2LBTA

Solution structure of the c domain of rv0899(d236a) from mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPAAYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv0899/MT0922
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan-binding protein
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lbtA00
5EAZA 4G4VA 3WPXA 2ZOVA 3OONA 2HQSC 2KGWA 5EB0A 4ERHA 2ZF8A 3WPWA 4R40B 3LDTA 2K1SA 3TD4A 2AIZP 4G4ZA 1OAPA 4RHAA 3S03A 4B62A 3IMPA 4ZHWA 4PWTA 3TD5A 4G4WA 3CYPB 2ZVZA 4G88A 2W8BC 2LCAA 2MQEA 2N48A 3S06A 4ZHVA 4ZHYB 3TD3A 5EB1B 1R1MA 3S0WA 3CYQA 3S0HA 2L26A 2ZVYA 2LBTA 3S0YA 4B5CA 4G4XA 4G4YA 3KHNA 3S02A
chains in the Genus database with same CATH superfamily
2HX0A 1X52A 4O4HA 5CB4A 2IAFA 2F9ZC 2OTLF 3NMUC 3MCAB 1GX1A 2HRYA 3N2GA 3J81M 2CW4A 4PWTA 2ZODA 1IV2A 5IJ0B 3DDNA 4BT2A 3ZP7A 1VHAA 3GTZA 5EIBD 1KQSF 1JJ2F 5JCOC 2JNBA 4I55B 5LXTA 3VMFB 2UYNA 5HY2A 5IYZB 4O4IA 3IKEA 3V7EA 3FD5A 1FNJA 3HKEB 3J7AR 3CCRF 1VQ9F 4TV8A 3OBYA 3RYCA 5EB0A 5BMVA 2B33A 3CPQA 3VO8A 2RB9A 3IKFA 3JATB 3CCMF 2HVYD 1CLIA 5FJ4C 2CHSA 3LWQC 1IV4A 4TV9B 1J7HA 3M1XA 2UZHA 3N4ZA 4EB6A 3CC7F 4XCQA 2KG4A 3HKBB 3UT5A 2MQEA 2OTMA 2VGMA 4BVTA 1VQ4F 1U43A 1Z5WA 5LP6A 1M1KH 1W5FA 3K12A 3HKDB 3RA5A 1XHOA 4I50B 3VYSC 2ALEA 5HY0A 2G9IA 3E22A 5GAPK 2QA4F 3LFOA 2K1SA 2AIZP 3CMEF 1W55A 1DT9A 5HP7A 3WXMB 4DRXB 2YYEA 5MN6A 5CA1B 2HS4A 5IJ0A 4X1KB 3CC4F 4LNUB 1FSZA 3ZOPA 4B46A 2CHTA 1QAHA 2Z01A 4C8GA 3S0HA 3JAWB 1YI2F 1Q86H 5MN4A 5JCOA 5IYZA 4NUTA 5EYPA 1SA0A 5J2TB 1SZQA 3HKEA 5LOVB 5C8YA 1IPAA 1YJWF 3ESJA 1VQ7F 1IV3A 3V7QA 3RYFA 3JATA 3K0TA 3WGJA 4RQOA 3E20B 1QVFF 3P10A 1ODEA 5JVDB 3VTIC 5GIPC 1Q8RA 5GANK 1CN7A 1W5EA 3E1YA 1RLUA 3CCUF 3WGMA 2GVIA 1OFUA 4O4IB 3K2XA 2BTOA 3WPXA 4I50A 1S72F 2HP3A 3KJJA 3HTNA 3VCZA 3LWRC 1W42A 4X3MA 4DRXA 4NWOB 1YJNF 5CA1A 4EB6B 5KX5B 4B45A 4ZOLB 4X1KA 2AIFA 3RYHB 3UT5B 3I56F 4ZHVA 3JVHA 2KTUA 3JARB 4BVSA 3FPIA 3WGNA 3CMAF 5HXZA 2EWCA 2L26A 2Z1TA 2LBTA 3JAWA 1W5BA 3JAKB 4BW0B 5LOVA 1VQOF 5DCVA 4BT7A 2QTPA 3PLAC 4BT6A 2H6LA 2NMUA 3E22B 3F0DA 3CXCF 5JQGB 5GIOC 4BY9D 1VQNF 3IMPA 3V4DA 1W40A 2PMPA 3IEWA 1TVKB 5JVDA 3JAMM 2OTJF 2LCAA 3S06A 3FFMA 1VQ5F 4BVRA 5EB1B 3NVKE 3C9SA 1FNKA 3F6MA 4X20B 4O2AB 5IJ9B 4C8EA 2VAPA 5EYPB 3C9UA 1SA0B 3I7TA 2R6R1 1W57A 1VQ6F 1YITF 5C8YB 1UFYA 1K9MH 1NQ3A 2Q1YA 5MN5A 4R40B 3VIUA 4G4ZA 3MBMA 3RYFB 4C4WC 5HY4A 5ITZB 3QUWA 1XV2A 3VI6A 3N2KB 5KX5A 4ZOLA 3RYHA 3O85A 3WGLA 3JARA 1GZ0A 3CCVF 3ERNA 1JD1A 3KE1A 2KTVA 3EORA 1ZWZA 2RHOA 3JAKA 4EI8A 5HXUA 3IEQA 3MQWA 1RQ7A 1W59A 4X1IB 2KGWA 2LBXA 1Z5VA 5LA6B 3KIZA 3TD4A 5JQGA 2I6DA 1W41A 2CWJA 3CCLF 4O4JB 1RA4A 4I4TB 4G88A 2W8BC 2Z1UA 3CCEF 1TVKA 3SIVA 4X1YB 1VQ8F 3VOAA 5FLXM 5G4UC 4TUYB 1VQVA 2ZVYA 3IR9A 4X20A 4O2AA 5IJ9A 2GLZA 1GO0A 2VAWA 1VQLF 4ERHA 1QVGF 3SIUA 2ZF8A 4EI9A 4IHJA 4BT5A 1H48A 4KWEA 3LDTA 3WJQA 3MCQA 1QU9A 2CSLA 4RHAA 1W5AA 4C82A 3GYQA 5ITZA 4TZZA 2QI2A 5G4VC 1VK3A 3N2KA 3G71F 2OHWA 3HWUA 5AVMA 5CA0B 4EI7A 1U3LA 3FBAA 2UYKA 2IQQA 1COMA 2PHNA 3VYTC 3N4YA 3I3FA 4F6RA 1QD9A 1XRGA 2H8EA 2VXYA 4LCKA 5IT9M 4X1IA 5LA6A 3WPWA 1KNKA 2HP0B 2QEXF 1YJ9F 1E7KA 4ZHWA 5GONA 3F0GA 1X7OA 2UYJA 4O4JA 3J80M 2ZAUA 4I4TA 5LYJB 1VQPF 3CG6A 1ONIA 1DBFA 3CCSF 1R1MA 1TUBB 4X1YA 2LBWA 3ELCA 4TUYA 2DT4A 4B5CA 3P4EA 2CZWA 3OBWA 3L7QA 3KJKA 4O2BB 3GHZA 5J2TA 1M90H 3CC2F 3B6NA 1N8RH 3C9RA 2FGYA 5JH7B 1UI9A 4O4LB 3TD3A 5CA0A 3V3TA 3CYQA 3LMEA 3U0OA 3JALB 4X3LA 1U3PA 4G4XA 3LWVC 4G4YA 3CB2A 1T0KB 4HNAB 3OW2F 2HS3A 3JASB 1IV1A 1X25A 4FFBB 1VH8A 3VOBA 4ZI7B 3HKCA 3I55F 1NJIH 2YXZA 3VYUC 3CD6F 4WBNB 3JCMM 4IHJB 1H47A 2HP0A 3RYIB 3S03A 4U3JB 4B62A 3TD5A 2RHLA 2ZVZA 3M84A 2P6YA 3C8LA 3LYBA 5HY1A 1JN1A 1RLGA 5LYJA 1Q7YH 3WJRA 3AGKA 2HRUA 4ZHQB 5J2UB 1GO1A 3CCJF 2BTQB 1TUBA 1KD1H 1W2BF 4C8IA 3S0YA 4YJ3B 5FNVB 4BVQA 1VQMF 1T0AA 4BT3A 5EZYB 2BO1A 2RHJA 4F6RB 4BT4A 2HQSC 5KMGB 2OZBA 4O2BA 3NK7A 1PF5A 1OAPA 3CPWF 1PXWA 2AMTA 4YJ2B 5GONB 4ZK7A 2Z1FA 3P0ZA 5JH7A 5EWRA 3R0PA 1YHQF 4O4LA 4ZHYB 5A2QM 1FFXB 3M4SA 3HJWC 3F0EA 5HP8A 3LWPC 3JALA 5EIBC 4I55A 3S02A 2Z1EA 4HNAA 4G4VA 3JASA 4IIJB 4FFBA 3OONA 4C81A 4ZI7A 3PAFA 3HAXD 3ZP4A 4WBNA 3CCQF 1W3EX 2DYYA 3DC2A 3RYIA 4U3JA 1SDSA 2H8CA 1YQNA 2V9YA 1X7PA 4ZHQA 3S0WA 5J2UA 1YIJF 2RHHA 4U39A 1JFFB 3KHNA 4YJ3A 5FNVA 3NVIB 2UYPA 4O4HB 5CB4B 3WJPA 3QHDA 2ZOVA 5EZYA 3HKCB 1K8AH 2VAMA 3ON1A 3K14A 5KMGA 3N2GB 2CVLA 3ZO8A 1XBIA 4TV9A 3CYPB 2IG8A 4DXDA 4YJ2A 3D01A 3HKBA 4NQ3A 3F0FA 1JY8A 2N48A 3G4SF 1H7MA 3BYQA 1FFXA 2Q1XA 5LXTB 2UYNB 1U40A 4M8IA 2R751 5HWEA 4E6EA 1K73H 2BTUA 3G6EF 3HKDA 5EAZA 3RE3A 4TV8B 5B8FA 1Q81H 1NMUB 1KC8H 3MDOA 1Q82H 1W581 3RYCB 4IIJA 5BMVB 3LWOC 2HS0A 3D00A 3Q8HA 3FD6A 3WGKA 2FC3A 5GINC 2GZLA 2I6RA 4G4WA 1CK2A 2WALA 3NK6A 4LNUA 3T80A 3QTYA 1KNJA 5LP6C 3C9TA 5EO3A 3RA6A 5LP6B 1RQ2A 3D54A 1VQKF 1YGYA 2VGNA 1JFFA
chains in the Genus database with same CATH topology
5EAZA 4G4VA 3WPXA 2ZOVA 3OONA 2HQSC 2KGWA 5EB0A 4ERHA 2ZF8A 3WPWA 4R40B 3LDTA 2K1SA 3TD4A 2AIZP 4G4ZA 1OAPA 4RHAA 3S03A 4B62A 3IMPA 4ZHWA 4PWTA 3TD5A 4G4WA 3CYPB 2ZVZA 4G88A 2W8BC 2LCAA 2MQEA 2N48A 3S06A 4ZHVA 4ZHYB 3TD3A 5EB1B 1R1MA 3S0WA 3CYQA 3S0HA 2L26A 2ZVYA 2LBTA 3S0YA 4B5CA 4G4XA 4G4YA 3KHNA 3S02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAZ A;  4G4V A;  3WPX A;  2ZOV A;  3OON A;  2HQS C;  2KGW A;  5EB0 A;  4ERH A;  2ZF8 A;  3WPW A;  4R40 B;  3LDT A;  2K1S A;  3TD4 A;  2AIZ P;  4G4Z A;  1OAP A;  4RHA A;  3S03 A;  4B62 A;  3IMP A;  4ZHW A;  4PWT A;  3TD5 A;  4G4W A;  3CYP B;  2ZVZ A;  4G88 A;  2W8B C;  2LCA A;  2MQE A;  2N48 A;  3S06 A;  4ZHV A;  4ZHY B;  3TD3 A;  5EB1 B;  1R1M A;  3S0W A;  3CYQ A;  3S0H A;  2L26 A;  2ZVY A;  2LBT A;  3S0Y A;  4B5C A;  4G4X A;  4G4Y A;  3KHN A;  3S02 A; 
#chains in the Genus database with same CATH topology
 2HX0 A;  1X52 A;  4O4H A;  5CB4 A;  2IAF A;  2F9Z C;  2OTL F;  3NMU C;  3MCA B;  1GX1 A;  2HRY A;  3N2G A;  3J81 M;  2CW4 A;  4PWT A;  2ZOD A;  1IV2 A;  5IJ0 B;  3DDN A;  4BT2 A;  3ZP7 A;  1VHA A;  3GTZ A;  5EIB D;  1KQS F;  1JJ2 F;  5JCO C;  2JNB A;  4I55 B;  5LXT A;  3VMF B;  2UYN A;  5HY2 A;  5IYZ B;  4O4I A;  3IKE A;  3V7E A;  3FD5 A;  1FNJ A;  3HKE B;  3J7A R;  3CCR F;  1VQ9 F;  4TV8 A;  3OBY A;  3RYC A;  5EB0 A;  5BMV A;  2B33 A;  3CPQ A;  3VO8 A;  2RB9 A;  3IKF A;  3JAT B;  3CCM F;  2HVY D;  1CLI A;  5FJ4 C;  2CHS A;  3LWQ C;  1IV4 A;  4TV9 B;  1J7H A;  3M1X A;  2UZH A;  3N4Z A;  4EB6 A;  3CC7 F;  4XCQ A;  2KG4 A;  3HKB B;  3UT5 A;  2MQE A;  2OTM A;  2VGM A;  4BVT A;  1VQ4 F;  1U43 A;  1Z5W A;  5LP6 A;  1M1K H;  1W5F A;  3K12 A;  3HKD B;  3RA5 A;  1XHO A;  4I50 B;  3VYS C;  2ALE A;  5HY0 A;  2G9I A;  3E22 A;  5GAP K;  2QA4 F;  3LFO A;  2K1S A;  2AIZ P;  3CME F;  1W55 A;  1DT9 A;  5HP7 A;  3WXM B;  4DRX B;  2YYE A;  5MN6 A;  5CA1 B;  2HS4 A;  5IJ0 A;  4X1K B;  3CC4 F;  4LNU B;  1FSZ A;  3ZOP A;  4B46 A;  2CHT A;  1QAH A;  2Z01 A;  4C8G A;  3S0H A;  3JAW B;  1YI2 F;  1Q86 H;  5MN4 A;  5JCO A;  5IYZ A;  4NUT A;  5EYP A;  1SA0 A;  5J2T B;  1SZQ A;  3HKE A;  5LOV B;  5C8Y A;  1IPA A;  1YJW F;  3ESJ A;  1VQ7 F;  1IV3 A;  3V7Q A;  3RYF A;  3JAT A;  3K0T A;  3WGJ A;  4RQO A;  3E20 B;  1QVF F;  3P10 A;  1ODE A;  5JVD B;  3VTI C;  5GIP C;  1Q8R A;  5GAN K;  1CN7 A;  1W5E A;  3E1Y A;  1RLU A;  3CCU F;  3WGM A;  2GVI A;  1OFU A;  4O4I B;  3K2X A;  2BTO A;  3WPX A;  4I50 A;  1S72 F;  2HP3 A;  3KJJ A;  3HTN A;  3VCZ A;  3LWR C;  1W42 A;  4X3M A;  4DRX A;  4NWO B;  1YJN F;  5CA1 A;  4EB6 B;  5KX5 B;  4B45 A;  4ZOL B;  4X1K A;  2AIF A;  3RYH B;  3UT5 B;  3I56 F;  4ZHV A;  3JVH A;  2KTU A;  3JAR B;  4BVS A;  3FPI A;  3WGN A;  3CMA F;  5HXZ A;  2EWC A;  2L26 A;  2Z1T A;  2LBT A;  3JAW A;  1W5B A;  3JAK B;  4BW0 B;  5LOV A;  1VQO F;  5DCV A;  4BT7 A;  2QTP A;  3PLA C;  4BT6 A;  2H6L A;  2NMU A;  3E22 B;  3F0D A;  3CXC F;  5JQG B;  5GIO C;  4BY9 D;  1VQN F;  3IMP A;  3V4D A;  1W40 A;  2PMP A;  3IEW A;  1TVK B;  5JVD A;  3JAM M;  2OTJ F;  2LCA A;  3S06 A;  3FFM A;  1VQ5 F;  4BVR A;  5EB1 B;  3NVK E;  3C9S A;  1FNK A;  3F6M A;  4X20 B;  4O2A B;  5IJ9 B;  4C8E A;  2VAP A;  5EYP B;  3C9U A;  1SA0 B;  3I7T A;  2R6R 1;  1W57 A;  1VQ6 F;  1YIT F;  5C8Y B;  1UFY A;  1K9M H;  1NQ3 A;  2Q1Y A;  5MN5 A;  4R40 B;  3VIU A;  4G4Z A;  3MBM A;  3RYF B;  4C4W C;  5HY4 A;  5ITZ B;  3QUW A;  1XV2 A;  3VI6 A;  3N2K B;  5KX5 A;  4ZOL A;  3RYH A;  3O85 A;  3WGL A;  3JAR A;  1GZ0 A;  3CCV F;  3ERN A;  1JD1 A;  3KE1 A;  2KTV A;  3EOR A;  1ZWZ A;  2RHO A;  3JAK A;  4EI8 A;  5HXU A;  3IEQ A;  3MQW A;  1RQ7 A;  1W59 A;  4X1I B;  2KGW A;  2LBX A;  1Z5V A;  5LA6 B;  3KIZ A;  3TD4 A;  5JQG A;  2I6D A;  1W41 A;  2CWJ A;  3CCL F;  4O4J B;  1RA4 A;  4I4T B;  4G88 A;  2W8B C;  2Z1U A;  3CCE F;  1TVK A;  3SIV A;  4X1Y B;  1VQ8 F;  3VOA A;  5FLX M;  5G4U C;  4TUY B;  1VQV A;  2ZVY A;  3IR9 A;  4X20 A;  4O2A A;  5IJ9 A;  2GLZ A;  1GO0 A;  2VAW A;  1VQL F;  4ERH A;  1QVG F;  3SIU A;  2ZF8 A;  4EI9 A;  4IHJ A;  4BT5 A;  1H48 A;  4KWE A;  3LDT A;  3WJQ A;  3MCQ A;  1QU9 A;  2CSL A;  4RHA A;  1W5A A;  4C82 A;  3GYQ A;  5ITZ A;  4TZZ A;  2QI2 A;  5G4V C;  1VK3 A;  3N2K A;  3G71 F;  2OHW A;  3HWU A;  5AVM A;  5CA0 B;  4EI7 A;  1U3L A;  3FBA A;  2UYK A;  2IQQ A;  1COM A;  2PHN A;  3VYT C;  3N4Y A;  3I3F A;  4F6R A;  1QD9 A;  1XRG A;  2H8E A;  2VXY A;  4LCK A;  5IT9 M;  4X1I A;  5LA6 A;  3WPW A;  1KNK A;  2HP0 B;  2QEX F;  1YJ9 F;  1E7K A;  4ZHW A;  5GON A;  3F0G A;  1X7O A;  2UYJ A;  4O4J A;  3J80 M;  2ZAU A;  4I4T A;  5LYJ B;  1VQP F;  3CG6 A;  1ONI A;  1DBF A;  3CCS F;  1R1M A;  1TUB B;  4X1Y A;  2LBW A;  3ELC A;  4TUY A;  2DT4 A;  4B5C A;  3P4E A;  2CZW A;  3OBW A;  3L7Q A;  3KJK A;  4O2B B;  3GHZ A;  5J2T A;  1M90 H;  3CC2 F;  3B6N A;  1N8R H;  3C9R A;  2FGY A;  5JH7 B;  1UI9 A;  4O4L B;  3TD3 A;  5CA0 A;  3V3T A;  3CYQ A;  3LME A;  3U0O A;  3JAL B;  4X3L A;  1U3P A;  4G4X A;  3LWV C;  4G4Y A;  3CB2 A;  1T0K B;  4HNA B;  3OW2 F;  2HS3 A;  3JAS B;  1IV1 A;  1X25 A;  4FFB B;  1VH8 A;  3VOB A;  4ZI7 B;  3HKC A;  3I55 F;  1NJI H;  2YXZ A;  3VYU C;  3CD6 F;  4WBN B;  3JCM M;  4IHJ B;  1H47 A;  2HP0 A;  3RYI B;  3S03 A;  4U3J B;  4B62 A;  3TD5 A;  2RHL A;  2ZVZ A;  3M84 A;  2P6Y A;  3C8L A;  3LYB A;  5HY1 A;  1JN1 A;  1RLG A;  5LYJ A;  1Q7Y H;  3WJR A;  3AGK A;  2HRU A;  4ZHQ B;  5J2U B;  1GO1 A;  3CCJ F;  2BTQ B;  1TUB A;  1KD1 H;  1W2B F;  4C8I A;  3S0Y A;  4YJ3 B;  5FNV B;  4BVQ A;  1VQM F;  1T0A A;  4BT3 A;  5EZY B;  2BO1 A;  2RHJ A;  4F6R B;  4BT4 A;  2HQS C;  5KMG B;  2OZB A;  4O2B A;  3NK7 A;  1PF5 A;  1OAP A;  3CPW F;  1PXW A;  2AMT A;  4YJ2 B;  5GON B;  4ZK7 A;  2Z1F A;  3P0Z A;  5JH7 A;  5EWR A;  3R0P A;  1YHQ F;  4O4L A;  4ZHY B;  5A2Q M;  1FFX B;  3M4S A;  3HJW C;  3F0E A;  5HP8 A;  3LWP C;  3JAL A;  5EIB C;  4I55 A;  3S02 A;  2Z1E A;  4HNA A;  4G4V A;  3JAS A;  4IIJ B;  4FFB A;  3OON A;  4C81 A;  4ZI7 A;  3PAF A;  3HAX D;  3ZP4 A;  4WBN A;  3CCQ F;  1W3E X;  2DYY A;  3DC2 A;  3RYI A;  4U3J A;  1SDS A;  2H8C A;  1YQN A;  2V9Y A;  1X7P A;  4ZHQ A;  3S0W A;  5J2U A;  1YIJ F;  2RHH A;  4U39 A;  1JFF B;  3KHN A;  4YJ3 A;  5FNV A;  3NVI B;  2UYP A;  4O4H B;  5CB4 B;  3WJP A;  3QHD A;  2ZOV A;  5EZY A;  3HKC B;  1K8A H;  2VAM A;  3ON1 A;  3K14 A;  5KMG A;  3N2G B;  2CVL A;  3ZO8 A;  1XBI A;  4TV9 A;  3CYP B;  2IG8 A;  4DXD A;  4YJ2 A;  3D01 A;  3HKB A;  4NQ3 A;  3F0F A;  1JY8 A;  2N48 A;  3G4S F;  1H7M A;  3BYQ A;  1FFX A;  2Q1X A;  5LXT B;  2UYN B;  1U40 A;  4M8I A;  2R75 1;  5HWE A;  4E6E A;  1K73 H;  2BTU A;  3G6E F;  3HKD A;  5EAZ A;  3RE3 A;  4TV8 B;  5B8F A;  1Q81 H;  1NMU B;  1KC8 H;  3MDO A;  1Q82 H;  1W58 1;  3RYC B;  4IIJ A;  5BMV B;  3LWO C;  2HS0 A;  3D00 A;  3Q8H A;  3FD6 A;  3WGK A;  2FC3 A;  5GIN C;  2GZL A;  2I6R A;  4G4W A;  1CK2 A;  2WAL A;  3NK6 A;  4LNU A;  3T80 A;  3QTY A;  1KNJ A;  5LP6 C;  3C9T A;  5EO3 A;  3RA6 A;  5LP6 B;  1RQ2 A;  3D54 A;  1VQK F;  1YGY A;  2VGN A;  1JFF A; 
#chains in the Genus database with same CATH homology
 5EAZ A;  4G4V A;  3WPX A;  2ZOV A;  3OON A;  2HQS C;  2KGW A;  5EB0 A;  4ERH A;  2ZF8 A;  3WPW A;  4R40 B;  3LDT A;  2K1S A;  3TD4 A;  2AIZ P;  4G4Z A;  1OAP A;  4RHA A;  3S03 A;  4B62 A;  3IMP A;  4ZHW A;  4PWT A;  3TD5 A;  4G4W A;  3CYP B;  2ZVZ A;  4G88 A;  2W8B C;  2LCA A;  2MQE A;  2N48 A;  3S06 A;  4ZHV A;  4ZHY B;  3TD3 A;  5EB1 B;  1R1M A;  3S0W A;  3CYQ A;  3S0H A;  2L26 A;  2ZVY A;  2LBT A;  3S0Y A;  4B5C A;  4G4X A;  4G4Y A;  3KHN A;  3S02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...