4RHAA

Structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
131
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of outer-membrane protein OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 39
structure length 131
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4rhaA00
4G4XA 3S0YA 3TD3A 1R1MA 2W8BC 4R40B 4B62A 2ZOVA 2ZF8A 2N48A 4ZHVA 3CYPB 2HQSC 4PWTA 5EB1B 3S06A 3OONA 4G4YA 3TD5A 2MQEA 3WPWA 5EAZA 2LBTA 4RHAA 4ZHWA 3S0WA 3LDTA 3CYQA 4B5CA 2K1SA 3S02A 3KHNA 4ZHYB 3IMPA 4G4VA 2LCAA 1OAPA 2ZVZA 2KGWA 3TD4A 3S0HA 5EB0A 4G88A 4G4WA 2ZVYA 3WPXA 4G4ZA 2AIZP 2L26A 4ERHA 3S03A
chains in the Genus database with same CATH superfamily
1H48A 3P4EA 4YJ2B 3CCJF 2VAWA 4U3JB 3NMUC 3E20B 3CMEF 1KQSF 1Z5VA 4BVRA 5JH7A 1VQ5F 3VI6A 2CHTA 1FNKA 2K1SA 3F0DA 1YJWF 3B6NA 4I4TA 1UI9A 1W5EA 5J2UA 2Z1UA 1M90H 4O4HA 2VXYA 3JAWA 1VH8A 5IYZB 4X1YA 2HVYD 2HRYA 3CCUF 5J2TB 3CCLF 5EO3A 4LNUB 2UYPA 5G4UC 1YITF 1GO0A 3GTZA 4YJ3B 1T0KB 4O4LB 4X20A 2LBTA 4RHAA 3S0WA 3RYIB 3S02A 3IKFA 3I55F 3HKEA 3Q8HA 5HP7A 4G4VA 3CCVF 3V7EA 4X1KB 3D00A 1JY8A 3T80A 3VYTC 1VQOF 3CG6A 3JASA 3HKCB 3N2GA 2GZLA 1FNJA 2IG8A 4E6EA 4G4XA 3P10A 1ZWZA 5LP6C 1S72F 1KNJA 5KMGB 2ZF8A 4WBNB 5MN4A 4LCKA 2HP0B 2CW4A 3BYQA 1W41A 2MQEA 4NUTA 4IHJA 4BVTA 2Q1XA 1W40A 2CWJA 1KD1H 1OFUA 5HWEA 1Q81H 1VQVA 5LXTA 1J7HA 4NQ3A 2QTPA 2DT4A 3EORA 1XBIA 2KG4A 5LOVA 1ONIA 3RYHA 3CMAF 5CA0B 1YIJF 5FLXM 3J80M 4TV9B 3M84A 3RYFB 4R40B 2ZOVA 4U39A 1RA4A 4TUYB 5CA1A 1W2BF 3OONA 1QVGF 2OHWA 5EYPA 2KTVA 3RE3A 3L7QA 3VO8A 3HAXD 5JQGA 3KHNA 2WALA 3HKBA 1VK3A 2HS3A 5KMGA 1Q8RA 1DBFA 2H8EA 1OAPA 2RHOA 3WGNA 5JVDB 1FFXA 3JATA 4O2AA 3LWVC 3P0ZA 2LBWA 5HY0A 4ZI7B 1YHQF 3VIUA 4BVSA 3CC7F 2CHSA 3KIZA 5IJ9B 5LOVB 1JN1A 3MQWA 3LFOA 5A2QM 1XV2A 4TV8A 1N8RH 1W5BA 3R0PA 3D01A 4I50B 2I6RA 4C8GA 4ZHWA 2Z1FA 3CCEF 3RYFA 4O2BB 4YJ2A 3ZOPA 4U3JA 1IV1A 3N4YA 4M8IA 4G88A 3CD6F 3KJJA 4ZK7A 2VGNA 2P6YA 1NQ3A 5IJ0B 3JALB 4EI7A 5J2UB 2N48A 2QEXF 5JVDA 1VQ7F 4O4JB 3I56F 5DCVA 5EAZA 3MCAB 3K0TA 4X1YB 4EB6B 4I55A 3N4ZA 4BT4A 4ZHYB 3NK6A 3RYCA 4C81A 5IJ9A 2LCAA 4DRXB 4TV8B 4B45A 1H47A 2HP3A 5KX5B 1X52A 4G4WA 3C9UA 4O4LA 1K8AH 3J7AR 2CZWA 1XRGA 2NMUA 3CCMF 3LYBA 2V9YA 4ZOLB 2IQQA 4BT5A 4G4YA 1VQPF 3PAFA 3FD6A 1U3PA 3VOAA 3IR9A 2EWCA 4BT2A 1VQ9F 4TV9A 1JD1A 2CSLA 2VAPA 3JASB 3LWPC 3HKCA 3E22A 3HWUA 5IJ0A 5HXUA 1RLUA 4HNAA 1JFFB 4BT3A 4KWEA 1TVKA 3RA6A 3JARA 5EYPB 5LYJB 2HX0A 3N2KB 4EB6A 5JQGB 1QD9A 3OW2F 1Z5WA 2RHLA 3WGKA 4I4TB 3WGLA 1PXWA 1FFXB 2HQSC 3JATB 5EB1B 1CK2A 1IV3A 1YGYA 1TUBA 3CYQA 4DXDA 4B46A 5IYZA 3F0GA 1RQ7A 1KC8H 5AVMA 3HTNA 2HS4A 3V4DA 3WJPA 3G4SF 5HY2A 2AIFA 5GINC 1YI2F 4TUYA 5CA1B 4F6RA 4YJ3A 3JCMM 3WPXA 2YXZA 5CB4A 3E22B 3RYIA 4O2BA 1IV4A 1M1KH 1VQ4F 2ZAUA 1TVKB 4X1KA 5C8YB 2OZBA 3CYPB 1IV2A 3FFMA 1YJNF 3UT5A 3D54A 4ZI7A 3G6EF 3N2GB 1K9MH 3F6MA 5JCOA 1QAHA 3IMPA 2KGWA 3I7TA 3CXCF 4WBNA 2RHHA 4BVQA 3TD4A 2HP0A 3VYUC 2OTJF 2QA4F 2ZVYA 2GLZA 3SIVA 4I55B 1U43A 2GVIA 3RYCB 2BTUA 3MBMA 3J81M 3V7QA 3LWOC 1JJ2F 4FFBB 3CCQF 3QHDA 4X1IA 2Q1YA 1NMUB 2BTOA 3O85A 3CC4F 3NVKE 3HKDA 3NVIB 4ZHQB 3RYHB 5GONA 5GIPC 5CA0A 3WJRA 2R751 4BY9D 2HS0A 2ZVZA 3JAKB 1UFYA 5MN5A 5EB0A 4BT7A 5JH7B 3UT5B 3KJKA 5FNVA 2B33A 3WGMA 2UYNA 4ERHA 4EI9A 1RQ2A 1SA0A 5BMVA 4HNAB 3WJQA 1Q7YH 3G71F 3GHZA 3JARB 4PWTA 3CPWF 1W581 2ALEA 5LYJA 5ITZA 1W59A 4O2AB 5KX5A 2IAFA 4C82A 4IIJB 3LDTA 3M1XA 1NJIH 5J2TA 1W3EX 2RHJA 3VCZA 4BT6A 5HXZA 1VQ8F 4EI8A 3DDNA 1U3LA 2UZHA 1E7KA 1GZ0A 3K12A 5GANK 1CLIA 2DYYA 1GX1A 1TUBB 4ZHQA 1SZQA 4G4ZA 1KNKA 5GONB 1X7OA 4O4IA 2Z1EA 1IPAA 1COMA 2PMPA 2UYKA 5LP6B 3VYSC 2HRUA 3TD3A 5JCOC 1JFFA 3ESJA 2KTUA 1X25A 2YYEA 3WPWA 1VHAA 3IKEA 1FSZA 5CB4B 1VQLF 1SA0B 5BMVB 1H7MA 3SIUA 2OTMA 2OTLF 2VGMA 3JALA 3U0OA 3ELCA 5EIBD 5B8FA 4IHJB 4O4JA 3M4SA 4IIJA 5EWRA 1CN7A 5LXTB 3S0YA 4NWOB 2H8CA 2W8BC 4B62A 3CCRF 1XHOA 5IT9M 4DRXA 3I3FA 2AMTA 3S06A 3FD5A 2LBXA 1Q82H 4RQOA 3VMFB 3E1YA 2Z01A 1SDSA 1VQKF 2RB9A 4X1IB 3IEQA 3LWRC 1W5FA 3CPQA 2FC3A 5EZYA 5HP8A 3PLAC 3ZP4A 3QTYA 1VQ6F 2Z1TA 1VQMF 1QU9A 2VAMA 3C9SA 1GO1A 2QI2A 3RA5A 3VTIC 1RLGA 3HKEB 1Q86H 5FJ4C 1R1MA 2G9IA 3CCSF 4ZHVA 1YQNA 3TD5A 1VQNF 1W42A 4O4HB 5FNVB 3ON1A 3JAWB 2CVLA 3N2KA 2PHNA 1U40A 1W57A 4C4WC 5LA6A 3FBAA 3MCQA 2JNBA 3HJWC 4X3MA 3CC2F 2BO1A 4X20B 3HKDB 2L26A 3S03A 3JVHA 4C8EA 2R6R1 3WGJA 3C9RA 3WXMB 4C8IA 1X7PA 3GYQA 3V3TA 5EZYB 4TZZA 3JAKA 5EIBC 2UYJA 3DC2A 3F0FA 4F6RB 4O4IB 4BW0B 3LMEA 2UYNB 5HY1A 3AGKA 5C8YA 5ITZB 3QUWA 3ZP7A 5GIOC 3C9TA 3CB2A 3HKBB 2FGYA 5GAPK 1T0AA 3JAMM 3F0EA 4X3LA 2H6LA 1PF5A 3ERNA 5LA6B 2BTQB 1W5AA 3MDOA 3VOBA 4B5CA 3IEWA 1W55A 3K14A 3OBYA 4XCQA 5LP6A 2I6DA 3NK7A 4LNUA 4FFBA 3C8LA 2ZODA 4ZOLA 3KE1A 3K2XA 3S0HA 5G4VC 5HY4A 4I50A 3ZO8A 1ODEA 3OBWA 1K73H 2F9ZC 1YJ9F 2AIZP 1DT9A 5MN6A 3FPIA 1QVFF 3LWQC
chains in the Genus database with same CATH topology
4G4XA 3S0YA 3TD3A 1R1MA 2W8BC 4R40B 4B62A 2ZOVA 2ZF8A 2N48A 4ZHVA 3CYPB 2HQSC 4PWTA 5EB1B 3S06A 3OONA 4G4YA 3TD5A 2MQEA 3WPWA 5EAZA 2LBTA 4RHAA 4ZHWA 3S0WA 3LDTA 3CYQA 4B5CA 2K1SA 3S02A 3KHNA 4ZHYB 3IMPA 4G4VA 2LCAA 1OAPA 2ZVZA 2KGWA 3TD4A 3S0HA 5EB0A 4G88A 4G4WA 2ZVYA 3WPXA 4G4ZA 2AIZP 2L26A 4ERHA 3S03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4X A;  3S0Y A;  3TD3 A;  1R1M A;  2W8B C;  4R40 B;  4B62 A;  2ZOV A;  2ZF8 A;  2N48 A;  4ZHV A;  3CYP B;  2HQS C;  4PWT A;  5EB1 B;  3S06 A;  3OON A;  4G4Y A;  3TD5 A;  2MQE A;  3WPW A;  5EAZ A;  2LBT A;  4RHA A;  4ZHW A;  3S0W A;  3LDT A;  3CYQ A;  4B5C A;  2K1S A;  3S02 A;  3KHN A;  4ZHY B;  3IMP A;  4G4V A;  2LCA A;  1OAP A;  2ZVZ A;  2KGW A;  3TD4 A;  3S0H A;  5EB0 A;  4G88 A;  4G4W A;  2ZVY A;  3WPX A;  4G4Z A;  2AIZ P;  2L26 A;  4ERH A;  3S03 A; 
#chains in the Genus database with same CATH topology
 1H48 A;  3P4E A;  4YJ2 B;  3CCJ F;  2VAW A;  4U3J B;  3NMU C;  3E20 B;  3CME F;  1KQS F;  1Z5V A;  4BVR A;  5JH7 A;  1VQ5 F;  3VI6 A;  2CHT A;  1FNK A;  2K1S A;  3F0D A;  1YJW F;  3B6N A;  4I4T A;  1UI9 A;  1W5E A;  5J2U A;  2Z1U A;  1M90 H;  4O4H A;  2VXY A;  3JAW A;  1VH8 A;  5IYZ B;  4X1Y A;  2HVY D;  2HRY A;  3CCU F;  5J2T B;  3CCL F;  5EO3 A;  4LNU B;  2UYP A;  5G4U C;  1YIT F;  1GO0 A;  3GTZ A;  4YJ3 B;  1T0K B;  4O4L B;  4X20 A;  2LBT A;  4RHA A;  3S0W A;  3RYI B;  3S02 A;  3IKF A;  3I55 F;  3HKE A;  3Q8H A;  5HP7 A;  4G4V A;  3CCV F;  3V7E A;  4X1K B;  3D00 A;  1JY8 A;  3T80 A;  3VYT C;  1VQO F;  3CG6 A;  3JAS A;  3HKC B;  3N2G A;  2GZL A;  1FNJ A;  2IG8 A;  4E6E A;  4G4X A;  3P10 A;  1ZWZ A;  5LP6 C;  1S72 F;  1KNJ A;  5KMG B;  2ZF8 A;  4WBN B;  5MN4 A;  4LCK A;  2HP0 B;  2CW4 A;  3BYQ A;  1W41 A;  2MQE A;  4NUT A;  4IHJ A;  4BVT A;  2Q1X A;  1W40 A;  2CWJ A;  1KD1 H;  1OFU A;  5HWE A;  1Q81 H;  1VQV A;  5LXT A;  1J7H A;  4NQ3 A;  2QTP A;  2DT4 A;  3EOR A;  1XBI A;  2KG4 A;  5LOV A;  1ONI A;  3RYH A;  3CMA F;  5CA0 B;  1YIJ F;  5FLX M;  3J80 M;  4TV9 B;  3M84 A;  3RYF B;  4R40 B;  2ZOV A;  4U39 A;  1RA4 A;  4TUY B;  5CA1 A;  1W2B F;  3OON A;  1QVG F;  2OHW A;  5EYP A;  2KTV A;  3RE3 A;  3L7Q A;  3VO8 A;  3HAX D;  5JQG A;  3KHN A;  2WAL A;  3HKB A;  1VK3 A;  2HS3 A;  5KMG A;  1Q8R A;  1DBF A;  2H8E A;  1OAP A;  2RHO A;  3WGN A;  5JVD B;  1FFX A;  3JAT A;  4O2A A;  3LWV C;  3P0Z A;  2LBW A;  5HY0 A;  4ZI7 B;  1YHQ F;  3VIU A;  4BVS A;  3CC7 F;  2CHS A;  3KIZ A;  5IJ9 B;  5LOV B;  1JN1 A;  3MQW A;  3LFO A;  5A2Q M;  1XV2 A;  4TV8 A;  1N8R H;  1W5B A;  3R0P A;  3D01 A;  4I50 B;  2I6R A;  4C8G A;  4ZHW A;  2Z1F A;  3CCE F;  3RYF A;  4O2B B;  4YJ2 A;  3ZOP A;  4U3J A;  1IV1 A;  3N4Y A;  4M8I A;  4G88 A;  3CD6 F;  3KJJ A;  4ZK7 A;  2VGN A;  2P6Y A;  1NQ3 A;  5IJ0 B;  3JAL B;  4EI7 A;  5J2U B;  2N48 A;  2QEX F;  5JVD A;  1VQ7 F;  4O4J B;  3I56 F;  5DCV A;  5EAZ A;  3MCA B;  3K0T A;  4X1Y B;  4EB6 B;  4I55 A;  3N4Z A;  4BT4 A;  4ZHY B;  3NK6 A;  3RYC A;  4C81 A;  5IJ9 A;  2LCA A;  4DRX B;  4TV8 B;  4B45 A;  1H47 A;  2HP3 A;  5KX5 B;  1X52 A;  4G4W A;  3C9U A;  4O4L A;  1K8A H;  3J7A R;  2CZW A;  1XRG A;  2NMU A;  3CCM F;  3LYB A;  2V9Y A;  4ZOL B;  2IQQ A;  4BT5 A;  4G4Y A;  1VQP F;  3PAF A;  3FD6 A;  1U3P A;  3VOA A;  3IR9 A;  2EWC A;  4BT2 A;  1VQ9 F;  4TV9 A;  1JD1 A;  2CSL A;  2VAP A;  3JAS B;  3LWP C;  3HKC A;  3E22 A;  3HWU A;  5IJ0 A;  5HXU A;  1RLU A;  4HNA A;  1JFF B;  4BT3 A;  4KWE A;  1TVK A;  3RA6 A;  3JAR A;  5EYP B;  5LYJ B;  2HX0 A;  3N2K B;  4EB6 A;  5JQG B;  1QD9 A;  3OW2 F;  1Z5W A;  2RHL A;  3WGK A;  4I4T B;  3WGL A;  1PXW A;  1FFX B;  2HQS C;  3JAT B;  5EB1 B;  1CK2 A;  1IV3 A;  1YGY A;  1TUB A;  3CYQ A;  4DXD A;  4B46 A;  5IYZ A;  3F0G A;  1RQ7 A;  1KC8 H;  5AVM A;  3HTN A;  2HS4 A;  3V4D A;  3WJP A;  3G4S F;  5HY2 A;  2AIF A;  5GIN C;  1YI2 F;  4TUY A;  5CA1 B;  4F6R A;  4YJ3 A;  3JCM M;  3WPX A;  2YXZ A;  5CB4 A;  3E22 B;  3RYI A;  4O2B A;  1IV4 A;  1M1K H;  1VQ4 F;  2ZAU A;  1TVK B;  4X1K A;  5C8Y B;  2OZB A;  3CYP B;  1IV2 A;  3FFM A;  1YJN F;  3UT5 A;  3D54 A;  4ZI7 A;  3G6E F;  3N2G B;  1K9M H;  3F6M A;  5JCO A;  1QAH A;  3IMP A;  2KGW A;  3I7T A;  3CXC F;  4WBN A;  2RHH A;  4BVQ A;  3TD4 A;  2HP0 A;  3VYU C;  2OTJ F;  2QA4 F;  2ZVY A;  2GLZ A;  3SIV A;  4I55 B;  1U43 A;  2GVI A;  3RYC B;  2BTU A;  3MBM A;  3J81 M;  3V7Q A;  3LWO C;  1JJ2 F;  4FFB B;  3CCQ F;  3QHD A;  4X1I A;  2Q1Y A;  1NMU B;  2BTO A;  3O85 A;  3CC4 F;  3NVK E;  3HKD A;  3NVI B;  4ZHQ B;  3RYH B;  5GON A;  5GIP C;  5CA0 A;  3WJR A;  2R75 1;  4BY9 D;  2HS0 A;  2ZVZ A;  3JAK B;  1UFY A;  5MN5 A;  5EB0 A;  4BT7 A;  5JH7 B;  3UT5 B;  3KJK A;  5FNV A;  2B33 A;  3WGM A;  2UYN A;  4ERH A;  4EI9 A;  1RQ2 A;  1SA0 A;  5BMV A;  4HNA B;  3WJQ A;  1Q7Y H;  3G71 F;  3GHZ A;  3JAR B;  4PWT A;  3CPW F;  1W58 1;  2ALE A;  5LYJ A;  5ITZ A;  1W59 A;  4O2A B;  5KX5 A;  2IAF A;  4C82 A;  4IIJ B;  3LDT A;  3M1X A;  1NJI H;  5J2T A;  1W3E X;  2RHJ A;  3VCZ A;  4BT6 A;  5HXZ A;  1VQ8 F;  4EI8 A;  3DDN A;  1U3L A;  2UZH A;  1E7K A;  1GZ0 A;  3K12 A;  5GAN K;  1CLI A;  2DYY A;  1GX1 A;  1TUB B;  4ZHQ A;  1SZQ A;  4G4Z A;  1KNK A;  5GON B;  1X7O A;  4O4I A;  2Z1E A;  1IPA A;  1COM A;  2PMP A;  2UYK A;  5LP6 B;  3VYS C;  2HRU A;  3TD3 A;  5JCO C;  1JFF A;  3ESJ A;  2KTU A;  1X25 A;  2YYE A;  3WPW A;  1VHA A;  3IKE A;  1FSZ A;  5CB4 B;  1VQL F;  1SA0 B;  5BMV B;  1H7M A;  3SIU A;  2OTM A;  2OTL F;  2VGM A;  3JAL A;  3U0O A;  3ELC A;  5EIB D;  5B8F A;  4IHJ B;  4O4J A;  3M4S A;  4IIJ A;  5EWR A;  1CN7 A;  5LXT B;  3S0Y A;  4NWO B;  2H8C A;  2W8B C;  4B62 A;  3CCR F;  1XHO A;  5IT9 M;  4DRX A;  3I3F A;  2AMT A;  3S06 A;  3FD5 A;  2LBX A;  1Q82 H;  4RQO A;  3VMF B;  3E1Y A;  2Z01 A;  1SDS A;  1VQK F;  2RB9 A;  4X1I B;  3IEQ A;  3LWR C;  1W5F A;  3CPQ A;  2FC3 A;  5EZY A;  5HP8 A;  3PLA C;  3ZP4 A;  3QTY A;  1VQ6 F;  2Z1T A;  1VQM F;  1QU9 A;  2VAM A;  3C9S A;  1GO1 A;  2QI2 A;  3RA5 A;  3VTI C;  1RLG A;  3HKE B;  1Q86 H;  5FJ4 C;  1R1M A;  2G9I A;  3CCS F;  4ZHV A;  1YQN A;  3TD5 A;  1VQN F;  1W42 A;  4O4H B;  5FNV B;  3ON1 A;  3JAW B;  2CVL A;  3N2K A;  2PHN A;  1U40 A;  1W57 A;  4C4W C;  5LA6 A;  3FBA A;  3MCQ A;  2JNB A;  3HJW C;  4X3M A;  3CC2 F;  2BO1 A;  4X20 B;  3HKD B;  2L26 A;  3S03 A;  3JVH A;  4C8E A;  2R6R 1;  3WGJ A;  3C9R A;  3WXM B;  4C8I A;  1X7P A;  3GYQ A;  3V3T A;  5EZY B;  4TZZ A;  3JAK A;  5EIB C;  2UYJ A;  3DC2 A;  3F0F A;  4F6R B;  4O4I B;  4BW0 B;  3LME A;  2UYN B;  5HY1 A;  3AGK A;  5C8Y A;  5ITZ B;  3QUW A;  3ZP7 A;  5GIO C;  3C9T A;  3CB2 A;  3HKB B;  2FGY A;  5GAP K;  1T0A A;  3JAM M;  3F0E A;  4X3L A;  2H6L A;  1PF5 A;  3ERN A;  5LA6 B;  2BTQ B;  1W5A A;  3MDO A;  3VOB A;  4B5C A;  3IEW A;  1W55 A;  3K14 A;  3OBY A;  4XCQ A;  5LP6 A;  2I6D A;  3NK7 A;  4LNU A;  4FFB A;  3C8L A;  2ZOD A;  4ZOL A;  3KE1 A;  3K2X A;  3S0H A;  5G4V C;  5HY4 A;  4I50 A;  3ZO8 A;  1ODE A;  3OBW A;  1K73 H;  2F9Z C;  1YJ9 F;  2AIZ P;  1DT9 A;  5MN6 A;  3FPI A;  1QVF F;  3LWQ C; 
#chains in the Genus database with same CATH homology
 4G4X A;  3S0Y A;  3TD3 A;  1R1M A;  2W8B C;  4R40 B;  4B62 A;  2ZOV A;  2ZF8 A;  2N48 A;  4ZHV A;  3CYP B;  2HQS C;  4PWT A;  5EB1 B;  3S06 A;  3OON A;  4G4Y A;  3TD5 A;  2MQE A;  3WPW A;  5EAZ A;  2LBT A;  4RHA A;  4ZHW A;  3S0W A;  3LDT A;  3CYQ A;  4B5C A;  2K1S A;  3S02 A;  3KHN A;  4ZHY B;  3IMP A;  4G4V A;  2LCA A;  1OAP A;  2ZVZ A;  2KGW A;  3TD4 A;  3S0H A;  5EB0 A;  4G88 A;  4G4W A;  2ZVY A;  3WPX A;  4G4Z A;  2AIZ P;  2L26 A;  4ERH A;  3S03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...