;  4X3L A;  4X20 B;  1JFF B;  2G9I A;  3M1X A;  5LYJ B;  3RYH B;  4O2B A;  3U0O A;  3L7Q A;  2YYE A;  3J7A R;  1U3L A;  2VAW A;  1XHO A;  3N2G B;  1YI2 F;  1KC8 H;  3JAW A;  1KNK A;  3TD3 A;  4C8G A;  4EB6 A;  4TZZ A;  4TV9 A;  1TUB A;  2GVI A;  2UYN A;  1X7P A;  3TD4 A;  3CCL F;  3CPQ A;  1JD1 A;  3HKB A;  3N2K A;  3N4Y A;  3WJR A;  3I3F A;  4O4H B;  5HXZ A;  2CZW A;  1VQM F;  4HNA A;  4LCK A;  1U3P A;  3NMU C;  2Z1E A;  3GHZ A;  3CCV F;  4X1Y B;  5HP8 A;  1GZ0 A;  4R40 B;  1K8A H;  4F6R A;  3Q8H A;  3J81 M;  1Q86 H;  2PMP A;  3HKD A;  2IG8 A;  3QTY A;  3VOB A;  3KHN A;  2VXY A;  2OTL F;  2F9Z C;  3NK6 A;  3CCU F;  3CCR F;  3JCM M;  1CLI A;  5KMG A;  3IKE A;  1H48 A;  1X25 A;  4YJ2 B;  1IV3 A;  5J2U B;  3JAT A;  3G71 F;  3JAL B;  2IQQ A;  1Q7Y H;  2CVL A;  3VYS C;  3D01 A;  3CC7 F;  3ZO8 A;  4O2B B;  1QAH A;  3WGK A;  4IHJ A;  1NMU B;  2Z1F A;  4I55 A;  3CCS F;  2Z1T A;  5BMV B;  3MQW A;  1OFU A;  3CYQ A;  1PF5 A;  2HS3 A;  3LDT A;  2FGY A;  3IEW A;  3IMP A;  3NVK E;  3CPW F;  4WBN A;  2AMT A;  1YJ9 F;  3WGN A;  2HP3 A;  1TUB B;  2BO1 A;  5LP6 C;  2UYN B;  3WGM A;  3GTZ A; 
#chains in the Genus database with same CATH homology
 2ZOV A;  4ZHV A;  2LCA A;  2MQE A;  2L26 A;  3S0W A;  3S06 A;  2K1S A;  4ZHW A;  2ZF8 A;  5EB1 B;  3S0Y A;  2W8B C;  3OON A;  2KGW A;  4G4X A;  4G4V A;  4G4Y A;  5EAZ A;  4G88 A;  4R40 B;  3CYQ A;  1R1M A;  3WPX A;  4ERH A;  3S03 A;  3LDT A;  1OAP A;  3S0H A;  3WPW A;  3IMP A;  3TD3 A;  4B5C A;  4ZHY B;  2HQS C;  2ZVZ A;  3KHN A;  2N48 A;  4G4Z A;  4PWT A;  3TD4 A;  4G4W A;  3CYP B;  4RHA A;  2AIZ P;  2LBT A;  3S02 A;  5EB0 A;  3TD5 A;  4B62 A;  2ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...