4RHAA

Structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
131
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of outer-membrane protein OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 39
structure length 131
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4rhaA00
2L26A 3LDTA 3WPXA 3IMPA 3S03A 4G88A 4G4WA 2K1SA 3S0WA 1R1MA 4B5CA 2ZF8A 4R40B 1OAPA 2LCAA 3KHNA 4PWTA 3TD5A 4ERHA 4ZHWA 3TD3A 4G4ZA 2KGWA 2ZVYA 4ZHYB 3S0HA 3WPWA 3S0YA 2MQEA 3CYPB 5EB1B 4ZHVA 3S02A 4G4XA 2ZVZA 3OONA 5EB0A 2LBTA 3TD4A 4RHAA 2N48A 2W8BC 3S06A 2AIZP 5EAZA 4G4YA 4G4VA 4B62A 3CYQA 2ZOVA 2HQSC
chains in the Genus database with same CATH superfamily
2Q1XA 1KQSF 5MN4A 1W581 1E7KA 4B5CA 5IJ9A 3CC7F 4C82A 3KIZA 5LYJB 3DC2A 3D01A 3BYQA 3HKCA 1YQNA 3MDOA 3ZOPA 4WBNA 1VQOF 1VQ6F 2H8CA 2B33A 5HY4A 1ODEA 5LA6A 5IJ0A 3V3TA 1QAHA 4IHJA 5LXTB 3J80M 4DRXB 1XV2A 1RQ2A 4BVQA 5HXUA 3MCAB 5ITZA 2ZF8A 2CSLA 2PMPA 3TD5A 3VYTC 2ALEA 1IPAA 1JD1A 1FNJA 2HS3A 3VOAA 5FLXM 5EZYB 2G9IA 1VQ9F 1NQ3A 3F0FA 4X3LA 2W8BC 1U40A 4LNUB 5J2TB 4G4VA 1W5FA 4ZOLA 3JAWA 5GONB 2IQQA 3E20B 3S03A 3ON1A 4G88A 4TUYB 2H8EA 2YYEA 4RQOA 4O2AA 4BT5A 3GTZA 3GYQA 3QUWA 3RYHB 3CCJF 3JAKB 5EYPA 3VO8A 4G4ZA 5IYZA 2QEXF 3E1YA 3RYHA 5JH7B 2ZODA 3B6NA 3HKDB 4BVTA 1K8AH 4DXDA 2ZVZA 3CCRF 4BVSA 1VQ8F 2LBTA 1NJIH 1K73H 3F0GA 5EAZA 2OTJF 3FFMA 1FFXB 4X1KA 1N8RH 4BT7A 5HY1A 4I50B 3CCEF 3L7QA 3M4SA 1OAPA 1YJNF 4ERHA 2R751 3NVIB 4C8GA 3C9RA 4O4HB 1X25A 4HNAA 5ITZB 2RHJA 3CYPB 4ZHVA 5GIOC 3LWVC 3TD4A 3IEWA 1U3LA 3HKBA 4X3MA 1Q7YH 3UT5A 3F0DA 3CYQA 2BO1A 5HP8A 5CA0B 1YJ9F 1GX1A 5JVDB 4TV8A 3IMPA 3V7QA 3KJJA 2OHWA 1W3EX 4ZI7A 3HKCB 4ZK7A 5LYJA 4R40B 3KHNA 4M8IA 3T80A 4ZHWA 2HP3A 4O2AB 3ESJA 5IJ9B 2KGWA 5LOVA 5BMVB 4ZHYB 5EWRA 3C8LA 1VQ4F 1SDSA 3WXMB 5CA0A 4TUYA 3RYIB 3M1XA 4ZOLB 2Z1UA 3CC4F 4ZHQB 5FJ4C 1VHAA 1M1KH 1VH8A 2I6DA 4E6EA 2H6LA 2HS4A 1Q8RA 3ZO8A 3RE3A 2UYPA 1QVFF 1SZQA 5KX5A 3NK6A 2HQSC 5AVMA 3IR9A 2CHSA 1GO0A 3VCZA 4X20A 4C8IA 4BT3A 3DDNA 1W5AA 4I55A 2GVIA 2WALA 1SA0A 1FSZA 3IEQA 3ELCA 2CZWA 2DYYA 1DT9A 3WJPA 3VOBA 3WPWA 3S0YA 1DBFA 3K0TA 3CCQF 5LXTA 1X7PA 3RA5A 4IHJB 3V4DA 5FNVB 2F9ZC 1GZ0A 4B62A 4O4JA 4U3JA 2I6RA 2VXYA 3CMAF 3HKDA 5JH7A 4WBNB 1Z5WA 2KTUA 3JALA 2R6R1 3CB2A 3JAKA 2RHLA 3JASA 4O4IA 1M90H 1IV2A 3N2KB 3NK7A 3RA6A 3NMUC 1RA4A 1JFFB 2CWJA 3AGKA 3SIVA 1YHQF 1PXWA 3FD5A 3K2XA 1H47A 3MQWA 3LMEA 4F6RA 3I56F 1CN7A 1RLUA 4O2BB 2AMTA 4B45A 3HAXD 3R0PA 2DT4A 3FPIA 4NUTA 2Z1EA 3J81M 4X1YB 5G4VC 3GHZA 4I4TA 2Z1TA 3JVHA 3CPWF 2CW4A 3RYFA 2BTQB 4EB6B 1JN1A 4DRXA 3LWQC 5CB4A 3CCMF 4X1YA 4O4LB 1KC8H 5A2QM 1KNKA 5EB0A 1Q81H 3U0OA 3KJKA 3V7EA 3O85A 1XHOA 3G4SF 1W57A 3WJQA 3ZP7A 2EWCA 1T0KB 1T0AA 3N2KA 2AIFA 1W5EA 1VQMF 1JFFA 2FGYA 2VGMA 3HJWC 3HWUA 1W41A 5GAPK 4LCKA 5HP7A 3VMFB 2LBXA 4EI9A 1VQKF 1QU9A 1RQ7A 4O4JB 3C9TA 3K14A 3UT5B 1Q82H 2HVYD 2ZOVA 4BT6A 2L26A 3WPXA 1RLGA 5B8FA 4XCQA 3VTIC 3CMEF 2KTVA 3CCSF 2K1SA 3CD6F 2UYJA 5HY2A 1NMUB 1IV1A 4O4HA 3OBWA 2ZAUA 4PWTA 5KMGB 4X1IB 2V9YA 4FFBB 3JCMM 3EORA 2QI2A 1VK3A 3JATB 4X20B 3MBMA 5CA1B 5JQGA 3J7AR 5KX5B 5GANK 1Q86H 3CG6A 4TZZA 2OZBA 1FNKA 3WGMA 4BT4A 3S06A 3D00A 2AIZP 3QHDA 1W5BA 4F6RB 3RYIA 1VQ7F 1COMA 1W59A 3K12A 5GINC 3OW2F 3WGJA 3D54A 4TV9A 3RYCB 5LP6B 1KNJA 5BMVA 3JASB 3E22A 4O4IB 5LOVB 5HWEA 1KD1H 5EYPB 3E22B 1YIJF 3S0HA 2RHOA 3WGKA 3VYUC 3WGLA 5HXZA 5EB1B 4U3JB 4BY9D 3IKEA 2BTUA 3IKFA 2IAFA 4BT2A 2NMUA 4YJ2A 1YJWF 4TV8B 5FNVA 3JAWB 2FC3A 3CXCF 3P10A 4G4XA 3G6EF 1J7HA 3N2GA 1IV4A 3HTNA 2HP0B 3LYBA 4B46A 3VYSC 4EI8A 1YI2F 1VQPF 4C81A 3S0WA 2UYNA 1U43A 3FBAA 1X7OA 2Z1FA 3N4YA 2UYNB 3KE1A 4KWEA 4FFBA 3TD3A 2JNBA 5C8YB 2HP0A 3I7TA 1FFXA 4BW0B 1W2BF 5GIPC 3S02A 3CCUF 5MN5A 5IJ0B 3F0EA 4YJ2B 2GZLA 4ZHQA 3PAFA 3CPQA 3P0ZA 2HX0A 5EIBD 2GLZA 1XBIA 3M84A 1Z5VA 1YGYA 2HRUA 4BVRA 5IYZB 1H7MA 1X52A 3I55F 1YITF 3RYCA 2KG4A 1PF5A 4ZI7B 4TV9B 2ZVYA 5LP6A 5HY0A 1VQ5F 4EI7A 5GONA 5JVDA 2RB9A 5JCOA 3JAMM 3HKBB 2N48A 3ERNA 2RHHA 4G4YA 2OTLF 1CLIA 3OBYA 3LDTA 4HNAB 2IG8A 3FD6A 3VI6A 3CCVF 2PHNA 5C8YA 5CB4B 3SIUA 5EIBC 2CVLA 5G4UC 2HRYA 3JARB 3VIUA 1ZWZA 4I50A 3LWPC 3HKEA 1W40A 3G71F 2UZHA 3P4EA 3RYFB 1VQLF 4NQ3A 4C4WC 3N2GB 4X1KB 1W55A 1TUBA 1VQNF 2VGNA 1JJ2F 2YXZA 3LFOA 5LA6B 1UFYA 4O2BA 1UI9A 3ZP4A 5IT9M 1U3PA 3N4ZA 5MN6A 4G4WA 3WJRA 1QVGF 3F6MA 5J2UA 2BTOA 1CK2A 1R1MA 1TVKA 2LCAA 3C9SA 5DCVA 3QTYA 1TVKB 3Q8HA 1VQVA 3PLAC 5J2UB 3JALB 2Z01A 3WGNA 2UYKA 2HS0A 4LNUA 5J2TA 1K9MH 5LP6C 3LWOC 4NWOB 5EZYA 4O4LA 2P6YA 5CA1A 1GO1A 5JQGB 3LWRC 2Q1YA 2OTMA 1TUBB 2VAPA 3JATA 1W42A 4EB6A 2CHTA 4YJ3B 5EO3A 1S72F 1QD9A 2QA4F 4IIJB 4X1IA 1IV3A 5KMGA 2QTPA 4U39A 5JCOC 4IIJA 3HKEB 3CCLF 3MCQA 4YJ3A 1SA0B 4I55B 4C8EA 2LBWA 3JARA 4I4TB 2MQEA 3CC2F 3NVKE 3OONA 3C9UA 4RHAA 1ONIA 2VAWA 3I3FA 1XRGA 1JY8A 2VAMA 1OFUA 1H48A
chains in the Genus database with same CATH topology
2L26A 3LDTA 3WPXA 3IMPA 3S03A 4G88A 4G4WA 2K1SA 3S0WA 1R1MA 4B5CA 2ZF8A 4R40B 1OAPA 2LCAA 3KHNA 4PWTA 3TD5A 4ERHA 4ZHWA 3TD3A 4G4ZA 2KGWA 2ZVYA 4ZHYB 3S0HA 3WPWA 3S0YA 2MQEA 3CYPB 5EB1B 4ZHVA 3S02A 4G4XA 2ZVZA 3OONA 5EB0A 2LBTA 3TD4A 4RHAA 2N48A 2W8BC 3S06A 2AIZP 5EAZA 4G4YA 4G4VA 4B62A 3CYQA 2ZOVA 2HQSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L26 A;  3LDT A;  3WPX A;  3IMP A;  3S03 A;  4G88 A;  4G4W A;  2K1S A;  3S0W A;  1R1M A;  4B5C A;  2ZF8 A;  4R40 B;  1OAP A;  2LCA A;  3KHN A;  4PWT A;  3TD5 A;  4ERH A;  4ZHW A;  3TD3 A;  4G4Z A;  2KGW A;  2ZVY A;  4ZHY B;  3S0H A;  3WPW A;  3S0Y A;  2MQE A;  3CYP B;  5EB1 B;  4ZHV A;  3S02 A;  4G4X A;  2ZVZ A;  3OON A;  5EB0 A;  2LBT A;  3TD4 A;  4RHA A;  2N48 A;  2W8B C;  3S06 A;  2AIZ P;  5EAZ A;  4G4Y A;  4G4V A;  4B62 A;  3CYQ A;  2ZOV A;  2HQS C; 
#chains in the Genus database with same CATH topology
 2Q1X A;  1KQS F;  5MN4 A;  1W58 1;  1E7K A;  4B5C A;  5IJ9 A;  3CC7 F;  4C82 A;  3KIZ A;  5LYJ B;  3DC2 A;  3D01 A;  3BYQ A;  3HKC A;  1YQN A;  3MDO A;  3ZOP A;  4WBN A;  1VQO F;  1VQ6 F;  2H8C A;  2B33 A;  5HY4 A;  1ODE A;  5LA6 A;  5IJ0 A;  3V3T A;  1QAH A;  4IHJ A;  5LXT B;  3J80 M;  4DRX B;  1XV2 A;  1RQ2 A;  4BVQ A;  5HXU A;  3MCA B;  5ITZ A;  2ZF8 A;  2CSL A;  2PMP A;  3TD5 A;  3VYT C;  2ALE A;  1IPA A;  1JD1 A;  1FNJ A;  2HS3 A;  3VOA A;  5FLX M;  5EZY B;  2G9I A;  1VQ9 F;  1NQ3 A;  3F0F A;  4X3L A;  2W8B C;  1U40 A;  4LNU B;  5J2T B;  4G4V A;  1W5F A;  4ZOL A;  3JAW A;  5GON B;  2IQQ A;  3E20 B;  3S03 A;  3ON1 A;  4G88 A;  4TUY B;  2H8E A;  2YYE A;  4RQO A;  4O2A A;  4BT5 A;  3GTZ A;  3GYQ A;  3QUW A;  3RYH B;  3CCJ F;  3JAK B;  5EYP A;  3VO8 A;  4G4Z A;  5IYZ A;  2QEX F;  3E1Y A;  3RYH A;  5JH7 B;  2ZOD A;  3B6N A;  3HKD B;  4BVT A;  1K8A H;  4DXD A;  2ZVZ A;  3CCR F;  4BVS A;  1VQ8 F;  2LBT A;  1NJI H;  1K73 H;  3F0G A;  5EAZ A;  2OTJ F;  3FFM A;  1FFX B;  4X1K A;  1N8R H;  4BT7 A;  5HY1 A;  4I50 B;  3CCE F;  3L7Q A;  3M4S A;  1OAP A;  1YJN F;  4ERH A;  2R75 1;  3NVI B;  4C8G A;  3C9R A;  4O4H B;  1X25 A;  4HNA A;  5ITZ B;  2RHJ A;  3CYP B;  4ZHV A;  5GIO C;  3LWV C;  3TD4 A;  3IEW A;  1U3L A;  3HKB A;  4X3M A;  1Q7Y H;  3UT5 A;  3F0D A;  3CYQ A;  2BO1 A;  5HP8 A;  5CA0 B;  1YJ9 F;  1GX1 A;  5JVD B;  4TV8 A;  3IMP A;  3V7Q A;  3KJJ A;  2OHW A;  1W3E X;  4ZI7 A;  3HKC B;  4ZK7 A;  5LYJ A;  4R40 B;  3KHN A;  4M8I A;  3T80 A;  4ZHW A;  2HP3 A;  4O2A B;  3ESJ A;  5IJ9 B;  2KGW A;  5LOV A;  5BMV B;  4ZHY B;  5EWR A;  3C8L A;  1VQ4 F;  1SDS A;  3WXM B;  5CA0 A;  4TUY A;  3RYI B;  3M1X A;  4ZOL B;  2Z1U A;  3CC4 F;  4ZHQ B;  5FJ4 C;  1VHA A;  1M1K H;  1VH8 A;  2I6D A;  4E6E A;  2H6L A;  2HS4 A;  1Q8R A;  3ZO8 A;  3RE3 A;  2UYP A;  1QVF F;  1SZQ A;  5KX5 A;  3NK6 A;  2HQS C;  5AVM A;  3IR9 A;  2CHS A;  1GO0 A;  3VCZ A;  4X20 A;  4C8I A;  4BT3 A;  3DDN A;  1W5A A;  4I55 A;  2GVI A;  2WAL A;  1SA0 A;  1FSZ A;  3IEQ A;  3ELC A;  2CZW A;  2DYY A;  1DT9 A;  3WJP A;  3VOB A;  3WPW A;  3S0Y A;  1DBF A;  3K0T A;  3CCQ F;  5LXT A;  1X7P A;  3RA5 A;  4IHJ B;  3V4D A;  5FNV B;  2F9Z C;  1GZ0 A;  4B62 A;  4O4J A;  4U3J A;  2I6R A;  2VXY A;  3CMA F;  3HKD A;  5JH7 A;  4WBN B;  1Z5W A;  2KTU A;  3JAL A;  2R6R 1;  3CB2 A;  3JAK A;  2RHL A;  3JAS A;  4O4I A;  1M90 H;  1IV2 A;  3N2K B;  3NK7 A;  3RA6 A;  3NMU C;  1RA4 A;  1JFF B;  2CWJ A;  3AGK A;  3SIV A;  1YHQ F;  1PXW A;  3FD5 A;  3K2X A;  1H47 A;  3MQW A;  3LME A;  4F6R A;  3I56 F;  1CN7 A;  1RLU A;  4O2B B;  2AMT A;  4B45 A;  3HAX D;  3R0P A;  2DT4 A;  3FPI A;  4NUT A;  2Z1E A;  3J81 M;  4X1Y B;  5G4V C;  3GHZ A;  4I4T A;  2Z1T A;  3JVH A;  3CPW F;  2CW4 A;  3RYF A;  2BTQ B;  4EB6 B;  1JN1 A;  4DRX A;  3LWQ C;  5CB4 A;  3CCM F;  4X1Y A;  4O4L B;  1KC8 H;  5A2Q M;  1KNK A;  5EB0 A;  1Q81 H;  3U0O A;  3KJK A;  3V7E A;  3O85 A;  1XHO A;  3G4S F;  1W57 A;  3WJQ A;  3ZP7 A;  2EWC A;  1T0K B;  1T0A A;  3N2K A;  2AIF A;  1W5E A;  1VQM F;  1JFF A;  2FGY A;  2VGM A;  3HJW C;  3HWU A;  1W41 A;  5GAP K;  4LCK A;  5HP7 A;  3VMF B;  2LBX A;  4EI9 A;  1VQK F;  1QU9 A;  1RQ7 A;  4O4J B;  3C9T A;  3K14 A;  3UT5 B;  1Q82 H;  2HVY D;  2ZOV A;  4BT6 A;  2L26 A;  3WPX A;  1RLG A;  5B8F A;  4XCQ A;  3VTI C;  3CME F;  2KTV A;  3CCS F;  2K1S A;  3CD6 F;  2UYJ A;  5HY2 A;  1NMU B;  1IV1 A;  4O4H A;  3OBW A;  2ZAU A;  4PWT A;  5KMG B;  4X1I B;  2V9Y A;  4FFB B;  3JCM M;  3EOR A;  2QI2 A;  1VK3 A;  3JAT B;  4X20 B;  3MBM A;  5CA1 B;  5JQG A;  3J7A R;  5KX5 B;  5GAN K;  1Q86 H;  3CG6 A;  4TZZ A;  2OZB A;  1FNK A;  3WGM A;  4BT4 A;  3S06 A;  3D00 A;  2AIZ P;  3QHD A;  1W5B A;  4F6R B;  3RYI A;  1VQ7 F;  1COM A;  1W59 A;  3K12 A;  5GIN C;  3OW2 F;  3WGJ A;  3D54 A;  4TV9 A;  3RYC B;  5LP6 B;  1KNJ A;  5BMV A;  3JAS B;  3E22 A;  4O4I B;  5LOV B;  5HWE A;  1KD1 H;  5EYP B;  3E22 B;  1YIJ F;  3S0H A;  2RHO A;  3WGK A;  3VYU C;  3WGL A;  5HXZ A;  5EB1 B;  4U3J B;  4BY9 D;  3IKE A;  2BTU A;  3IKF A;  2IAF A;  4BT2 A;  2NMU A;  4YJ2 A;  1YJW F;  4TV8 B;  5FNV A;  3JAW B;  2FC3 A;  3CXC F;  3P10 A;  4G4X A;  3G6E F;  1J7H A;  3N2G A;  1IV4 A;  3HTN A;  2HP0 B;  3LYB A;  4B46 A;  3VYS C;  4EI8 A;  1YI2 F;  1VQP F;  4C81 A;  3S0W A;  2UYN A;  1U43 A;  3FBA A;  1X7O A;  2Z1F A;  3N4Y A;  2UYN B;  3KE1 A;  4KWE A;  4FFB A;  3TD3 A;  2JNB A;  5C8Y B;  2HP0 A;  3I7T A;  1FFX A;  4BW0 B;  1W2B F;  5GIP C;  3S02 A;  3CCU F;  5MN5 A;  5IJ0 B;  3F0E A;  4YJ2 B;  2GZL A;  4ZHQ A;  3PAF A;  3CPQ A;  3P0Z A;  2HX0 A;  5EIB D;  2GLZ A;  1XBI A;  3M84 A;  1Z5V A;  1YGY A;  2HRU A;  4BVR A;  5IYZ B;  1H7M A;  1X52 A;  3I55 F;  1YIT F;  3RYC A;  2KG4 A;  1PF5 A;  4ZI7 B;  4TV9 B;  2ZVY A;  5LP6 A;  5HY0 A;  1VQ5 F;  4EI7 A;  5GON A;  5JVD A;  2RB9 A;  5JCO A;  3JAM M;  3HKB B;  2N48 A;  3ERN A;  2RHH A;  4G4Y A;  2OTL F;  1CLI A;  3OBY A;  3LDT A;  4HNA B;  2IG8 A;  3FD6 A;  3VI6 A;  3CCV F;  2PHN A;  5C8Y A;  5CB4 B;  3SIU A;  5EIB C;  2CVL A;  5G4U C;  2HRY A;  3JAR B;  3VIU A;  1ZWZ A;  4I50 A;  3LWP C;  3HKE A;  1W40 A;  3G71 F;  2UZH A;  3P4E A;  3RYF B;  1VQL F;  4NQ3 A;  4C4W C;  3N2G B;  4X1K B;  1W55 A;  1TUB A;  1VQN F;  2VGN A;  1JJ2 F;  2YXZ A;  3LFO A;  5LA6 B;  1UFY A;  4O2B A;  1UI9 A;  3ZP4 A;  5IT9 M;  1U3P A;  3N4Z A;  5MN6 A;  4G4W A;  3WJR A;  1QVG F;  3F6M A;  5J2U A;  2BTO A;  1CK2 A;  1R1M A;  1TVK A;  2LCA A;  3C9S A;  5DCV A;  3QTY A;  1TVK B;  3Q8H A;  1VQV A;  3PLA C;  5J2U B;  3JAL B;  2Z01 A;  3WGN A;  2UYK A;  2HS0 A;  4LNU A;  5J2T A;  1K9M H;  5LP6 C;  3LWO C;  4NWO B;  5EZY A;  4O4L A;  2P6Y A;  5CA1 A;  1GO1 A;  5JQG B;  3LWR C;  2Q1Y A;  2OTM A;  1TUB B;  2VAP A;  3JAT A;  1W42 A;  4EB6 A;  2CHT A;  4YJ3 B;  5EO3 A;  1S72 F;  1QD9 A;  2QA4 F;  4IIJ B;  4X1I A;  1IV3 A;  5KMG A;  2QTP A;  4U39 A;  5JCO C;  4IIJ A;  3HKE B;  3CCL F;  3MCQ A;  4YJ3 A;  1SA0 B;  4I55 B;  4C8E A;  2LBW A;  3JAR A;  4I4T B;  2MQE A;  3CC2 F;  3NVK E;  3OON A;  3C9U A;  4RHA A;  1ONI A;  2VAW A;  3I3F A;  1XRG A;  1JY8 A;  2VAM A;  1OFU A;  1H48 A; 
#chains in the Genus database with same CATH homology
 2L26 A;  3LDT A;  3WPX A;  3IMP A;  3S03 A;  4G88 A;  4G4W A;  2K1S A;  3S0W A;  1R1M A;  4B5C A;  2ZF8 A;  4R40 B;  1OAP A;  2LCA A;  3KHN A;  4PWT A;  3TD5 A;  4ERH A;  4ZHW A;  3TD3 A;  4G4Z A;  2KGW A;  2ZVY A;  4ZHY B;  3S0H A;  3WPW A;  3S0Y A;  2MQE A;  3CYP B;  5EB1 B;  4ZHV A;  3S02 A;  4G4X A;  2ZVZ A;  3OON A;  5EB0 A;  2LBT A;  3TD4 A;  4RHA A;  2N48 A;  2W8B C;  3S06 A;  2AIZ P;  5EAZ A;  4G4Y A;  4G4V A;  4B62 A;  3CYQ A;  2ZOV A;  2HQS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...