2LBTA

Solution structure of the c domain of rv0899(d236a) from mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPAAYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGLGSVNPIASNATPEGRAKNRRVEIVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein Rv0899/MT0922
publication title Molecular Structure and Peptidoglycan Recognition of Mycobacterium tuberculosis ArfA (Rv0899).
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan-binding protein
total genus 37
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2lbtA00
2AIZP 2ZF8A 3WPWA 4G4ZA 2ZOVA 4G4YA 4G4VA 4B62A 3S0HA 4ZHWA 2L26A 3S02A 5EB1B 4B5CA 3IMPA 2KGWA 3TD3A 3OONA 2K1SA 2ZVYA 4G4WA 4PWTA 2MQEA 3S06A 2HQSC 3LDTA 4ERHA 5EAZA 4ZHVA 2ZVZA 2LCAA 3CYQA 3WPXA 4ZHYB 3KHNA 4RHAA 2LBTA 3TD5A 3S0YA 4G4XA 3TD4A 1R1MA 3S0WA 3S03A 5EB0A 4G88A 3CYPB 4R40B 2W8BC 1OAPA 2N48A
chains in the Genus database with same CATH superfamily
2H8EA 4I50B 5HY0A 2R751 4G4ZA 4G4VA 3CB2A 3S0HA 3WGKA 2L26A 3S02A 1VQVA 3TD3A 3JAWB 4YJ2B 3KIZA 2Z01A 3PLAC 2HQSC 3F0FA 1VQ5F 4O2AB 5ITZA 2RHJA 3RYFB 2IAFA 4O4HB 4BT5A 3WJPA 3KHNA 1VQKF 1PF5A 3V4DA 1VK3A 3I55F 1COMA 3HTNA 2HRUA 1VQPF 1X7PA 2CZWA 1X7OA 3L7QA 2B33A 4X1IB 5BMVA 1IV2A 2IG8A 3T80A 1VQLF 3VTIC 3M84A 3JVHA 5HP7A 5CB4B 4EB6B 4PWTA 3IEWA 4X1YB 3S06A 4X20A 3LDTA 5GIOC 1ODEA 3D54A 5KX5B 1X52A 1GO1A 2LBTA 1VQ4F 3IKEA 1U43A 3N2KB 3V7EA 2HVYD 2RB9A 3NMUC 3P0ZA 2DYYA 1NQ3A 2W8BC 3WGNA 4I50A 2AIZP 1W5EA 3P4EA 2PHNA 5GINC 1VQOF 3NK6A 1KD1H 1TUBB 3JASB 3LYBA 3JAWA 4YJ2A 2Q1YA 3OW2F 4BVSA 5LOVB 4X3LA 1K9MH 4O2AA 3GHZA 3RYFA 4BVRA 4BY9D 3VCZA 4O4HA 3CCEF 5CA1B 3TD5A 2LBXA 1ONIA 5FLXM 2VGNA 1S72F 5GANK 1JJ2F 1YGYA 3HKEB 4ZOLB 3JALB 3QUWA 5HY1A 2KTVA 3VMFB 4BVTA 4X1IA 5JQGB 3F0DA 5HXZA 2EWCA 4ZHWA 3OBWA 1IV3A 5CB4A 4EB6A 4X1YA 1UI9A 3MDOA 1SZQA 1IV4A 3LWRC 3RE3A 2HS4A 3MCQA 5KX5A 2OZBA 3N4ZA 3C9SA 1QAHA 1DBFA 3WJRA 2BTOA 3N2KA 4NQ3A 3RA6A 3CCLF 1YHQF 5EZYB 1R1MA 4G88A 3CYPB 3LWVC 3VOAA 2ZF8A 2YXZA 3FBAA 3WPWA 3G6EF 3LMEA 2KG4A 4IHJB 3C8LA 2KTUA 1TUBA 3JASA 3Q8HA 3KJJA 3QHDA 1CLIA 1T0AA 4U39A 5LOVA 1J7HA 3O85A 3J7AR 2H8CA 3JATB 4ZHVA 1Q8RA 5FJ4C 3D00A 1CK2A 5CA1A 3I7TA 4I4TB 1CN7A 1GX1A 3CG6A 3HKEA 4ZOLA 3JALA 2HP0B 1FNKA 1W41A 5JQGA 5AVMA 5GONB 1XBIA 4BT4A 3VOBA 3WGLA 4U3JB 5J2UB 5EWRA 2UYJA 3JARB 3MBMA 4NWOB 2OTMA 2UZHA 3CD6F 4EI9A 3CCQF 5G4UC 5JCOA 3F0GA 3JAMM 3WPXA 3OBYA 5JCOC 2RHHA 1W57A 3I3FA 3IEQA 2JNBA 5EZYA 5MN5A 5C8YA 3ELCA 5EB0A 3HAXD 3CXCF 2BTUA 1K73H 3LWOC 1VQ8F 4C81A 5IYZB 1NMUB 1U40A 5HWEA 3G71F 1U3LA 4IHJA 3K12A 3J81M 1IV1A 2AIFA 3F6MA 4EI8A 1ZWZA 4B45A 2OTJF 3UT5B 1GO0A 3K2XA 2F9ZC 2RHOA 3JATA 4IIJB 3ERNA 4TV9B 3G4SF 4I4TA 1W59A 2AMTA 3CMAF 4TUYB 3HKDB 1SDSA 4ZHQB 2HP0A 1KNKA 5GONA 4BW0B 1M90H 1VQNF 2VAWA 5LA6B 4F6RB 4U3JA 4B5CA 5J2UA 1H47A 1XRGA 3JARA 1KQSF 4G4WA 2G9IA 1N8RH 1VHAA 3ZP7A 1E7KA 1RLGA 3VYSC 4O4JB 4ERHA 5LP6B 4KWEA 3E22B 2VGMA 5HY4A 1Q86H 3ON1A 1VQMF 3C9TA 5HP8A 3PAFA 5HXUA 1IPAA 1RA4A 2HS3A 1SA0B 2QA4F 1OAPA 5IYZA 4C8GA 5HY2A 2N48A 1VQ7F 4G4YA 1XHOA 2Z1FA 3CPQA 3HKCB 5EO3A 1TVKB 5GAPK 1W2BF 3VYUC 3CC4F 2I6RA 2Z1EA 2ZVYA 3UT5A 4O4IB 4IIJA 3V7QA 4HNAB 5EAZA 5JVDB 4FFBB 4TV9A 3N2GB 2ZAUA 1YJNF 2CSLA 4X1KB 5LYJB 4TUYA 3HKDA 4ZHQA 4R40B 3E20B 3FD6A 3QTYA 3CCRF 2V9YA 1JN1A 3HKBB 4BT7A 5LA6A 4B62A 1FNJA 1K8AH 4I55B 4F6RA 3KE1A 3RYIB 4DRXB 2NMUA 3IKFA 2UYNB 3E1YA 5KMGB 1YQNA 1QU9A 3VIUA 4O4JA 3LWQC 1VQ9F 2YYEA 5LP6A 2IQQA 3E22A 5MN4A 4BT2A 1NJIH 4XCQA 5LP6C 1FSZA 4RHAA 2RHLA 5EYPB 2I6DA 1W5AA 3ZP4A 1JFFB 1SA0A 3S03A 1YJ9F 3I56F 4NUTA 3WXMB 5IJ9B 3NK7A 3RYHB 1JY8A 3D01A 3GYQA 4O4LB 2PMPA 2BO1A 2Z1TA 3HKCA 1TVKA 3SIVA 2KGWA 3SIUA 5IJ0B 3U0OA 4O4IA 4HNAA 3CC2F 5JVDA 3N4YA 3LFOA 3N2GA 4FFBA 2LCAA 2HP3A 3CCVF 1YJWF 4TV8B 3M4SA 2H6LA 4X1KA 3VO8A 5LYJA 5J2TB 3S0WA 1X25A 2UYKA 3GTZA 5A2QM 1Z5WA 5MN6A 4RQOA 3DDNA 3HKBA 4I55A 3WGMA 3EORA 3RYIA 4DRXA 1VQ6F 2UYNA 2CVLA 1M1KH 1RLUA 4M8IA 2LBWA 5KMGA 3OONA 4ZI7B 2QI2A 1Q82H 1W3EX 4TZZA 3C9UA 1YITF 1W40A 5EYPA 3IR9A 3TD4A 1JFFA 2DT4A 3CCMF 1GZ0A 2GVIA 1PXWA 5IJ9A 3RYHA 3BYQA 3RYCB 4O4LA 3NVKE 2OTLF 3VI6A 5IT9M 3JAKB 2CWJA 4C8IA 1W55A 4LNUB 3IMPA 1W42A 4DXDA 3CMEF 3NVIB 2VAPA 5IJ0A 3LWPC 3B6NA 3ESJA 2R6R1 1H7MA 5CA0B 1YIJF 3RA5A 2GZLA 4WBNB 1RQ2A 3CYQA 4C8EA 1FFXB 2BTQB 4TV8A 1W581 4O2BB 5LXTB 5J2TA 4C82A 4G4XA 1KNJA 3K0TA 1QVFF 1W5FA 3VYTC 3CC7F 1T0KB 2HS0A 5B8FA 4YJ3B 1RQ7A 4ZI7A 2QEXF 3HWUA 5JH7B 1U3PA 1KC8H 2VAMA 3ZO8A 4EI7A 2ZODA 2Q1XA 5FNVB 2P6YA 3V3TA 4ZHYB 1VH8A 2ALEA 2UYPA 5EIBD 2CHTA 3WJQA 3ZOPA 3F0EA 1YI2F 3RYCA 3MCAB 2QTPA 1Q7YH 4BT6A 3DC2A 2ZOVA 3R0PA 4BVQA 2OHWA 3JAKA 2HRYA 4LNUA 3J80M 1H48A 3FFMA 5CA0A 1Q81H 5DCVA 5G4VC 4X3MA 4WBNA 4BT3A 3CPWF 1FFXA 1XV2A 2ZVZA 5ITZB 3FD5A 4O2BA 4E6EA 5LXTA 3JCMM 4C4WC 2VXYA 3CCSF 5C8YB 4B46A 3AGKA 1JD1A 1W5BA 2CHSA 2HX0A 2CW4A 1QVGF 1Z5VA 4YJ3A 3C9RA 5BMVB 4LCKA 5EB1B 2FC3A 5JH7A 3P10A 2K1SA 1QD9A 1UFYA 2MQEA 2Z1UA 3MQWA 5FNVA 2GLZA 3HJWC 4X20B 2WALA 3KJKA 3WGJA 1DT9A 3CCUF 5EIBC 3K14A 4ZK7A 3FPIA 3S0YA 2FGYA 5GIPC 3CCJF 3M1XA 1OFUA
chains in the Genus database with same CATH topology
2AIZP 2ZF8A 3WPWA 4G4ZA 2ZOVA 4G4YA 4G4VA 4B62A 3S0HA 4ZHWA 2L26A 3S02A 5EB1B 4B5CA 3IMPA 2KGWA 3TD3A 3OONA 2K1SA 2ZVYA 4G4WA 4PWTA 2MQEA 3S06A 2HQSC 3LDTA 4ERHA 5EAZA 4ZHVA 2ZVZA 2LCAA 3CYQA 3WPXA 4ZHYB 3KHNA 4RHAA 2LBTA 3TD5A 3S0YA 4G4XA 3TD4A 1R1MA 3S0WA 3S03A 5EB0A 4G88A 3CYPB 4R40B 2W8BC 1OAPA 2N48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  2ZF8 A;  3WPW A;  4G4Z A;  2ZOV A;  4G4Y A;  4G4V A;  4B62 A;  3S0H A;  4ZHW A;  2L26 A;  3S02 A;  5EB1 B;  4B5C A;  3IMP A;  2KGW A;  3TD3 A;  3OON A;  2K1S A;  2ZVY A;  4G4W A;  4PWT A;  2MQE A;  3S06 A;  2HQS C;  3LDT A;  4ERH A;  5EAZ A;  4ZHV A;  2ZVZ A;  2LCA A;  3CYQ A;  3WPX A;  4ZHY B;  3KHN A;  4RHA A;  2LBT A;  3TD5 A;  3S0Y A;  4G4X A;  3TD4 A;  1R1M A;  3S0W A;  3S03 A;  5EB0 A;  4G88 A;  3CYP B;  4R40 B;  2W8B C;  1OAP A;  2N48 A; 
#chains in the Genus database with same CATH topology
 2H8E A;  4I50 B;  5HY0 A;  2R75 1;  4G4Z A;  4G4V A;  3CB2 A;  3S0H A;  3WGK A;  2L26 A;  3S02 A;  1VQV A;  3TD3 A;  3JAW B;  4YJ2 B;  3KIZ A;  2Z01 A;  3PLA C;  2HQS C;  3F0F A;  1VQ5 F;  4O2A B;  5ITZ A;  2RHJ A;  3RYF B;  2IAF A;  4O4H B;  4BT5 A;  3WJP A;  3KHN A;  1VQK F;  1PF5 A;  3V4D A;  1VK3 A;  3I55 F;  1COM A;  3HTN A;  2HRU A;  1VQP F;  1X7P A;  2CZW A;  1X7O A;  3L7Q A;  2B33 A;  4X1I B;  5BMV A;  1IV2 A;  2IG8 A;  3T80 A;  1VQL F;  3VTI C;  3M84 A;  3JVH A;  5HP7 A;  5CB4 B;  4EB6 B;  4PWT A;  3IEW A;  4X1Y B;  3S06 A;  4X20 A;  3LDT A;  5GIO C;  1ODE A;  3D54 A;  5KX5 B;  1X52 A;  1GO1 A;  2LBT A;  1VQ4 F;  3IKE A;  1U43 A;  3N2K B;  3V7E A;  2HVY D;  2RB9 A;  3NMU C;  3P0Z A;  2DYY A;  1NQ3 A;  2W8B C;  3WGN A;  4I50 A;  2AIZ P;  1W5E A;  3P4E A;  2PHN A;  5GIN C;  1VQO F;  3NK6 A;  1KD1 H;  1TUB B;  3JAS B;  3LYB A;  3JAW A;  4YJ2 A;  2Q1Y A;  3OW2 F;  4BVS A;  5LOV B;  4X3L A;  1K9M H;  4O2A A;  3GHZ A;  3RYF A;  4BVR A;  4BY9 D;  3VCZ A;  4O4H A;  3CCE F;  5CA1 B;  3TD5 A;  2LBX A;  1ONI A;  5FLX M;  2VGN A;  1S72 F;  5GAN K;  1JJ2 F;  1YGY A;  3HKE B;  4ZOL B;  3JAL B;  3QUW A;  5HY1 A;  2KTV A;  3VMF B;  4BVT A;  4X1I A;  5JQG B;  3F0D A;  5HXZ A;  2EWC A;  4ZHW A;  3OBW A;  1IV3 A;  5CB4 A;  4EB6 A;  4X1Y A;  1UI9 A;  3MDO A;  1SZQ A;  1IV4 A;  3LWR C;  3RE3 A;  2HS4 A;  3MCQ A;  5KX5 A;  2OZB A;  3N4Z A;  3C9S A;  1QAH A;  1DBF A;  3WJR A;  2BTO A;  3N2K A;  4NQ3 A;  3RA6 A;  3CCL F;  1YHQ F;  5EZY B;  1R1M A;  4G88 A;  3CYP B;  3LWV C;  3VOA A;  2ZF8 A;  2YXZ A;  3FBA A;  3WPW A;  3G6E F;  3LME A;  2KG4 A;  4IHJ B;  3C8L A;  2KTU A;  1TUB A;  3JAS A;  3Q8H A;  3KJJ A;  3QHD A;  1CLI A;  1T0A A;  4U39 A;  5LOV A;  1J7H A;  3O85 A;  3J7A R;  2H8C A;  3JAT B;  4ZHV A;  1Q8R A;  5FJ4 C;  3D00 A;  1CK2 A;  5CA1 A;  3I7T A;  4I4T B;  1CN7 A;  1GX1 A;  3CG6 A;  3HKE A;  4ZOL A;  3JAL A;  2HP0 B;  1FNK A;  1W41 A;  5JQG A;  5AVM A;  5GON B;  1XBI A;  4BT4 A;  3VOB A;  3WGL A;  4U3J B;  5J2U B;  5EWR A;  2UYJ A;  3JAR B;  3MBM A;  4NWO B;  2OTM A;  2UZH A;  3CD6 F;  4EI9 A;  3CCQ F;  5G4U C;  5JCO A;  3F0G A;  3JAM M;  3WPX A;  3OBY A;  5JCO C;  2RHH A;  1W57 A;  3I3F A;  3IEQ A;  2JNB A;  5EZY A;  5MN5 A;  5C8Y A;  3ELC A;  5EB0 A;  3HAX D;  3CXC F;  2BTU A;  1K73 H;  3LWO C;  1VQ8 F;  4C81 A;  5IYZ B;  1NMU B;  1U40 A;  5HWE A;  3G71 F;  1U3L A;  4IHJ A;  3K12 A;  3J81 M;  1IV1 A;  2AIF A;  3F6M A;  4EI8 A;  1ZWZ A;  4B45 A;  2OTJ F;  3UT5 B;  1GO0 A;  3K2X A;  2F9Z C;  2RHO A;  3JAT A;  4IIJ B;  3ERN A;  4TV9 B;  3G4S F;  4I4T A;  1W59 A;  2AMT A;  3CMA F;  4TUY B;  3HKD B;  1SDS A;  4ZHQ B;  2HP0 A;  1KNK A;  5GON A;  4BW0 B;  1M90 H;  1VQN F;  2VAW A;  5LA6 B;  4F6R B;  4U3J A;  4B5C A;  5J2U A;  1H47 A;  1XRG A;  3JAR A;  1KQS F;  4G4W A;  2G9I A;  1N8R H;  1VHA A;  3ZP7 A;  1E7K A;  1RLG A;  3VYS C;  4O4J B;  4ERH A;  5LP6 B;  4KWE A;  3E22 B;  2VGM A;  5HY4 A;  1Q86 H;  3ON1 A;  1VQM F;  3C9T A;  5HP8 A;  3PAF A;  5HXU A;  1IPA A;  1RA4 A;  2HS3 A;  1SA0 B;  2QA4 F;  1OAP A;  5IYZ A;  4C8G A;  5HY2 A;  2N48 A;  1VQ7 F;  4G4Y A;  1XHO A;  2Z1F A;  3CPQ A;  3HKC B;  5EO3 A;  1TVK B;  5GAP K;  1W2B F;  3VYU C;  3CC4 F;  2I6R A;  2Z1E A;  2ZVY A;  3UT5 A;  4O4I B;  4IIJ A;  3V7Q A;  4HNA B;  5EAZ A;  5JVD B;  4FFB B;  4TV9 A;  3N2G B;  2ZAU A;  1YJN F;  2CSL A;  4X1K B;  5LYJ B;  4TUY A;  3HKD A;  4ZHQ A;  4R40 B;  3E20 B;  3FD6 A;  3QTY A;  3CCR F;  2V9Y A;  1JN1 A;  3HKB B;  4BT7 A;  5LA6 A;  4B62 A;  1FNJ A;  1K8A H;  4I55 B;  4F6R A;  3KE1 A;  3RYI B;  4DRX B;  2NMU A;  3IKF A;  2UYN B;  3E1Y A;  5KMG B;  1YQN A;  1QU9 A;  3VIU A;  4O4J A;  3LWQ C;  1VQ9 F;  2YYE A;  5LP6 A;  2IQQ A;  3E22 A;  5MN4 A;  4BT2 A;  1NJI H;  4XCQ A;  5LP6 C;  1FSZ A;  4RHA A;  2RHL A;  5EYP B;  2I6D A;  1W5A A;  3ZP4 A;  1JFF B;  1SA0 A;  3S03 A;  1YJ9 F;  3I56 F;  4NUT A;  3WXM B;  5IJ9 B;  3NK7 A;  3RYH B;  1JY8 A;  3D01 A;  3GYQ A;  4O4L B;  2PMP A;  2BO1 A;  2Z1T A;  3HKC A;  1TVK A;  3SIV A;  2KGW A;  3SIU A;  5IJ0 B;  3U0O A;  4O4I A;  4HNA A;  3CC2 F;  5JVD A;  3N4Y A;  3LFO A;  3N2G A;  4FFB A;  2LCA A;  2HP3 A;  3CCV F;  1YJW F;  4TV8 B;  3M4S A;  2H6L A;  4X1K A;  3VO8 A;  5LYJ A;  5J2T B;  3S0W A;  1X25 A;  2UYK A;  3GTZ A;  5A2Q M;  1Z5W A;  5MN6 A;  4RQO A;  3DDN A;  3HKB A;  4I55 A;  3WGM A;  3EOR A;  3RYI A;  4DRX A;  1VQ6 F;  2UYN A;  2CVL A;  1M1K H;  1RLU A;  4M8I A;  2LBW A;  5KMG A;  3OON A;  4ZI7 B;  2QI2 A;  1Q82 H;  1W3E X;  4TZZ A;  3C9U A;  1YIT F;  1W40 A;  5EYP A;  3IR9 A;  3TD4 A;  1JFF A;  2DT4 A;  3CCM F;  1GZ0 A;  2GVI A;  1PXW A;  5IJ9 A;  3RYH A;  3BYQ A;  3RYC B;  4O4L A;  3NVK E;  2OTL F;  3VI6 A;  5IT9 M;  3JAK B;  2CWJ A;  4C8I A;  1W55 A;  4LNU B;  3IMP A;  1W42 A;  4DXD A;  3CME F;  3NVI B;  2VAP A;  5IJ0 A;  3LWP C;  3B6N A;  3ESJ A;  2R6R 1;  1H7M A;  5CA0 B;  1YIJ F;  3RA5 A;  2GZL A;  4WBN B;  1RQ2 A;  3CYQ A;  4C8E A;  1FFX B;  2BTQ B;  4TV8 A;  1W58 1;  4O2B B;  5LXT B;  5J2T A;  4C82 A;  4G4X A;  1KNJ A;  3K0T A;  1QVF F;  1W5F A;  3VYT C;  3CC7 F;  1T0K B;  2HS0 A;  5B8F A;  4YJ3 B;  1RQ7 A;  4ZI7 A;  2QEX F;  3HWU A;  5JH7 B;  1U3P A;  1KC8 H;  2VAM A;  3ZO8 A;  4EI7 A;  2ZOD A;  2Q1X A;  5FNV B;  2P6Y A;  3V3T A;  4ZHY B;  1VH8 A;  2ALE A;  2UYP A;  5EIB D;  2CHT A;  3WJQ A;  3ZOP A;  3F0E A;  1YI2 F;  3RYC A;  3MCA B;  2QTP A;  1Q7Y H;  4BT6 A;  3DC2 A;  2ZOV A;  3R0P A;  4BVQ A;  2OHW A;  3JAK A;  2HRY A;  4LNU A;  3J80 M;  1H48 A;  3FFM A;  5CA0 A;  1Q81 H;  5DCV A;  5G4V C;  4X3M A;  4WBN A;  4BT3 A;  3CPW F;  1FFX A;  1XV2 A;  2ZVZ A;  5ITZ B;  3FD5 A;  4O2B A;  4E6E A;  5LXT A;  3JCM M;  4C4W C;  2VXY A;  3CCS F;  5C8Y B;  4B46 A;  3AGK A;  1JD1 A;  1W5B A;  2CHS A;  2HX0 A;  2CW4 A;  1QVG F;  1Z5V A;  4YJ3 A;  3C9R A;  5BMV B;  4LCK A;  5EB1 B;  2FC3 A;  5JH7 A;  3P10 A;  2K1S A;  1QD9 A;  1UFY A;  2MQE A;  2Z1U A;  3MQW A;  5FNV A;  2GLZ A;  3HJW C;  4X20 B;  2WAL A;  3KJK A;  3WGJ A;  1DT9 A;  3CCU F;  5EIB C;  3K14 A;  4ZK7 A;  3FPI A;  3S0Y A;  2FGY A;  5GIP C;  3CCJ F;  3M1X A;  1OFU A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  2ZF8 A;  3WPW A;  4G4Z A;  2ZOV A;  4G4Y A;  4G4V A;  4B62 A;  3S0H A;  4ZHW A;  2L26 A;  3S02 A;  5EB1 B;  4B5C A;  3IMP A;  2KGW A;  3TD3 A;  3OON A;  2K1S A;  2ZVY A;  4G4W A;  4PWT A;  2MQE A;  3S06 A;  2HQS C;  3LDT A;  4ERH A;  5EAZ A;  4ZHV A;  2ZVZ A;  2LCA A;  3CYQ A;  3WPX A;  4ZHY B;  3KHN A;  4RHA A;  2LBT A;  3TD5 A;  3S0Y A;  4G4X A;  3TD4 A;  1R1M A;  3S0W A;  3S03 A;  5EB0 A;  4G88 A;  3CYP B;  4R40 B;  2W8B C;  1OAP A;  2N48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...