4RHAA

Structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
131
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
publication title Structure of the C-terminal domain of outer-membrane protein OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
total genus 39
structure length 131
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4rhaA00
5EAZA 3TD4A 4G4ZA 4G4VA 4R40B 4ERHA 5EB0A 3IMPA 4RHAA 3S0HA 3TD3A 2KGWA 3CYPB 3TD5A 2AIZP 4ZHVA 3S03A 5EB1B 3S06A 2ZVYA 4G88A 2L26A 4G4WA 3WPXA 4B5CA 3S0WA 3KHNA 3S02A 3CYQA 1OAPA 4ZHYB 2ZVZA 4G4YA 4PWTA 1R1MA 2LCAA 2W8BC 4ZHWA 2K1SA 3LDTA 2LBTA 3S0YA 3OONA 2ZF8A 2N48A 4B62A 2MQEA 2ZOVA 2HQSC 4G4XA 3WPWA
chains in the Genus database with same CATH superfamily
2CW4A 4B45A 5CB4A 2VAWA 3F0GA 3CXCF 3S0HA 4C8GA 1N8RH 3CYPB 1VQMF 3N2GB 3D01A 2UYNA 5IJ9A 4O4JB 3VYUC 3S0WA 4XCQA 5CA0A 5HP8A 2Q1YA 3CG6A 3FFMA 1JJ2F 3KJJA 1VHAA 4B62A 2MQEA 3LWOC 2Z1EA 3VIUA 2V9YA 3RYFB 4O4LA 3OW2F 1COMA 4WBNB 3N2KA 5IJ0A 1XHOA 3CB2A 3NK6A 3VYTC 1CK2A 4NWOB 1YITF 1FFXB 2F9ZC 2KG4A 1YJWF 3CCRF 3K14A 1KC8H 5IYZB 2KTUA 5MN5A 5HP7A 4ZHYB 2HRYA 1JD1A 5EZYB 4BT3A 2LCAA 4IHJB 3WJRA 2CZWA 2UYJA 4U3JA 4I4TA 2OHWA 3F6MA 4EI9A 4G4ZA 3CPQA 5KX5B 5EIBD 4DXDA 1XRGA 3WGKA 2ZODA 5MN6A 3CC2F 3E22A 3UT5B 4TUYB 3S03A 1YIJF 3SIUA 2HP3A 5LP6B 3DDNA 1YJNF 2HS3A 1XBIA 3C9TA 4BVSA 4ZOLA 3BYQA 4ZHQB 2QA4F 2RB9A 4LCKA 1T0AA 5JVDB 2VGMA 5EYPB 5J2TA 1VQ7F 4BT6A 2GZLA 2ZOVA 4FFBA 4G4VA 5BMVA 1W59A 3JALA 3LFOA 3N4ZA 5LXTA 3RYCB 1U3LA 1VQPF 3IEWA 1W57A 3HAXD 1SZQA 4C81A 1PF5A 1W5BA 3K0TA 1PXWA 1W5FA 1W2BF 4O4LB 3JARA 4DRXA 3CYQA 3N2KB 3P4EA 1K73H 2YYEA 4BVRA 5IT9M 3RE3A 3HTNA 1ODEA 3WPWA 4YJ2A 5EAZA 4O4IA 1ZWZA 2CHSA 3JAWA 2PHNA 1Q81H 1RQ7A 4TZZA 4ZI7B 2HX0A 3HJWC 5G4VC 3LMEA 1VH8A 5A2QM 2BTUA 1VQLF 2CSLA 1Q86H 2CVLA 5J2UB 5C8YB 3PAFA 3NVKE 4O2AB 3PLAC 3NMUC 5ITZA 3E22B 5LYJB 1W3EX 1TVKB 3JAKA 4X1YB 3HKBB 4X3MA 1U3PA 1JFFB 4RHAA 5JQGA 3KIZA 4EB6A 3IKEA 4KWEA 3HKDA 3V7QA 5KMGA 1S72F 1UFYA 4ZHVA 2HVYD 1T0KB 4YJ3B 4X1KB 1NQ3A 4RQOA 2IQQA 5BMVB 1RLGA 4X20A 3CCLF 5HY1A 2RHJA 1JY8A 4HNAB 3C9SA 2B33A 1W5EA 3CCUF 4BT2A 4C82A 3JCMM 1K9MH 4G4XA 1DT9A 3ZP7A 3JASB 5HXZA 5DCVA 3JVHA 1ONIA 3JATB 2UYKA 1SA0B 4X1IA 5JH7B 3I55F 3HKCA 3TD5A 1VQVA 1H47A 5FJ4C 3RYHB 4I55B 4TV8A 3JAMM 2ZVYA 4YJ2B 1YJ9F 2HP0B 5GONB 3R0PA 1W41A 3AGKA 3RYIB 5FNVB 3WJPA 3O85A 1UI9A 1VQOF 3LWRC 3E1YA 2LBXA 4G4YA 4PWTA 1R1MA 3F0EA 2CHTA 3EORA 1KNJA 5EIBC 2I6RA 3VO8A 2GLZA 2EWCA 4C8IA 3ZO8A 5LA6B 5LP6C 3CCSF 1QU9A 3MCAB 2KGWA 1TUBB 2VGNA 5HY4A 3WGJA 3JAKB 3F0DA 4G88A 1W42A 1RLUA 5CB4B 1OAPA 1RA4A 1VQ4F 1VQ8F 3K2XA 1QD9A 4O2BA 2UYNB 5IJ9B 1NJIH 2CWJA 2N48A 3D00A 5CA0B 1VK3A 5LOVA 3TD4A 4R40B 3WGLA 3CCVF 1Q7YH 1Z5VA 2ALEA 3VYSC 3LYBA 5CA1A 1IV1A 3HWUA 3QTYA 3MCQA 5EWRA 1J7HA 4X3LA 2H6LA 3MBMA 1YHQF 3IR9A 3Q8HA 4BT4A 4O4HA 3CC7F 3F0FA 3N4YA 5IJ0B 2GVIA 3MDOA 1YGYA 3ERNA 1CN7A 3VOAA 2LBWA 3N2GA 3OONA 4BY9D 4O4JA 3C9UA 2Q1XA 2NMUA 1VQKF 4ERHA 3ESJA 3MQWA 4C4WC 1VQ5F 4IIJA 5EO3A 4U3JB 4I4TB 3NVIB 3CCEF 2BTOA 3B6NA 1XV2A 4LNUA 3FD6A 2FC3A 5JCOA 1VQ6F 1QVGF 2ZVZA 3RYFA 3LWVC 1Q82H 2I6DA 3WJQA 4WBNA 5GIPC 3V7EA 4ZHWA 3GHZA 2LBTA 1IPAA 1KNKA 1Z5WA 1FFXA 3P0ZA 4ZOLB 1FNJA 5HXUA 5GANK 5IYZA 2KTVA 3WXMB 2IG8A 3E20B 1M90H 3J81M 3ELCA 2AIZP 3M84A 1X7PA 5EZYA 1GO0A 4IHJA 2R6R1 5EB1B 5HWEA 5J2TB 1E7KA 4NUTA 3S06A 4FFBB 4BVTA 4EI7A 1X52A 3KHNA 5GIOC 3JALB 5LXTB 2UZHA 2R751 5KX5A 3T80A 5JCOC 3UT5A 2H8CA 4BVQA 2IAFA 2BTQB 3QHDA 5LP6A 2YXZA 2FGYA 3JARB 3ZP4A 4DRXB 3QUWA 3I56F 1QVFF 2QI2A 1DBFA 4ZHQA 3TD3A 5B8FA 1IV2A 2QTPA 5JVDA 2UYPA 2OZBA 5EYPA 3D54A 3I7TA 4TV9A 1H48A 4G4WA 4B5CA 1KQSF 1X25A 4O4IB 3S02A 1NMUB 1SDSA 3JAWB 3GYQA 1W581 4IIJB 4BT5A 3CCQF 5AVMA 3NK7A 3RYCA 2W8BC 2PMPA 1X7OA 1OFUA 2K1SA 4LNUB 3VCZA 5GAPK 2Z1TA 3M1XA 2ZAUA 5ITZB 5G4UC 3KJKA 1IV3A 1RQ2A 4M8IA 4F6RA 3FPIA 3M4SA 3CMEF 1YQNA 1K8AH 3HKEA 2WALA 1GZ0A 3VTIC 5HY2A 2P6YA 5JQGB 1QAHA 4EB6B 2HS4A 3HKDB 3VOBA 2OTLF 5KMGB 3CCJF 4NQ3A 4ZI7A 5MN4A 2AMTA 3C9RA 1CLIA 3RA5A 3DC2A 3WGNA 5HY0A 4X20B 2DYYA 2HQSC 3VMFB 5J2UA 5C8YA 3G4SF 4O2AA 3IMPA 4BW0B 5LYJA 1VQNF 4ZK7A 2Z1FA 1TVKA 4I50A 3IKFA 4X1YA 3IEQA 3HKBA 3SIVA 1KD1H 3OBYA 4X1IB 3G6EF 3HKCB 1JFFA 1FSZA 4TV9B 4TV8B 3LDTA 1W40A 2JNBA 4B46A 2OTJF 4YJ3A 4X1KA 4E6EA 1IV4A 2AIFA 3FD5A 3CC4F 3U0OA 3J80M 3WGMA 2RHLA 4HNAA 2VXYA 2H8EA 3K12A 1JN1A 1FNKA 4EI8A 2L26A 3VI6A 3WPXA 3G71F 5GINC 2RHOA 3GTZA 3CMAF 2VAMA 1W5AA 3JASA 4F6RB 3RA6A 3CCMF 1VQ9F 1H7MA 3ZOPA 3JATA 4BT7A 1SA0A 2HRUA 3HKEB 5JH7A 1U40A 3L7QA 4I55A 3RYHA 3LWPC 3CPWF 2G9IA 2OTMA 2BO1A 3C8LA 2HP0A 5GONA 1U43A 3RYIA 5EB0A 1Q8RA 5FNVA 1W55A 4O2BB 3I3FA 3V4DA 4C8EA 1YI2F 1GO1A 2VAPA 5LOVB 3J7AR 5FLXM 1GX1A 3OBWA 2HS0A 3KE1A 3CD6F 3LWQC 3FBAA 3ON1A 4U39A 5CA1B 5LA6A 2QEXF 2Z01A 2DT4A 2RHHA 1M1KH 1TUBA 3S0YA 4I50B 2Z1UA 2ZF8A 4TUYA 3V3TA 4O4HB 3P10A
chains in the Genus database with same CATH topology
5EAZA 3TD4A 4G4ZA 4G4VA 4R40B 4ERHA 5EB0A 3IMPA 4RHAA 3S0HA 3TD3A 2KGWA 3CYPB 3TD5A 2AIZP 4ZHVA 3S03A 5EB1B 3S06A 2ZVYA 4G88A 2L26A 4G4WA 3WPXA 4B5CA 3S0WA 3KHNA 3S02A 3CYQA 1OAPA 4ZHYB 2ZVZA 4G4YA 4PWTA 1R1MA 2LCAA 2W8BC 4ZHWA 2K1SA 3LDTA 2LBTA 3S0YA 3OONA 2ZF8A 2N48A 4B62A 2MQEA 2ZOVA 2HQSC 4G4XA 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAZ A;  3TD4 A;  4G4Z A;  4G4V A;  4R40 B;  4ERH A;  5EB0 A;  3IMP A;  4RHA A;  3S0H A;  3TD3 A;  2KGW A;  3CYP B;  3TD5 A;  2AIZ P;  4ZHV A;  3S03 A;  5EB1 B;  3S06 A;  2ZVY A;  4G88 A;  2L26 A;  4G4W A;  3WPX A;  4B5C A;  3S0W A;  3KHN A;  3S02 A;  3CYQ A;  1OAP A;  4ZHY B;  2ZVZ A;  4G4Y A;  4PWT A;  1R1M A;  2LCA A;  2W8B C;  4ZHW A;  2K1S A;  3LDT A;  2LBT A;  3S0Y A;  3OON A;  2ZF8 A;  2N48 A;  4B62 A;  2MQE A;  2ZOV A;  2HQS C;  4G4X A;  3WPW A; 
#chains in the Genus database with same CATH topology
 2CW4 A;  4B45 A;  5CB4 A;  2VAW A;  3F0G A;  3CXC F;  3S0H A;  4C8G A;  1N8R H;  3CYP B;  1VQM F;  3N2G B;  3D01 A;  2UYN A;  5IJ9 A;  4O4J B;  3VYU C;  3S0W A;  4XCQ A;  5CA0 A;  5HP8 A;  2Q1Y A;  3CG6 A;  3FFM A;  1JJ2 F;  3KJJ A;  1VHA A;  4B62 A;  2MQE A;  3LWO C;  2Z1E A;  3VIU A;  2V9Y A;  3RYF B;  4O4L A;  3OW2 F;  1COM A;  4WBN B;  3N2K A;  5IJ0 A;  1XHO A;  3CB2 A;  3NK6 A;  3VYT C;  1CK2 A;  4NWO B;  1YIT F;  1FFX B;  2F9Z C;  2KG4 A;  1YJW F;  3CCR F;  3K14 A;  1KC8 H;  5IYZ B;  2KTU A;  5MN5 A;  5HP7 A;  4ZHY B;  2HRY A;  1JD1 A;  5EZY B;  4BT3 A;  2LCA A;  4IHJ B;  3WJR A;  2CZW A;  2UYJ A;  4U3J A;  4I4T A;  2OHW A;  3F6M A;  4EI9 A;  4G4Z A;  3CPQ A;  5KX5 B;  5EIB D;  4DXD A;  1XRG A;  3WGK A;  2ZOD A;  5MN6 A;  3CC2 F;  3E22 A;  3UT5 B;  4TUY B;  3S03 A;  1YIJ F;  3SIU A;  2HP3 A;  5LP6 B;  3DDN A;  1YJN F;  2HS3 A;  1XBI A;  3C9T A;  4BVS A;  4ZOL A;  3BYQ A;  4ZHQ B;  2QA4 F;  2RB9 A;  4LCK A;  1T0A A;  5JVD B;  2VGM A;  5EYP B;  5J2T A;  1VQ7 F;  4BT6 A;  2GZL A;  2ZOV A;  4FFB A;  4G4V A;  5BMV A;  1W59 A;  3JAL A;  3LFO A;  3N4Z A;  5LXT A;  3RYC B;  1U3L A;  1VQP F;  3IEW A;  1W57 A;  3HAX D;  1SZQ A;  4C81 A;  1PF5 A;  1W5B A;  3K0T A;  1PXW A;  1W5F A;  1W2B F;  4O4L B;  3JAR A;  4DRX A;  3CYQ A;  3N2K B;  3P4E A;  1K73 H;  2YYE A;  4BVR A;  5IT9 M;  3RE3 A;  3HTN A;  1ODE A;  3WPW A;  4YJ2 A;  5EAZ A;  4O4I A;  1ZWZ A;  2CHS A;  3JAW A;  2PHN A;  1Q81 H;  1RQ7 A;  4TZZ A;  4ZI7 B;  2HX0 A;  3HJW C;  5G4V C;  3LME A;  1VH8 A;  5A2Q M;  2BTU A;  1VQL F;  2CSL A;  1Q86 H;  2CVL A;  5J2U B;  5C8Y B;  3PAF A;  3NVK E;  4O2A B;  3PLA C;  3NMU C;  5ITZ A;  3E22 B;  5LYJ B;  1W3E X;  1TVK B;  3JAK A;  4X1Y B;  3HKB B;  4X3M A;  1U3P A;  1JFF B;  4RHA A;  5JQG A;  3KIZ A;  4EB6 A;  3IKE A;  4KWE A;  3HKD A;  3V7Q A;  5KMG A;  1S72 F;  1UFY A;  4ZHV A;  2HVY D;  1T0K B;  4YJ3 B;  4X1K B;  1NQ3 A;  4RQO A;  2IQQ A;  5BMV B;  1RLG A;  4X20 A;  3CCL F;  5HY1 A;  2RHJ A;  1JY8 A;  4HNA B;  3C9S A;  2B33 A;  1W5E A;  3CCU F;  4BT2 A;  4C82 A;  3JCM M;  1K9M H;  4G4X A;  1DT9 A;  3ZP7 A;  3JAS B;  5HXZ A;  5DCV A;  3JVH A;  1ONI A;  3JAT B;  2UYK A;  1SA0 B;  4X1I A;  5JH7 B;  3I55 F;  3HKC A;  3TD5 A;  1VQV A;  1H47 A;  5FJ4 C;  3RYH B;  4I55 B;  4TV8 A;  3JAM M;  2ZVY A;  4YJ2 B;  1YJ9 F;  2HP0 B;  5GON B;  3R0P A;  1W41 A;  3AGK A;  3RYI B;  5FNV B;  3WJP A;  3O85 A;  1UI9 A;  1VQO F;  3LWR C;  3E1Y A;  2LBX A;  4G4Y A;  4PWT A;  1R1M A;  3F0E A;  2CHT A;  3EOR A;  1KNJ A;  5EIB C;  2I6R A;  3VO8 A;  2GLZ A;  2EWC A;  4C8I A;  3ZO8 A;  5LA6 B;  5LP6 C;  3CCS F;  1QU9 A;  3MCA B;  2KGW A;  1TUB B;  2VGN A;  5HY4 A;  3WGJ A;  3JAK B;  3F0D A;  4G88 A;  1W42 A;  1RLU A;  5CB4 B;  1OAP A;  1RA4 A;  1VQ4 F;  1VQ8 F;  3K2X A;  1QD9 A;  4O2B A;  2UYN B;  5IJ9 B;  1NJI H;  2CWJ A;  2N48 A;  3D00 A;  5CA0 B;  1VK3 A;  5LOV A;  3TD4 A;  4R40 B;  3WGL A;  3CCV F;  1Q7Y H;  1Z5V A;  2ALE A;  3VYS C;  3LYB A;  5CA1 A;  1IV1 A;  3HWU A;  3QTY A;  3MCQ A;  5EWR A;  1J7H A;  4X3L A;  2H6L A;  3MBM A;  1YHQ F;  3IR9 A;  3Q8H A;  4BT4 A;  4O4H A;  3CC7 F;  3F0F A;  3N4Y A;  5IJ0 B;  2GVI A;  3MDO A;  1YGY A;  3ERN A;  1CN7 A;  3VOA A;  2LBW A;  3N2G A;  3OON A;  4BY9 D;  4O4J A;  3C9U A;  2Q1X A;  2NMU A;  1VQK F;  4ERH A;  3ESJ A;  3MQW A;  4C4W C;  1VQ5 F;  4IIJ A;  5EO3 A;  4U3J B;  4I4T B;  3NVI B;  3CCE F;  2BTO A;  3B6N A;  1XV2 A;  4LNU A;  3FD6 A;  2FC3 A;  5JCO A;  1VQ6 F;  1QVG F;  2ZVZ A;  3RYF A;  3LWV C;  1Q82 H;  2I6D A;  3WJQ A;  4WBN A;  5GIP C;  3V7E A;  4ZHW A;  3GHZ A;  2LBT A;  1IPA A;  1KNK A;  1Z5W A;  1FFX A;  3P0Z A;  4ZOL B;  1FNJ A;  5HXU A;  5GAN K;  5IYZ A;  2KTV A;  3WXM B;  2IG8 A;  3E20 B;  1M90 H;  3J81 M;  3ELC A;  2AIZ P;  3M84 A;  1X7P A;  5EZY A;  1GO0 A;  4IHJ A;  2R6R 1;  5EB1 B;  5HWE A;  5J2T B;  1E7K A;  4NUT A;  3S06 A;  4FFB B;  4BVT A;  4EI7 A;  1X52 A;  3KHN A;  5GIO C;  3JAL B;  5LXT B;  2UZH A;  2R75 1;  5KX5 A;  3T80 A;  5JCO C;  3UT5 A;  2H8C A;  4BVQ A;  2IAF A;  2BTQ B;  3QHD A;  5LP6 A;  2YXZ A;  2FGY A;  3JAR B;  3ZP4 A;  4DRX B;  3QUW A;  3I56 F;  1QVF F;  2QI2 A;  1DBF A;  4ZHQ A;  3TD3 A;  5B8F A;  1IV2 A;  2QTP A;  5JVD A;  2UYP A;  2OZB A;  5EYP A;  3D54 A;  3I7T A;  4TV9 A;  1H48 A;  4G4W A;  4B5C A;  1KQS F;  1X25 A;  4O4I B;  3S02 A;  1NMU B;  1SDS A;  3JAW B;  3GYQ A;  1W58 1;  4IIJ B;  4BT5 A;  3CCQ F;  5AVM A;  3NK7 A;  3RYC A;  2W8B C;  2PMP A;  1X7O A;  1OFU A;  2K1S A;  4LNU B;  3VCZ A;  5GAP K;  2Z1T A;  3M1X A;  2ZAU A;  5ITZ B;  5G4U C;  3KJK A;  1IV3 A;  1RQ2 A;  4M8I A;  4F6R A;  3FPI A;  3M4S A;  3CME F;  1YQN A;  1K8A H;  3HKE A;  2WAL A;  1GZ0 A;  3VTI C;  5HY2 A;  2P6Y A;  5JQG B;  1QAH A;  4EB6 B;  2HS4 A;  3HKD B;  3VOB A;  2OTL F;  5KMG B;  3CCJ F;  4NQ3 A;  4ZI7 A;  5MN4 A;  2AMT A;  3C9R A;  1CLI A;  3RA5 A;  3DC2 A;  3WGN A;  5HY0 A;  4X20 B;  2DYY A;  2HQS C;  3VMF B;  5J2U A;  5C8Y A;  3G4S F;  4O2A A;  3IMP A;  4BW0 B;  5LYJ A;  1VQN F;  4ZK7 A;  2Z1F A;  1TVK A;  4I50 A;  3IKF A;  4X1Y A;  3IEQ A;  3HKB A;  3SIV A;  1KD1 H;  3OBY A;  4X1I B;  3G6E F;  3HKC B;  1JFF A;  1FSZ A;  4TV9 B;  4TV8 B;  3LDT A;  1W40 A;  2JNB A;  4B46 A;  2OTJ F;  4YJ3 A;  4X1K A;  4E6E A;  1IV4 A;  2AIF A;  3FD5 A;  3CC4 F;  3U0O A;  3J80 M;  3WGM A;  2RHL A;  4HNA A;  2VXY A;  2H8E A;  3K12 A;  1JN1 A;  1FNK A;  4EI8 A;  2L26 A;  3VI6 A;  3WPX A;  3G71 F;  5GIN C;  2RHO A;  3GTZ A;  3CMA F;  2VAM A;  1W5A A;  3JAS A;  4F6R B;  3RA6 A;  3CCM F;  1VQ9 F;  1H7M A;  3ZOP A;  3JAT A;  4BT7 A;  1SA0 A;  2HRU A;  3HKE B;  5JH7 A;  1U40 A;  3L7Q A;  4I55 A;  3RYH A;  3LWP C;  3CPW F;  2G9I A;  2OTM A;  2BO1 A;  3C8L A;  2HP0 A;  5GON A;  1U43 A;  3RYI A;  5EB0 A;  1Q8R A;  5FNV A;  1W55 A;  4O2B B;  3I3F A;  3V4D A;  4C8E A;  1YI2 F;  1GO1 A;  2VAP A;  5LOV B;  3J7A R;  5FLX M;  1GX1 A;  3OBW A;  2HS0 A;  3KE1 A;  3CD6 F;  3LWQ C;  3FBA A;  3ON1 A;  4U39 A;  5CA1 B;  5LA6 A;  2QEX F;  2Z01 A;  2DT4 A;  2RHH A;  1M1K H;  1TUB A;  3S0Y A;  4I50 B;  2Z1U A;  2ZF8 A;  4TUY A;  3V3T A;  4O4H B;  3P10 A; 
#chains in the Genus database with same CATH homology
 5EAZ A;  3TD4 A;  4G4Z A;  4G4V A;  4R40 B;  4ERH A;  5EB0 A;  3IMP A;  4RHA A;  3S0H A;  3TD3 A;  2KGW A;  3CYP B;  3TD5 A;  2AIZ P;  4ZHV A;  3S03 A;  5EB1 B;  3S06 A;  2ZVY A;  4G88 A;  2L26 A;  4G4W A;  3WPX A;  4B5C A;  3S0W A;  3KHN A;  3S02 A;  3CYQ A;  1OAP A;  4ZHY B;  2ZVZ A;  4G4Y A;  4PWT A;  1R1M A;  2LCA A;  2W8B C;  4ZHW A;  2K1S A;  3LDT A;  2LBT A;  3S0Y A;  3OON A;  2ZF8 A;  2N48 A;  4B62 A;  2MQE A;  2ZOV A;  2HQS C;  4G4X A;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...