2LBTA

Solution structure of the c domain of rv0899(d236a) from mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPAAYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptidoglycan-binding protein
molecule keywords Uncharacterized protein Rv0899/MT0922
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lbtA00
2ZF8A 3CYPB 4B5CA 3OONA 4G88A 4ZHVA 4G4WA 2ZVZA 3TD5A 3CYQA 4ERHA 3WPXA 3S03A 2KGWA 3IMPA 1R1MA 4ZHYB 2ZVYA 2L26A 1OAPA 2LCAA 2AIZP 3KHNA 2HQSC 2MQEA 3S0WA 3TD3A 4RHAA 3LDTA 5EB1B 3S0HA 5EAZA 2W8BC 4PWTA 3S06A 3WPWA 2N48A 2K1SA 4G4YA 4ZHWA 2LBTA 4R40B 3S02A 3TD4A 4G4XA 4G4VA 5EB0A 4B62A 2ZOVA 3S0YA 4G4ZA
chains in the Genus database with same CATH superfamily
1YIJF 4ZHQA 5CB4B 1H47A 3CYQA 3SIVA 4U3JB 1PXWA 1R1MA 2LBWA 2LBXA 2OTLF 5LXTB 4U39A 5BMVA 4O4IA 2RHOA 3D54A 3ELCA 3JAWB 4TV9B 3RYIA 4I55B 2K1SA 2H6LA 4EB6B 3F0EA 3S02A 1CLIA 2UYJA 4YJ2A 1VQNF 1VH8A 2KG4A 3WJPA 4BW0B 1YI2F 5HWEA 3C9TA 1SA0A 3OW2F 3P10A 2RHJA 3TD5A 1N8RH 1W59A 1TUBA 1W55A 4BVRA 1RLUA 5IJ9B 5HP7A 1PF5A 3G71F 3CCVF 4O2BA 2B33A 3F0FA 1RLGA 1KNJA 5GAPK 3E22A 3ZO8A 1ONIA 5KMGA 1YJNF 1X7PA 4TV8A 2FC3A 3E20B 3RYFA 3HKBB 3LWRC 5GINC 5LYJA 5JCOC 1X25A 3V4DA 1FSZA 4LCKA 1XBIA 1VQKF 4X1KA 3VTIC 5LA6B 3KJJA 4IHJB 1CK2A 3VI6A 4B46A 5JH7A 3F0DA 1JJ2F 1W5EA 2BTUA 4ZI7B 3HAXD 3L7QA 2AMTA 4C81A 3VO8A 1Q86H 1VQOF 2QI2A 3LDTA 2UZHA 1VQLF 1QD9A 1YGYA 3C9RA 4NQ3A 5GONA 5LP6A 2ZODA 1QAHA 4BVQA 1W581 3LYBA 2VAPA 4O4IB 3CMAF 2CVLA 2ZOVA 5J2UA 1M90H 4BT6A 3AGKA 3I56F 3OONA 5IYZA 3K2XA 1W40A 4YJ2B 1W3EX 4X1YB 1YITF 4I50B 4DRXA 3RYCA 1ODEA 1UI9A 2RHHA 2UYNB 3TD3A 5EYPB 5EAZA 4LNUB 3JARB 2I6RA 3MDOA 3S06A 2RHLA 3N4ZA 1VK3A 4O4HB 4R40B 1DBFA 5HP8A 2ZAUA 3VIUA 3CB2A 3S0YA 5KMGB 2ZF8A 1Z5VA 4O4LA 3U0OA 1JFFB 4X1IA 3FD5A 4X3MA 3UT5A 1FFXB 4G88A 5EO3A 5HY4A 2HP0A 5FLXM 2BO1A 3S03A 3M84A 4XCQA 2IQQA 2IG8A 1IV3A 1OAPA 3CC2F 1RA4A 5JH7B 5JQGB 1H7MA 5GIPC 3SIUA 5EB1B 3S0HA 3NVKE 1KNKA 5CA0B 3RYHA 3HKEB 3QTYA 5DCVA 3OBYA 4YJ3A 1M1KH 3P4EA 3CG6A 5CA1B 3CD6F 3D00A 2Z1UA 3CC4F 3JASB 4ZOLB 5J2TB 3KJKA 2HRYA 3HWUA 2HP3A 3RA6A 3CPWF 3K12A 1X52A 3WGLA 3MCAB 2Z01A 3DC2A 2NMUA 4X20B 2MQEA 4TUYB 2UYPA 3N2KA 4FFBB 3RA5A 2AIFA 3WPWA 3ZOPA 4NWOB 3HKCA 2OHWA 1RQ7A 3MBMA 3E1YA 3WJRA 3N2GB 5IJ0A 4C4WC 2CWJA 1IPAA 4BT2A 5EWRA 3WJQA 3NVIB 1IV2A 3CCLF 2VXYA 1FNJA 2H8CA 4O4JA 4O2AA 3JALB 4BT3A 2VAMA 5ITZB 3CCUF 3M4SA 3F6MA 2HP0B 3JAKA 2HQSC 5FNVA 3PLAC 5A2QM 1S72F 2W8BC 1XRGA 5KX5B 3D01A 3IEQA 3IKEA 1VQ9F 4ZK7A 1QVFF 4C82A 1YHQF 1ZWZA 3FD6A 3GYQA 4ZHVA 2RB9A 2YYEA 4ERHA 1U3LA 2CZWA 1KD1H 1UFYA 3GTZA 4HNAB 4IIJA 1XV2A 4ZHQB 2EWCA 1K9MH 1FNKA 4I4TA 1COMA 3KE1A 4WBNA 5MN5A 5LOVA 2VGNA 3I3FA 1Q82H 3JATA 3VOAA 1YJWF 2F9ZC 4B45A 3C8LA 3Q8HA 5BMVB 2V9YA 5EZYA 1NQ3A 3RYIB 2P6YA 2HS3A 3HKCB 1CN7A 3HKDA 3LFOA 2CHTA 3WGMA 4F6RA 1W42A 5IJ0B 2HVYD 2R751 2QA4F 4C8EA 3JVHA 2AIZP 5JVDA 1SA0B 2QEXF 3WXMB 3V7EA 1TUBB 4PWTA 4DXDA 2OTMA 5CB4A 4EI9A 4O2BB 3LWOC 5EB0A 4U3JA 4B62A 3E22B 4EI7A 1GZ0A 4BVSA 5LXTA 3ESJA 1VQPF 3HJWC 4TV8B 3WGJA 3QHDA 3RYFB 4BT5A 3WPXA 5LYJB 3VYUC 3JAWA 3LWVC 2HX0A 3J7AR 2KGWA 4TV9A 2VGMA 3J80M 3HTNA 4I55A 3WGKA 3GHZA 4X1KB 4BVTA 3VCZA 3BYQA 3S0WA 1E7KA 3MQWA 4RHAA 3JAMM 1X7OA 1VQ6F 2Z1TA 3CC7F 2N48A 5C8YA 2BTQB 2LBTA 1KC8H 3TD4A 2CHSA 2VAWA 5JCOA 1U3PA 1W5BA 1JN1A 5IJ9A 3IKFA 1NMUB 1GO0A 5GONB 5LP6B 1KQSF 5EIBC 2R6R1 4BY9D 2I6DA 3M1XA 5J2UB 2L26A 3HKBA 1Q8RA 5EIBD 5HY0A 3ERNA 2Z1FA 5IYZB 1SDSA 3T80A 3FPIA 5LA6A 3N4YA 3CPQA 4IHJA 5LP6C 2KTUA 3VYSC 1H48A 4M8IA 3WGNA 3ZP4A 5HXUA 3NK6A 4DRXB 3RYCB 3CCQF 1VQ5F 4ZI7A 1JY8A 2QTPA 3VOBA 2UYKA 1QVGF 3K0TA 1W41A 2ZVZA 2OZBA 1TVKA 1K73H 3C9SA 1W5AA 1RQ2A 2CW4A 3G6EF 2JNBA 2GLZA 4O4LB 3IEWA 2GVIA 4X1IB 3UT5B 3FBAA 2GZLA 5GIOC 2BTOA 4C8GA 2H8EA 1IV1A 4ZHWA 3CCSF 2G9IA 5MN4A 2Q1XA 1YJ9F 4X1YA 3P0ZA 4I50A 3ZP7A 5C8YB 3R0PA 3RYHB 2UYNA 5EYPA 1Z5WA 3B6NA 4LNUA 1JD1A 3JARA 3DDNA 3QUWA 4YJ3B 2ZVYA 4NUTA 4O4HA 1VQ7F 3KHNA 1T0KB 3O85A 3CCJF 1K8AH 5HXZA 2KTVA 1VHAA 4KWEA 3EORA 1JFFA 1VQVA 1FFXA 5AVMA 4G4YA 2OTJF 3CMEF 4BT7A 3K14A 5GANK 5FJ4C 3N2KB 3NMUC 2DYYA 3CYPB 1J7HA 1U40A 2CSLA 2Z1EA 4C8IA 2ALEA 4RQOA 5JQGA 4G4WA 1Q7YH 3CCEF 3NK7A 1DT9A 5CA0A 3IMPA 3LWPC 2LCAA 3HKEA 3RE3A 3V3TA 3I7TA 2HS4A 5G4UC 1TVKB 2FGYA 5HY1A 5IT9M 5CA1A 2YXZA 1VQ4F 3ON1A 5HY2A 2PHNA 1VQMF 3C9UA 3JASA 4O4JB 2Q1YA 3CXCF 4O2AB 4ZOLA 1Q81H 5J2TA 3JAKB 4TZZA 5FNVB 3VMFB 3CCMF 1W57A 3F0GA 4X20A 1SZQA 5B8FA 3CCRF 3V7QA 4TUYA 4FFBA 1W5FA 3J81M 3JCMM 3G4SF 2IAFA 4EB6A 3PAFA 3N2GA 5MN6A 2DT4A 5G4VC 1NJIH 1XHOA 4IIJB 2WALA 1U43A 3MCQA 1T0AA 3I55F 1IV4A 3FFMA 1GX1A 3JALA 4B5CA 5ITZA 3LWQC 4I4TB 2HS0A 4WBNB 5LOVB 2PMPA 3JATB 3OBWA 3LMEA 4ZHYB 5EZYB 1W2BF 5KX5A 3IR9A 3KIZA 4X3LA 4BT4A 1OFUA 1GO1A 1QU9A 2HRUA 3VYTC 1VQ8F 3HKDB 4F6RB 4E6EA 5JVDB 4G4XA 4G4VA 1YQNA 4EI8A 4HNAA 4G4ZA
chains in the Genus database with same CATH topology
2ZF8A 3CYPB 4B5CA 3OONA 4G88A 4ZHVA 4G4WA 2ZVZA 3TD5A 3CYQA 4ERHA 3WPXA 3S03A 2KGWA 3IMPA 1R1MA 4ZHYB 2ZVYA 2L26A 1OAPA 2LCAA 2AIZP 3KHNA 2HQSC 2MQEA 3S0WA 3TD3A 4RHAA 3LDTA 5EB1B 3S0HA 5EAZA 2W8BC 4PWTA 3S06A 3WPWA 2N48A 2K1SA 4G4YA 4ZHWA 2LBTA 4R40B 3S02A 3TD4A 4G4XA 4G4VA 5EB0A 4B62A 2ZOVA 3S0YA 4G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZF8 A;  3CYP B;  4B5C A;  3OON A;  4G88 A;  4ZHV A;  4G4W A;  2ZVZ A;  3TD5 A;  3CYQ A;  4ERH A;  3WPX A;  3S03 A;  2KGW A;  3IMP A;  1R1M A;  4ZHY B;  2ZVY A;  2L26 A;  1OAP A;  2LCA A;  2AIZ P;  3KHN A;  2HQS C;  2MQE A;  3S0W A;  3TD3 A;  4RHA A;  3LDT A;  5EB1 B;  3S0H A;  5EAZ A;  2W8B C;  4PWT A;  3S06 A;  3WPW A;  2N48 A;  2K1S A;  4G4Y A;  4ZHW A;  2LBT A;  4R40 B;  3S02 A;  3TD4 A;  4G4X A;  4G4V A;  5EB0 A;  4B62 A;  2ZOV A;  3S0Y A;  4G4Z A; 
#chains in the Genus database with same CATH topology
 1YIJ F;  4ZHQ A;  5CB4 B;  1H47 A;  3CYQ A;  3SIV A;  4U3J B;  1PXW A;  1R1M A;  2LBW A;  2LBX A;  2OTL F;  5LXT B;  4U39 A;  5BMV A;  4O4I A;  2RHO A;  3D54 A;  3ELC A;  3JAW B;  4TV9 B;  3RYI A;  4I55 B;  2K1S A;  2H6L A;  4EB6 B;  3F0E A;  3S02 A;  1CLI A;  2UYJ A;  4YJ2 A;  1VQN F;  1VH8 A;  2KG4 A;  3WJP A;  4BW0 B;  1YI2 F;  5HWE A;  3C9T A;  1SA0 A;  3OW2 F;  3P10 A;  2RHJ A;  3TD5 A;  1N8R H;  1W59 A;  1TUB A;  1W55 A;  4BVR A;  1RLU A;  5IJ9 B;  5HP7 A;  1PF5 A;  3G71 F;  3CCV F;  4O2B A;  2B33 A;  3F0F A;  1RLG A;  1KNJ A;  5GAP K;  3E22 A;  3ZO8 A;  1ONI A;  5KMG A;  1YJN F;  1X7P A;  4TV8 A;  2FC3 A;  3E20 B;  3RYF A;  3HKB B;  3LWR C;  5GIN C;  5LYJ A;  5JCO C;  1X25 A;  3V4D A;  1FSZ A;  4LCK A;  1XBI A;  1VQK F;  4X1K A;  3VTI C;  5LA6 B;  3KJJ A;  4IHJ B;  1CK2 A;  3VI6 A;  4B46 A;  5JH7 A;  3F0D A;  1JJ2 F;  1W5E A;  2BTU A;  4ZI7 B;  3HAX D;  3L7Q A;  2AMT A;  4C81 A;  3VO8 A;  1Q86 H;  1VQO F;  2QI2 A;  3LDT A;  2UZH A;  1VQL F;  1QD9 A;  1YGY A;  3C9R A;  4NQ3 A;  5GON A;  5LP6 A;  2ZOD A;  1QAH A;  4BVQ A;  1W58 1;  3LYB A;  2VAP A;  4O4I B;  3CMA F;  2CVL A;  2ZOV A;  5J2U A;  1M90 H;  4BT6 A;  3AGK A;  3I56 F;  3OON A;  5IYZ A;  3K2X A;  1W40 A;  4YJ2 B;  1W3E X;  4X1Y B;  1YIT F;  4I50 B;  4DRX A;  3RYC A;  1ODE A;  1UI9 A;  2RHH A;  2UYN B;  3TD3 A;  5EYP B;  5EAZ A;  4LNU B;  3JAR B;  2I6R A;  3MDO A;  3S06 A;  2RHL A;  3N4Z A;  1VK3 A;  4O4H B;  4R40 B;  1DBF A;  5HP8 A;  2ZAU A;  3VIU A;  3CB2 A;  3S0Y A;  5KMG B;  2ZF8 A;  1Z5V A;  4O4L A;  3U0O A;  1JFF B;  4X1I A;  3FD5 A;  4X3M A;  3UT5 A;  1FFX B;  4G88 A;  5EO3 A;  5HY4 A;  2HP0 A;  5FLX M;  2BO1 A;  3S03 A;  3M84 A;  4XCQ A;  2IQQ A;  2IG8 A;  1IV3 A;  1OAP A;  3CC2 F;  1RA4 A;  5JH7 B;  5JQG B;  1H7M A;  5GIP C;  3SIU A;  5EB1 B;  3S0H A;  3NVK E;  1KNK A;  5CA0 B;  3RYH A;  3HKE B;  3QTY A;  5DCV A;  3OBY A;  4YJ3 A;  1M1K H;  3P4E A;  3CG6 A;  5CA1 B;  3CD6 F;  3D00 A;  2Z1U A;  3CC4 F;  3JAS B;  4ZOL B;  5J2T B;  3KJK A;  2HRY A;  3HWU A;  2HP3 A;  3RA6 A;  3CPW F;  3K12 A;  1X52 A;  3WGL A;  3MCA B;  2Z01 A;  3DC2 A;  2NMU A;  4X20 B;  2MQE A;  4TUY B;  2UYP A;  3N2K A;  4FFB B;  3RA5 A;  2AIF A;  3WPW A;  3ZOP A;  4NWO B;  3HKC A;  2OHW A;  1RQ7 A;  3MBM A;  3E1Y A;  3WJR A;  3N2G B;  5IJ0 A;  4C4W C;  2CWJ A;  1IPA A;  4BT2 A;  5EWR A;  3WJQ A;  3NVI B;  1IV2 A;  3CCL F;  2VXY A;  1FNJ A;  2H8C A;  4O4J A;  4O2A A;  3JAL B;  4BT3 A;  2VAM A;  5ITZ B;  3CCU F;  3M4S A;  3F6M A;  2HP0 B;  3JAK A;  2HQS C;  5FNV A;  3PLA C;  5A2Q M;  1S72 F;  2W8B C;  1XRG A;  5KX5 B;  3D01 A;  3IEQ A;  3IKE A;  1VQ9 F;  4ZK7 A;  1QVF F;  4C82 A;  1YHQ F;  1ZWZ A;  3FD6 A;  3GYQ A;  4ZHV A;  2RB9 A;  2YYE A;  4ERH A;  1U3L A;  2CZW A;  1KD1 H;  1UFY A;  3GTZ A;  4HNA B;  4IIJ A;  1XV2 A;  4ZHQ B;  2EWC A;  1K9M H;  1FNK A;  4I4T A;  1COM A;  3KE1 A;  4WBN A;  5MN5 A;  5LOV A;  2VGN A;  3I3F A;  1Q82 H;  3JAT A;  3VOA A;  1YJW F;  2F9Z C;  4B45 A;  3C8L A;  3Q8H A;  5BMV B;  2V9Y A;  5EZY A;  1NQ3 A;  3RYI B;  2P6Y A;  2HS3 A;  3HKC B;  1CN7 A;  3HKD A;  3LFO A;  2CHT A;  3WGM A;  4F6R A;  1W42 A;  5IJ0 B;  2HVY D;  2R75 1;  2QA4 F;  4C8E A;  3JVH A;  2AIZ P;  5JVD A;  1SA0 B;  2QEX F;  3WXM B;  3V7E A;  1TUB B;  4PWT A;  4DXD A;  2OTM A;  5CB4 A;  4EI9 A;  4O2B B;  3LWO C;  5EB0 A;  4U3J A;  4B62 A;  3E22 B;  4EI7 A;  1GZ0 A;  4BVS A;  5LXT A;  3ESJ A;  1VQP F;  3HJW C;  4TV8 B;  3WGJ A;  3QHD A;  3RYF B;  4BT5 A;  3WPX A;  5LYJ B;  3VYU C;  3JAW A;  3LWV C;  2HX0 A;  3J7A R;  2KGW A;  4TV9 A;  2VGM A;  3J80 M;  3HTN A;  4I55 A;  3WGK A;  3GHZ A;  4X1K B;  4BVT A;  3VCZ A;  3BYQ A;  3S0W A;  1E7K A;  3MQW A;  4RHA A;  3JAM M;  1X7O A;  1VQ6 F;  2Z1T A;  3CC7 F;  2N48 A;  5C8Y A;  2BTQ B;  2LBT A;  1KC8 H;  3TD4 A;  2CHS A;  2VAW A;  5JCO A;  1U3P A;  1W5B A;  1JN1 A;  5IJ9 A;  3IKF A;  1NMU B;  1GO0 A;  5GON B;  5LP6 B;  1KQS F;  5EIB C;  2R6R 1;  4BY9 D;  2I6D A;  3M1X A;  5J2U B;  2L26 A;  3HKB A;  1Q8R A;  5EIB D;  5HY0 A;  3ERN A;  2Z1F A;  5IYZ B;  1SDS A;  3T80 A;  3FPI A;  5LA6 A;  3N4Y A;  3CPQ A;  4IHJ A;  5LP6 C;  2KTU A;  3VYS C;  1H48 A;  4M8I A;  3WGN A;  3ZP4 A;  5HXU A;  3NK6 A;  4DRX B;  3RYC B;  3CCQ F;  1VQ5 F;  4ZI7 A;  1JY8 A;  2QTP A;  3VOB A;  2UYK A;  1QVG F;  3K0T A;  1W41 A;  2ZVZ A;  2OZB A;  1TVK A;  1K73 H;  3C9S A;  1W5A A;  1RQ2 A;  2CW4 A;  3G6E F;  2JNB A;  2GLZ A;  4O4L B;  3IEW A;  2GVI A;  4X1I B;  3UT5 B;  3FBA A;  2GZL A;  5GIO C;  2BTO A;  4C8G A;  2H8E A;  1IV1 A;  4ZHW A;  3CCS F;  2G9I A;  5MN4 A;  2Q1X A;  1YJ9 F;  4X1Y A;  3P0Z A;  4I50 A;  3ZP7 A;  5C8Y B;  3R0P A;  3RYH B;  2UYN A;  5EYP A;  1Z5W A;  3B6N A;  4LNU A;  1JD1 A;  3JAR A;  3DDN A;  3QUW A;  4YJ3 B;  2ZVY A;  4NUT A;  4O4H A;  1VQ7 F;  3KHN A;  1T0K B;  3O85 A;  3CCJ F;  1K8A H;  5HXZ A;  2KTV A;  1VHA A;  4KWE A;  3EOR A;  1JFF A;  1VQV A;  1FFX A;  5AVM A;  4G4Y A;  2OTJ F;  3CME F;  4BT7 A;  3K14 A;  5GAN K;  5FJ4 C;  3N2K B;  3NMU C;  2DYY A;  3CYP B;  1J7H A;  1U40 A;  2CSL A;  2Z1E A;  4C8I A;  2ALE A;  4RQO A;  5JQG A;  4G4W A;  1Q7Y H;  3CCE F;  3NK7 A;  1DT9 A;  5CA0 A;  3IMP A;  3LWP C;  2LCA A;  3HKE A;  3RE3 A;  3V3T A;  3I7T A;  2HS4 A;  5G4U C;  1TVK B;  2FGY A;  5HY1 A;  5IT9 M;  5CA1 A;  2YXZ A;  1VQ4 F;  3ON1 A;  5HY2 A;  2PHN A;  1VQM F;  3C9U A;  3JAS A;  4O4J B;  2Q1Y A;  3CXC F;  4O2A B;  4ZOL A;  1Q81 H;  5J2T A;  3JAK B;  4TZZ A;  5FNV B;  3VMF B;  3CCM F;  1W57 A;  3F0G A;  4X20 A;  1SZQ A;  5B8F A;  3CCR F;  3V7Q A;  4TUY A;  4FFB A;  1W5F A;  3J81 M;  3JCM M;  3G4S F;  2IAF A;  4EB6 A;  3PAF A;  3N2G A;  5MN6 A;  2DT4 A;  5G4V C;  1NJI H;  1XHO A;  4IIJ B;  2WAL A;  1U43 A;  3MCQ A;  1T0A A;  3I55 F;  1IV4 A;  3FFM A;  1GX1 A;  3JAL A;  4B5C A;  5ITZ A;  3LWQ C;  4I4T B;  2HS0 A;  4WBN B;  5LOV B;  2PMP A;  3JAT B;  3OBW A;  3LME A;  4ZHY B;  5EZY B;  1W2B F;  5KX5 A;  3IR9 A;  3KIZ A;  4X3L A;  4BT4 A;  1OFU A;  1GO1 A;  1QU9 A;  2HRU A;  3VYT C;  1VQ8 F;  3HKD B;  4F6R B;  4E6E A;  5JVD B;  4G4X A;  4G4V A;  1YQN A;  4EI8 A;  4HNA A;  4G4Z A; 
#chains in the Genus database with same CATH homology
 2ZF8 A;  3CYP B;  4B5C A;  3OON A;  4G88 A;  4ZHV A;  4G4W A;  2ZVZ A;  3TD5 A;  3CYQ A;  4ERH A;  3WPX A;  3S03 A;  2KGW A;  3IMP A;  1R1M A;  4ZHY B;  2ZVY A;  2L26 A;  1OAP A;  2LCA A;  2AIZ P;  3KHN A;  2HQS C;  2MQE A;  3S0W A;  3TD3 A;  4RHA A;  3LDT A;  5EB1 B;  3S0H A;  5EAZ A;  2W8B C;  4PWT A;  3S06 A;  3WPW A;  2N48 A;  2K1S A;  4G4Y A;  4ZHW A;  2LBT A;  4R40 B;  3S02 A;  3TD4 A;  4G4X A;  4G4V A;  5EB0 A;  4B62 A;  2ZOV A;  3S0Y A;  4G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...