4RHAA

Structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
131
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
publication title Structure of the C-terminal domain of outer-membrane protein OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
total genus 39
structure length 131
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4rhaA00
1R1MA 2ZVZA 4ERHA 2MQEA 3OONA 4G88A 3S0WA 2ZOVA 4ZHVA 2AIZP 2ZVYA 3CYQA 5EB0A 3S0HA 2HQSC 4G4ZA 3TD3A 4ZHWA 3IMPA 3KHNA 3WPWA 4G4WA 2N48A 3LDTA 1OAPA 2LCAA 3S0YA 4R40B 4B62A 3S03A 3TD5A 4PWTA 4B5CA 3S06A 2K1SA 3S02A 2L26A 2KGWA 4RHAA 4ZHYB 2LBTA 5EAZA 3TD4A 4G4VA 5EB1B 3CYPB 2W8BC 4G4YA 3WPXA 4G4XA 2ZF8A
chains in the Genus database with same CATH superfamily
4B46A 1KQSF 3OONA 3VYUC 2V9YA 1W581 3KJKA 1U43A 2JNBA 3E1YA 3ERNA 1M1KH 3IMPA 4O4LB 3LWOC 4C8IA 1QVFF 4YJ2B 3J80M 5ITZA 1TUBB 3JASA 5EZYB 3CPWF 2H8CA 4YJ3B 5IJ0B 3WGJA 1ODEA 3LDTA 4O4JA 4X1IB 1SA0B 3T80A 1GZ0A 4I55B 4LNUA 5C8YA 5J2TA 4BT4A 3JAKB 3N2GA 4I4TB 2W8BC 3FD6A 3VYSC 3KE1A 5EWRA 1VHAA 3FFMA 3M84A 3N4YA 2QA4F 3JVHA 1K73H 5ITZB 3TD3A 3JASB 1RQ2A 1Q86H 5LP6C 4BVQA 4O4JB 4RQOA 1VQ6F 2OTJF 2ALEA 1U40A 2Q1YA 4B62A 1ZWZA 4LNUB 5C8YB 5KMGB 5J2TB 3CCMF 3ZP7A 1ONIA 2Z1FA 3N2GB 3HKBA 3JAWB 4X20B 2RHOA 1DBFA 5EAZA 3TD4A 4EI7A 2CWJA 2BTQB 1VQ4F 4BT2A 5IT9M 4BT5A 2AMTA 3CC7F 1COMA 3K2XA 1IV4A 3B6NA 5KX5A 3IR9A 1K9MH 3MCQA 2IQQA 3MCAB 3P4EA 3UT5A 2Z1EA 3HKBB 3DC2A 2Z01A 3JARB 3KIZA 1M90H 1Q7YH 1YI2F 5HY4A 1W41A 4G4VA 3CCJF 4X1KB 2HP0A 4IIJA 5LYJA 2OTLF 5B8FA 3FD5A 2HRUA 5LXTA 2FGYA 5JVDA 3MDOA 5KX5B 2KTVA 1VQLF 1VH8A 3V4DA 1W5EA 3UT5B 1T0AA 5IJ9A 2F9ZC 4EB6A 3CMAF 4O4HB 1RQ7A 4U3JA 5G4UC 3JAMM 3ZP4A 1VQ5F 4IIJB 4C4WC 1YJNF 2UYNA 5FLXM 3IEWA 4G4XA 3I3FA 5LXTB 1R1MA 1GO0A 2LBWA 3V7QA 3Q8HA 2HX0A 1KC8H 3SIVA 1XBIA 5GINC 5IJ9B 4EB6B 3GYQA 3LYBA 3CCQF 3ESJA 4U3JB 3VTIC 5FNVB 1YJWF 1JD1A 3CB2A 3CD6F 3QHDA 1UFYA 4O4IA 3PLAC 3S06A 1NJIH 3E22B 4TV9A 5BMVB 2OTMA 2ZAUA 3LFOA 2UYNB 3J7AR 1XHOA 2QI2A 3WJQA 5EB1B 1X7PA 3CYPB 2HS0A 3F0FA 1W5BA 2OHWA 2Z1TA 4EI8A 1VQOF 5G4VC 4G88A 5JQGB 4BW0B 4DRXB 5EB0A 1PXWA 3QUWA 3KHNA 3E20B 4C81A 3IKEA 3D01A 3RYFA 2N48A 2UYJA 5HY2A 1SZQA 2FC3A 3F6MA 3S03A 4TV9B 2K1SA 3S02A 1JJ2F 1QVGF 1W42A 1RLUA 3J81M 1K8AH 3N2KA 5EO3A 5HWEA 2H8EA 1SDSA 4G4YA 5HP8A 3NMUC 5J2UA 1KNJA 1W3EX 3M1XA 1DT9A 4TZZA 2MQEA 1X25A 5DCVA 2RB9A 2ZOVA 3CYQA 4ZHQA 4EI9A 1N8RH 1W57A 3WGKA 4C8GA 3CXCF 5MN5A 1VQVA 3C9SA 3CCEF 4BVTA 2VAWA 4R40B 1YQNA 3OW2F 3N2KB 3HJWC 1W5AA 1QD9A 2BO1A 5LA6A 4HNAA 4BT6A 4ZI7A 4C8EA 3CCUF 3P0ZA 4TUYA 3WPXA 1VQKF 2CHTA 1S72F 1IV2A 4ZHQB 3S0WA 3VOBA 3KJJA 3U0OA 3JCMM 3LMEA 2GVIA 2RHLA 5EIBC 3JALA 3LWRC 2UYPA 1YJ9F 1X52A 3CC4F 5HXZA 3NVIB 3NVKE 5JCOA 1CLIA 2IAFA 4I50A 3HTNA 4HNAB 5LA6B 5JH7A 3M4SA 1Z5VA 4TUYB 1FNKA 2LBTA 5A2QM 3CCLF 2Q1XA 4BY9D 3MQWA 3CPQA 2CSLA 4TV8A 4ERHA 2HVYD 4E6EA 3CCSF 2Z1UA 4C82A 1VK3A 3C8LA 3WJPA 3C9TA 1W40A 1YHQF 3LWQC 2RHJA 5HXUA 3S0YA 1QU9A 5JH7B 3MBMA 4NWOB 3VMFB 3K12A 1W2BF 3HKDA 2HP0B 3P10A 5LYJB 1H47A 4TV8B 1NQ3A 2CZWA 2ZVZA 1X7OA 3PAFA 1Z5WA 5JVDB 3VYTC 1W5FA 2HP3A 4KWEA 4X3MA 3F0DA 3VOAA 1J7HA 2RHHA 2NMUA 2HS4A 2ZODA 1JFFA 3NK6A 4M8IA 1OAPA 2R751 3AGKA 4NUTA 3VIUA 5GIPC 1QAHA 3HKEA 3HKDB 5IYZA 2HS3A 4WBNA 3V7EA 4ZHYB 3CC2F 3K14A 1H7MA 2QTPA 4BVSA 1Q8RA 3DDNA 4BT7A 5AVMA 3RA5A 2WALA 5LOVA 1YITF 3C9UA 2OZBA 2KG4A 4G4ZA 1JFFB 1Q81H 2GZLA 5JCOC 5MN6A 4YJ2A 3HKEB 5MN4A 5IJ0A 3FPIA 4O4IB 1GX1A 1XRGA 4F6RA 3HAXD 4WBNB 2KGWA 3VI6A 3RYIA 3WGNA 1YIJF 3OBYA 1CN7A 1FSZA 2DYYA 3WGMA 5LOVB 3VO8A 5HY1A 3G4SF 2B33A 3JATA 2KTUA 3RYFB 3V3TA 4BVRA 4ZK7A 1VQ9F 1U3LA 3VCZA 2BTUA 5FJ4C 4F6RB 4FFBA 3TD5A 5KMGA 1PF5A 3RYIB 3K0TA 2VGMA 1H48A 1YGYA 4ZOLA 3JAWA 4X20A 1OFUA 2CHSA 2HRYA 4DXDA 1UI9A 1VQMF 5J2UB 5GONA 2QEXF 2YYEA 3I55F 3QTYA 3R0PA 2CVLA 2VXYA 4B45A 3RE3A 1W59A 3JATB 4ZHVA 4LCKA 4XCQA 5CA0A 1Q82H 3HKCA 1TVKA 4X1YA 1FFXA 1VQ7F 4FFBB 3N4ZA 1VQNF 3L7QA 5GIOC 2YXZA 2CW4A 4ZOLB 4BT3A 3OBWA 3JARA 1RLGA 3RYHA 4ZI7B 5GONB 5CA1A 1VQPF 5EYPA 4X1KA 1T0KB 2ZF8A 2VAMA 2VGNA 3WXMB 5CA0B 1CK2A 5GANK 5CB4A 5HP7A 4O2AA 3HKCB 1TVKB 2HQSC 4X1YB 2R6R1 2VAPA 2EWCA 2H6LA 3G6EF 1FFXB 3F0EA 3LWVC 3JALB 3WJRA 3SIUA 3C9RA 4O4HA 4O2BA 4I50B 4PWTA 3RYHB 1GO1A 3HWUA 5CA1B 4IHJA 3ZOPA 5EYPB 2IG8A 3G71F 2DT4A 2PHNA 4NQ3A 3WGLA 3F0GA 3CCRF 1IV1A 5EIBD 3ZO8A 5CB4B 2BTOA 3LWPC 4O2AB 3GTZA 3ON1A 1JN1A 2AIZP 2ZVYA 3S0HA 1FNJA 3ELCA 3WPWA 3O85A 4U39A 1U3PA 1W55A 3CMEF 3CG6A 4O2BB 2LCAA 3IKFA 1IV3A 5FNVA 5HY0A 1NMUB 4IHJB 1VQ8F 2LBXA 5LP6A 4B5CA 2L26A 1KNKA 3GHZA 3E22A 5BMVA 4RHAA 1E7KA 2GLZA 3RYCA 1RA4A 3FBAA 1XV2A 3EORA 3IEQA 4X3LA 1KD1H 5JQGA 4DRXA 4ZHWA 5GAPK 4G4WA 3D54A 4O4LA 2PMPA 1JY8A 1TUBA 3NK7A 5EZYA 5LP6B 2UZHA 4YJ3A 1IPAA 2P6YA 3I7TA 2I6RA 3BYQA 5IYZB 4X1IA 3CCVF 1SA0A 2UYKA 4I55A 3RYCB 2AIFA 3RA6A 3I56F 3JAKA 2G9IA 3D00A 4I4TA 2I6DA
chains in the Genus database with same CATH topology
1R1MA 2ZVZA 4ERHA 2MQEA 3OONA 4G88A 3S0WA 2ZOVA 4ZHVA 2AIZP 2ZVYA 3CYQA 5EB0A 3S0HA 2HQSC 4G4ZA 3TD3A 4ZHWA 3IMPA 3KHNA 3WPWA 4G4WA 2N48A 3LDTA 1OAPA 2LCAA 3S0YA 4R40B 4B62A 3S03A 3TD5A 4PWTA 4B5CA 3S06A 2K1SA 3S02A 2L26A 2KGWA 4RHAA 4ZHYB 2LBTA 5EAZA 3TD4A 4G4VA 5EB1B 3CYPB 2W8BC 4G4YA 3WPXA 4G4XA 2ZF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1M A;  2ZVZ A;  4ERH A;  2MQE A;  3OON A;  4G88 A;  3S0W A;  2ZOV A;  4ZHV A;  2AIZ P;  2ZVY A;  3CYQ A;  5EB0 A;  3S0H A;  2HQS C;  4G4Z A;  3TD3 A;  4ZHW A;  3IMP A;  3KHN A;  3WPW A;  4G4W A;  2N48 A;  3LDT A;  1OAP A;  2LCA A;  3S0Y A;  4R40 B;  4B62 A;  3S03 A;  3TD5 A;  4PWT A;  4B5C A;  3S06 A;  2K1S A;  3S02 A;  2L26 A;  2KGW A;  4RHA A;  4ZHY B;  2LBT A;  5EAZ A;  3TD4 A;  4G4V A;  5EB1 B;  3CYP B;  2W8B C;  4G4Y A;  3WPX A;  4G4X A;  2ZF8 A; 
#chains in the Genus database with same CATH topology
 4B46 A;  1KQS F;  3OON A;  3VYU C;  2V9Y A;  1W58 1;  3KJK A;  1U43 A;  2JNB A;  3E1Y A;  3ERN A;  1M1K H;  3IMP A;  4O4L B;  3LWO C;  4C8I A;  1QVF F;  4YJ2 B;  3J80 M;  5ITZ A;  1TUB B;  3JAS A;  5EZY B;  3CPW F;  2H8C A;  4YJ3 B;  5IJ0 B;  3WGJ A;  1ODE A;  3LDT A;  4O4J A;  4X1I B;  1SA0 B;  3T80 A;  1GZ0 A;  4I55 B;  4LNU A;  5C8Y A;  5J2T A;  4BT4 A;  3JAK B;  3N2G A;  4I4T B;  2W8B C;  3FD6 A;  3VYS C;  3KE1 A;  5EWR A;  1VHA A;  3FFM A;  3M84 A;  3N4Y A;  2QA4 F;  3JVH A;  1K73 H;  5ITZ B;  3TD3 A;  3JAS B;  1RQ2 A;  1Q86 H;  5LP6 C;  4BVQ A;  4O4J B;  4RQO A;  1VQ6 F;  2OTJ F;  2ALE A;  1U40 A;  2Q1Y A;  4B62 A;  1ZWZ A;  4LNU B;  5C8Y B;  5KMG B;  5J2T B;  3CCM F;  3ZP7 A;  1ONI A;  2Z1F A;  3N2G B;  3HKB A;  3JAW B;  4X20 B;  2RHO A;  1DBF A;  5EAZ A;  3TD4 A;  4EI7 A;  2CWJ A;  2BTQ B;  1VQ4 F;  4BT2 A;  5IT9 M;  4BT5 A;  2AMT A;  3CC7 F;  1COM A;  3K2X A;  1IV4 A;  3B6N A;  5KX5 A;  3IR9 A;  1K9M H;  3MCQ A;  2IQQ A;  3MCA B;  3P4E A;  3UT5 A;  2Z1E A;  3HKB B;  3DC2 A;  2Z01 A;  3JAR B;  3KIZ A;  1M90 H;  1Q7Y H;  1YI2 F;  5HY4 A;  1W41 A;  4G4V A;  3CCJ F;  4X1K B;  2HP0 A;  4IIJ A;  5LYJ A;  2OTL F;  5B8F A;  3FD5 A;  2HRU A;  5LXT A;  2FGY A;  5JVD A;  3MDO A;  5KX5 B;  2KTV A;  1VQL F;  1VH8 A;  3V4D A;  1W5E A;  3UT5 B;  1T0A A;  5IJ9 A;  2F9Z C;  4EB6 A;  3CMA F;  4O4H B;  1RQ7 A;  4U3J A;  5G4U C;  3JAM M;  3ZP4 A;  1VQ5 F;  4IIJ B;  4C4W C;  1YJN F;  2UYN A;  5FLX M;  3IEW A;  4G4X A;  3I3F A;  5LXT B;  1R1M A;  1GO0 A;  2LBW A;  3V7Q A;  3Q8H A;  2HX0 A;  1KC8 H;  3SIV A;  1XBI A;  5GIN C;  5IJ9 B;  4EB6 B;  3GYQ A;  3LYB A;  3CCQ F;  3ESJ A;  4U3J B;  3VTI C;  5FNV B;  1YJW F;  1JD1 A;  3CB2 A;  3CD6 F;  3QHD A;  1UFY A;  4O4I A;  3PLA C;  3S06 A;  1NJI H;  3E22 B;  4TV9 A;  5BMV B;  2OTM A;  2ZAU A;  3LFO A;  2UYN B;  3J7A R;  1XHO A;  2QI2 A;  3WJQ A;  5EB1 B;  1X7P A;  3CYP B;  2HS0 A;  3F0F A;  1W5B A;  2OHW A;  2Z1T A;  4EI8 A;  1VQO F;  5G4V C;  4G88 A;  5JQG B;  4BW0 B;  4DRX B;  5EB0 A;  1PXW A;  3QUW A;  3KHN A;  3E20 B;  4C81 A;  3IKE A;  3D01 A;  3RYF A;  2N48 A;  2UYJ A;  5HY2 A;  1SZQ A;  2FC3 A;  3F6M A;  3S03 A;  4TV9 B;  2K1S A;  3S02 A;  1JJ2 F;  1QVG F;  1W42 A;  1RLU A;  3J81 M;  1K8A H;  3N2K A;  5EO3 A;  5HWE A;  2H8E A;  1SDS A;  4G4Y A;  5HP8 A;  3NMU C;  5J2U A;  1KNJ A;  1W3E X;  3M1X A;  1DT9 A;  4TZZ A;  2MQE A;  1X25 A;  5DCV A;  2RB9 A;  2ZOV A;  3CYQ A;  4ZHQ A;  4EI9 A;  1N8R H;  1W57 A;  3WGK A;  4C8G A;  3CXC F;  5MN5 A;  1VQV A;  3C9S A;  3CCE F;  4BVT A;  2VAW A;  4R40 B;  1YQN A;  3OW2 F;  3N2K B;  3HJW C;  1W5A A;  1QD9 A;  2BO1 A;  5LA6 A;  4HNA A;  4BT6 A;  4ZI7 A;  4C8E A;  3CCU F;  3P0Z A;  4TUY A;  3WPX A;  1VQK F;  2CHT A;  1S72 F;  1IV2 A;  4ZHQ B;  3S0W A;  3VOB A;  3KJJ A;  3U0O A;  3JCM M;  3LME A;  2GVI A;  2RHL A;  5EIB C;  3JAL A;  3LWR C;  2UYP A;  1YJ9 F;  1X52 A;  3CC4 F;  5HXZ A;  3NVI B;  3NVK E;  5JCO A;  1CLI A;  2IAF A;  4I50 A;  3HTN A;  4HNA B;  5LA6 B;  5JH7 A;  3M4S A;  1Z5V A;  4TUY B;  1FNK A;  2LBT A;  5A2Q M;  3CCL F;  2Q1X A;  4BY9 D;  3MQW A;  3CPQ A;  2CSL A;  4TV8 A;  4ERH A;  2HVY D;  4E6E A;  3CCS F;  2Z1U A;  4C82 A;  1VK3 A;  3C8L A;  3WJP A;  3C9T A;  1W40 A;  1YHQ F;  3LWQ C;  2RHJ A;  5HXU A;  3S0Y A;  1QU9 A;  5JH7 B;  3MBM A;  4NWO B;  3VMF B;  3K12 A;  1W2B F;  3HKD A;  2HP0 B;  3P10 A;  5LYJ B;  1H47 A;  4TV8 B;  1NQ3 A;  2CZW A;  2ZVZ A;  1X7O A;  3PAF A;  1Z5W A;  5JVD B;  3VYT C;  1W5F A;  2HP3 A;  4KWE A;  4X3M A;  3F0D A;  3VOA A;  1J7H A;  2RHH A;  2NMU A;  2HS4 A;  2ZOD A;  1JFF A;  3NK6 A;  4M8I A;  1OAP A;  2R75 1;  3AGK A;  4NUT A;  3VIU A;  5GIP C;  1QAH A;  3HKE A;  3HKD B;  5IYZ A;  2HS3 A;  4WBN A;  3V7E A;  4ZHY B;  3CC2 F;  3K14 A;  1H7M A;  2QTP A;  4BVS A;  1Q8R A;  3DDN A;  4BT7 A;  5AVM A;  3RA5 A;  2WAL A;  5LOV A;  1YIT F;  3C9U A;  2OZB A;  2KG4 A;  4G4Z A;  1JFF B;  1Q81 H;  2GZL A;  5JCO C;  5MN6 A;  4YJ2 A;  3HKE B;  5MN4 A;  5IJ0 A;  3FPI A;  4O4I B;  1GX1 A;  1XRG A;  4F6R A;  3HAX D;  4WBN B;  2KGW A;  3VI6 A;  3RYI A;  3WGN A;  1YIJ F;  3OBY A;  1CN7 A;  1FSZ A;  2DYY A;  3WGM A;  5LOV B;  3VO8 A;  5HY1 A;  3G4S F;  2B33 A;  3JAT A;  2KTU A;  3RYF B;  3V3T A;  4BVR A;  4ZK7 A;  1VQ9 F;  1U3L A;  3VCZ A;  2BTU A;  5FJ4 C;  4F6R B;  4FFB A;  3TD5 A;  5KMG A;  1PF5 A;  3RYI B;  3K0T A;  2VGM A;  1H48 A;  1YGY A;  4ZOL A;  3JAW A;  4X20 A;  1OFU A;  2CHS A;  2HRY A;  4DXD A;  1UI9 A;  1VQM F;  5J2U B;  5GON A;  2QEX F;  2YYE A;  3I55 F;  3QTY A;  3R0P A;  2CVL A;  2VXY A;  4B45 A;  3RE3 A;  1W59 A;  3JAT B;  4ZHV A;  4LCK A;  4XCQ A;  5CA0 A;  1Q82 H;  3HKC A;  1TVK A;  4X1Y A;  1FFX A;  1VQ7 F;  4FFB B;  3N4Z A;  1VQN F;  3L7Q A;  5GIO C;  2YXZ A;  2CW4 A;  4ZOL B;  4BT3 A;  3OBW A;  3JAR A;  1RLG A;  3RYH A;  4ZI7 B;  5GON B;  5CA1 A;  1VQP F;  5EYP A;  4X1K A;  1T0K B;  2ZF8 A;  2VAM A;  2VGN A;  3WXM B;  5CA0 B;  1CK2 A;  5GAN K;  5CB4 A;  5HP7 A;  4O2A A;  3HKC B;  1TVK B;  2HQS C;  4X1Y B;  2R6R 1;  2VAP A;  2EWC A;  2H6L A;  3G6E F;  1FFX B;  3F0E A;  3LWV C;  3JAL B;  3WJR A;  3SIU A;  3C9R A;  4O4H A;  4O2B A;  4I50 B;  4PWT A;  3RYH B;  1GO1 A;  3HWU A;  5CA1 B;  4IHJ A;  3ZOP A;  5EYP B;  2IG8 A;  3G71 F;  2DT4 A;  2PHN A;  4NQ3 A;  3WGL A;  3F0G A;  3CCR F;  1IV1 A;  5EIB D;  3ZO8 A;  5CB4 B;  2BTO A;  3LWP C;  4O2A B;  3GTZ A;  3ON1 A;  1JN1 A;  2AIZ P;  2ZVY A;  3S0H A;  1FNJ A;  3ELC A;  3WPW A;  3O85 A;  4U39 A;  1U3P A;  1W55 A;  3CME F;  3CG6 A;  4O2B B;  2LCA A;  3IKF A;  1IV3 A;  5FNV A;  5HY0 A;  1NMU B;  4IHJ B;  1VQ8 F;  2LBX A;  5LP6 A;  4B5C A;  2L26 A;  1KNK A;  3GHZ A;  3E22 A;  5BMV A;  4RHA A;  1E7K A;  2GLZ A;  3RYC A;  1RA4 A;  3FBA A;  1XV2 A;  3EOR A;  3IEQ A;  4X3L A;  1KD1 H;  5JQG A;  4DRX A;  4ZHW A;  5GAP K;  4G4W A;  3D54 A;  4O4L A;  2PMP A;  1JY8 A;  1TUB A;  3NK7 A;  5EZY A;  5LP6 B;  2UZH A;  4YJ3 A;  1IPA A;  2P6Y A;  3I7T A;  2I6R A;  3BYQ A;  5IYZ B;  4X1I A;  3CCV F;  1SA0 A;  2UYK A;  4I55 A;  3RYC B;  2AIF A;  3RA6 A;  3I56 F;  3JAK A;  2G9I A;  3D00 A;  4I4T A;  2I6D A; 
#chains in the Genus database with same CATH homology
 1R1M A;  2ZVZ A;  4ERH A;  2MQE A;  3OON A;  4G88 A;  3S0W A;  2ZOV A;  4ZHV A;  2AIZ P;  2ZVY A;  3CYQ A;  5EB0 A;  3S0H A;  2HQS C;  4G4Z A;  3TD3 A;  4ZHW A;  3IMP A;  3KHN A;  3WPW A;  4G4W A;  2N48 A;  3LDT A;  1OAP A;  2LCA A;  3S0Y A;  4R40 B;  4B62 A;  3S03 A;  3TD5 A;  4PWT A;  4B5C A;  3S06 A;  2K1S A;  3S02 A;  2L26 A;  2KGW A;  4RHA A;  4ZHY B;  2LBT A;  5EAZ A;  3TD4 A;  4G4V A;  5EB1 B;  3CYP B;  2W8B C;  4G4Y A;  3WPX A;  4G4X A;  2ZF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...