3CG6A

Crystal structure of gadd45 gamma
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
131
Chain Sequence
TARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVDLHCILISNPNWKDPALEKLSLFCEESRSFNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible 45 gamma
publication title The crystal structure and dimerization interface of GADD45gamma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 43
structure length 131
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cg6A00
2KG4A 1K8AH 3CG6A 1QVFF 3RA5A 3WXMB 2VGMA 1VQ8F 2CZWA 1Q7YH 1T0KB 2QA4F 3I56F 3CCMF 1N8RH 2OTLF 3SIVA 4X3LA 4X3MA 3LWVC 1W3EX 2OHWA 3HAXD 1Q86H 1KD1H 1X7PA 2OZBA 5DCVA 1GZ0A 1W40A 3CPQA 1KC8H 3G4SF 5A2QM 3CCLF 1YJWF 1K73H 3LWRC 1NJIH 3ON1A 3JAMM 3MCAB 1YJ9F 3CCEF 4LCKA 5EWRA 1VQ5F 5IT9M 4BW0B 3G71F 3E20B 1DT9A 2QI2A 1YITF 1JJ2F 3LWQC 1W2BF 3CD6F 2FC3A 3PLAC 2KTVA 4TZZA 1NMUB 2LBXA 3LWPC 1IPAA 1VQOF 4C4WC 1GO0A 3SIUA 4NUTA 3VI6A 1M1KH 1RLGA 3NMUC 1YJNF 3CCVF 5GANK 3V7QA 3CPWF 3CCQF 1E7KA 1XBIA 2ALEA 1M90H 1KQSF 1ZWZA 3RA6A 3IR9A 1PXWA 1RA4A 3LFOA 3CMAF 3VMFB 3CCRF 1YIJF 2QEXF 3CCSF 3FFMA 2VGNA 1GO1A 3N4ZA 1VQ6F 2LBWA 3J7AR 3V7EA 2JNBA 3JCMM 1VQKF 3E1YA 2AIFA 5GINC 3CMEF 3OBWA 1VQNF 5GIPC 1CN7A 5FLXM 3NVIB 1VQ7F 3G6EF 3CCJF 1SDSA 5G4UC 3J80M 3AGKA 2OTJF 3CCUF 2KTUA 3OW2F 3NK7A 1X7OA 1CK2A 1Q82H 5G4VC 3GYQA 3LWOC 3CC4F 1VQMF 1Q81H 3O85A 1S72F 1W41A 1X52A 1VQ4F 3CC7F 1VQ9F 3PAFA 1QVGF 2I6DA 1K9MH 4BY9D 3N4YA 5FJ4C 3CXCF 3I55F 2BO1A 2HVYD 1VQPF 3HJWC 3J81M 5GAPK 3NVKE 1H7MA 1YHQF 5EO3A 1YI2F 3OBYA 5GIOC 3NK6A 1VQLF 1W42A 2WALA 3CC2F
chains in the Genus database with same CATH superfamily
1PF5A 3CG6A 3WXMB 4YJ3B 5IYZA 1IV2A 1XHOA 4X3LA 3LWVC 1OFUA 4HNAB 2ZF8A 5EIBD 4ZHYB 3HKDB 3HKEA 4FFBB 1Q86H 2VXYA 1X7PA 1FSZA 2CHSA 4EB6B 2RHJA 3RYIB 1RQ2A 4RQOA 5EB0A 3P10A 5EYPA 1VHAA 3CCEF 5EWRA 1VQ5F 1TVKB 5IT9M 3U0OA 4IIJB 1X25A 1DT9A 3WGLA 3WPWA 2RHHA 1YITF 3LWQC 3S03A 1W2BF 4EI7A 5CA0A 5HXUA 5BMVA 3D54A 3QHDA 2LBXA 3WJRA 2V9YA 3FD5A 4C4WC 4ZHQB 5B8FA 1GO0A 1W57A 3N2KA 3VI6A 3IKEA 1RLGA 5LYJB 1FFXA 3NMUC 3WGKA 3HWUA 4X1YB 5LXTA 2LBTA 4ZOLA 1XBIA 3K14A 2BTQB 2N48A 1M90H 1W59A 3JAWB 4BT5A 2FGYA 4EI8A 5FNVA 4F6RA 1PXWA 2P6YA 3C9RA 3C8LA 3RYHA 4X1IA 3LFOA 5JQGA 1SA0A 3RYCB 5MN5A 5HY2A 2UYNB 2QEXF 5J2TA 3JATA 5LA6B 1GO1A 4R40B 4TV9B 3J7AR 2AIFA 3ZP4A 4YJ2B 5MN4A 2Z1UA 1JFFB 3IKFA 1CN7A 2HS4A 3L7QA 1VQ7F 3B6NA 5GONA 1SDSA 2HRUA 5IJ9B 3J80M 2R6R1 2ZOVA 2H8EA 4G4YA 1W55A 4NWOB 1W5BA 5G4VC 1U43A 3S06A 3VYUC 1Q81H 3O85A 2ZODA 4M8IA 1X52A 3LMEA 3CC7F 3IEQA 3PAFA 2GZLA 1R1MA 5EB1B 3UT5A 5KX5A 2CVLA 4WBNB 3N4YA 5MN6A 5JVDB 4BY9D 2BO1A 4O2AA 1VQPF 4DXDA 4TUYB 3VOBA 5GAPK 3F0DA 2LCAA 2VAWA 4LNUB 1YI2F 3NK6A 3M4SA 3CC2F 2KG4A 3P0ZA 1T0AA 3RA5A 4B46A 4C82A 4O4LA 1Q7YH 3N2GA 3FBAA 2QA4F 3I56F 3CCMF 5LOVB 1N8RH 4BT4A 4X20A 3ESJA 2OHWA 5HP7A 2UZHA 3QUWA 1W40A 5EYPB 3R0PA 2ZAUA 5JCOA 3G4SF 3S02A 3V3TA 1FNJA 1TUBB 1NJIH 2Z01A 3RE3A 5HWEA 3JAMM 5ITZB 1YQNA 4I55A 5BMVB 3IMPA 5J2UA 3P4EA 5JH7A 2CWJA 2DT4A 2KTVA 4TZZA 1NMUB 2ZVZA 4O2BA 1FFXB 3MBMA 2UYJA 4ZI7A 4X1KA 3JAKB 1H48A 4O4IB 5EAZA 1YJNF 4U3JA 5GANK 1KNJA 3CYQA 3D00A 2ALEA 3RYHB 3S0YA 2I6RA 3IR9A 1YGYA 2DYYA 1RA4A 3QTYA 4C81A 3WGNA 3D01A 3CCSF 2HP3A 5C8YA 1UI9A 2LBWA 5EZYA 3FD6A 3RYFA 5AVMA 2HS0A 3M1XA 5LP6A 1VQKF 3E1YA 5GONB 3C9TA 5GINC 1RQ7A 5IJ0A 3E22A 5GIPC 4BT3A 3WJPA 3NVIB 1W5FA 3CCJF 3HKBB 4E6EA 5G4UC 2GLZA 3AGKA 2BTUA 3WPXA 2KTUA 3CYPB 3NK7A 3LYBA 3GYQA 3WGJA 3GTZA 4YJ3A 1OAPA 4G4WA 4DRXA 2UYKA 2KGWA 5KX5B 1QVGF 3HKDA 4FFBA 3I55F 3F0EA 1IV4A 3T80A 4BT7A 4EI9A 3J81M 1ONIA 3TD5A 4IHJA 1W5AA 4ZHVA 2HP0A 4BVQA 3EORA 3V4DA 4O4LB 2WALA 2CSLA 3N2GB 1RLUA 3VCZA 2Q1XA 1CLIA 4BVTA 2IQQA 4X20B 5CB4B 1VQ8F 2CZWA 5KMGB 1W5EA 4O4HB 1Q8RA 3KE1A 3JARA 4X3MA 2B33A 1W3EX 1QU9A 3FPIA 4C8EA 2AMTA 2PHNA 1KD1H 2CHTA 2Z1FA 2OZBA 2VAPA 4ZHQA 5DCVA 4TV8A 3CPQA 3JALB 1KC8H 4I50B 5CA1B 4I55B 4X1YA 1K73H 3C9UA 3GHZA 2Z1TA 3MCAB 4LCKA 2YXZA 1U3PA 1IV1A 1ODEA 3WJQA 1U40A 3JAWA 1VK3A 3G71F 1U3LA 2QI2A 1H47A 1JJ2F 5IYZB 2F9ZC 3LWPC 3HKCA 4X1KB 3HKEB 2UYNA 3SIUA 3ERNA 3TD3A 2PMPA 4NUTA 1M1KH 4I4TA 4B5CA 3CPWF 3I3FA 3VOAA 2HQSC 4O4JA 4RHAA 1JFFA 1KQSF 1GX1A 1QAHA 5CA0B 3DC2A 3WGMA 5HY0A 3CMAF 5EZYB 1Z5WA 3FFMA 3N2KB 5LP6B 2VGNA 3N4ZA 1VQ6F 2Q1YA 2HS3A 2JNBA 3JASA 4KWEA 4B45A 5LXTB 1J7HA 5HY1A 4ZOLB 2W8BC 3CMEF 5JCOC 2NMUA 5FLXM 4WBNA 5JVDA 4F6RB 5FNVB 3VTIC 3ELCA 3TD4A 1JN1A 3ZP7A 4X1IB 2OTJF 5JQGB 1SA0B 4C8IA 3OW2F 4LNUA 3KHNA 5J2TB 2EWCA 2VAMA 3JATB 3Q8HA 1Q82H 4DRXB 1VH8A 1VQVA 3LWOC 3CC4F 1S72F 3S0WA 4BVSA 5LOVA 1VQ4F 2I6DA 1K9MH 3KJKA 4IHJB 5FJ4C 3CXCF 2HVYD 2HP0B 2HRYA 2Z1EA 3HJWC 1H7MA 1YHQF 4B62A 5EO3A 1TUBA 2R751 2RHOA 5GIOC 4U39A 1W42A 4BT2A 5ITZA 1K8AH 1QVFF 3JARB 3MQWA 2VGMA 1T0KB 3MCQA 2OTLF 3SIVA 2UYPA 3HAXD 4TV8B 4G88A 3HTNA 2IG8A 3UT5B 4PWTA 4O2AB 5LP6C 1GZ0A 2GVIA 4HNAA 3JAKA 5A2QM 4O4IA 1KNKA 3CCLF 1YJWF 4EB6A 1FNKA 3LWRC 3ON1A 3RYIA 1YJ9F 2RHLA 4BW0B 1QD9A 3E20B 2H6LA 3HKCB 1TVKA 3KIZA 3VO8A 3CD6F 2AIZP 2FC3A 3BYQA 4IIJA 3PLAC 2IAFA 3LDTA 3M84A 1JY8A 2RB9A 3KJJA 1JD1A 1IPAA 3K0TA 4ZK7A 1VQOF 4I4TB 2MQEA 3S0HA 3CCVF 4O4JB 3V7QA 3CCQF 2ZVYA 5LYJA 1E7KA 1Z5VA 3K2XA 3CB2A 1UFYA 2H8CA 1XV2A 1ZWZA 3HKBA 3RA6A 5J2UB 5JH7B 3ZOPA 3F6MA 3VMFB 3CCRF 4O2BB 4XCQA 1YIJF 5EIBC 3F0GA 4BT6A 2CW4A 3JASB 4ZI7B 3RYCA 1NQ3A 4G4VA 3V7EA 5HY4A 4U3JB 5LA6A 4G4XA 3JCMM 4ERHA 3JVHA 4TV9A 4NQ3A 3C9SA 1W581 3OBWA 1VQNF 3ZO8A 5HXZA 3G6EF 2BTOA 4YJ2A 2HX0A 3I7TA 3VIUA 3CCUF 5IJ9A 1X7OA 1CK2A 3DDNA 4BVRA 4G4ZA 2L26A 5C8YB 2G9IA 1VQMF 1IV3A 5CB4A 3RYFB 3VYSC 5KMGA 4O4HA 1W41A 1VQ9F 1XRGA 2K1SA 5IJ0B 3IEWA 3E22B 5HP8A 3F0FA 1DBFA 3OONA 3VYTC 4ZHWA 3K12A 3JALA 1SZQA 2QTPA 3NVKE 4I50A 5CA1A 3MDOA 4C8GA 1COMA 2OTMA 4TUYA 3OBYA 1VQLF 2YYEA
chains in the Genus database with same CATH topology
2KG4A 1K8AH 3CG6A 1QVFF 3RA5A 3WXMB 2VGMA 1VQ8F 2CZWA 1Q7YH 1T0KB 2QA4F 3I56F 3CCMF 1N8RH 2OTLF 3SIVA 4X3LA 4X3MA 3LWVC 1W3EX 2OHWA 3HAXD 1Q86H 1KD1H 1X7PA 2OZBA 5DCVA 1GZ0A 1W40A 3CPQA 1KC8H 3G4SF 5A2QM 3V3TA 4BVTA 3CCLF 1YJWF 1K73H 3LWRC 1NJIH 3ON1A 5HWEA 3JAMM 3MCAB 1YJ9F 3CCEF 4LCKA 5EWRA 1VQ5F 5IT9M 4BW0B 3G71F 3E20B 1DT9A 2QI2A 1YITF 1JJ2F 3LWQC 1W2BF 3CD6F 4EI7A 2FC3A 5HXUA 3PLAC 2KTVA 4TZZA 1NMUB 2F9ZC 2LBXA 3LWPC 1IPAA 1VQOF 4C4WC 1GO0A 3SIUA 4NUTA 3VI6A 1M1KH 1RLGA 3NMUC 1YJNF 3CCVF 5GANK 3V7QA 3CPWF 3CCQF 1E7KA 1XBIA 3D00A 2ALEA 1M90H 1KQSF 1ZWZA 2FGYA 3RA6A 4EI8A 3IR9A 1PXWA 1RA4A 3LFOA 5HY0A 3CMAF 3VMFB 3CCRF 5HY2A 4XCQA 1YIJF 2QEXF 3CCSF 3FFMA 2VGNA 1GO1A 3N4ZA 1VQ6F 2LBWA 3J7AR 3V7EA 2JNBA 5HY4A 3JCMM 1VQKF 3E1YA 5HY1A 2AIFA 4NQ3A 5GINC 3CMEF 3OBWA 1VQNF 5GIPC 1CN7A 5FLXM 5HXZA 3NVIB 1VQ7F 3G6EF 3CCJF 1SDSA 5G4UC 2GLZA 3J80M 3AGKA 2OTJF 3CCUF 2KTUA 3OW2F 3NK7A 1X7OA 1CK2A 4BVRA 1Q82H 5G4VC 3GYQA 3LWOC 3CC4F 1VQMF 1Q81H 3O85A 1S72F 4BVSA 1W41A 1X52A 1VQ4F 3CC7F 1VQ9F 3PAFA 1QVGF 2I6DA 1K9MH 4BY9D 3N4YA 5FJ4C 3CXCF 3I55F 2BO1A 2HVYD 1VQPF 3HJWC 4EI9A 3J81M 5GAPK 3NVKE 1H7MA 1YHQF 4BVQA 5EO3A 1YI2F 3OBYA 5GIOC 3NK6A 1VQLF 1W42A 2WALA 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG4 A;  1K8A H;  3CG6 A;  1QVF F;  3RA5 A;  3WXM B;  2VGM A;  1VQ8 F;  2CZW A;  1Q7Y H;  1T0K B;  2QA4 F;  3I56 F;  3CCM F;  1N8R H;  2OTL F;  3SIV A;  4X3L A;  4X3M A;  3LWV C;  1W3E X;  2OHW A;  3HAX D;  1Q86 H;  1KD1 H;  1X7P A;  2OZB A;  5DCV A;  1GZ0 A;  1W40 A;  3CPQ A;  1KC8 H;  3G4S F;  5A2Q M;  3CCL F;  1YJW F;  1K73 H;  3LWR C;  1NJI H;  3ON1 A;  3JAM M;  3MCA B;  1YJ9 F;  3CCE F;  4LCK A;  5EWR A;  1VQ5 F;  5IT9 M;  4BW0 B;  3G71 F;  3E20 B;  1DT9 A;  2QI2 A;  1YIT F;  1JJ2 F;  3LWQ C;  1W2B F;  3CD6 F;  2FC3 A;  3PLA C;  2KTV A;  4TZZ A;  1NMU B;  2LBX A;  3LWP C;  1IPA A;  1VQO F;  4C4W C;  1GO0 A;  3SIU A;  4NUT A;  3VI6 A;  1M1K H;  1RLG A;  3NMU C;  1YJN F;  3CCV F;  5GAN K;  3V7Q A;  3CPW F;  3CCQ F;  1E7K A;  1XBI A;  2ALE A;  1M90 H;  1KQS F;  1ZWZ A;  3RA6 A;  3IR9 A;  1PXW A;  1RA4 A;  3LFO A;  3CMA F;  3VMF B;  3CCR F;  1YIJ F;  2QEX F;  3CCS F;  3FFM A;  2VGN A;  1GO1 A;  3N4Z A;  1VQ6 F;  2LBW A;  3J7A R;  3V7E A;  2JNB A;  3JCM M;  1VQK F;  3E1Y A;  2AIF A;  5GIN C;  3CME F;  3OBW A;  1VQN F;  5GIP C;  1CN7 A;  5FLX M;  3NVI B;  1VQ7 F;  3G6E F;  3CCJ F;  1SDS A;  5G4U C;  3J80 M;  3AGK A;  2OTJ F;  3CCU F;  2KTU A;  3OW2 F;  3NK7 A;  1X7O A;  1CK2 A;  1Q82 H;  5G4V C;  3GYQ A;  3LWO C;  3CC4 F;  1VQM F;  1Q81 H;  3O85 A;  1S72 F;  1W41 A;  1X52 A;  1VQ4 F;  3CC7 F;  1VQ9 F;  3PAF A;  1QVG F;  2I6D A;  1K9M H;  4BY9 D;  3N4Y A;  5FJ4 C;  3CXC F;  3I55 F;  2BO1 A;  2HVY D;  1VQP F;  3HJW C;  3J81 M;  5GAP K;  3NVK E;  1H7M A;  1YHQ F;  5EO3 A;  1YI2 F;  3OBY A;  5GIO C;  3NK6 A;  1VQL F;  1W42 A;  2WAL A;  3CC2 F; 
#chains in the Genus database with same CATH topology
 1PF5 A;  3CG6 A;  3WXM B;  4YJ3 B;  5IYZ A;  1IV2 A;  1XHO A;  4X3L A;  3LWV C;  1OFU A;  4HNA B;  2ZF8 A;  5EIB D;  4ZHY B;  3HKD B;  3HKE A;  4FFB B;  1Q86 H;  2VXY A;  1X7P A;  1FSZ A;  2CHS A;  4EB6 B;  2RHJ A;  3RYI B;  1RQ2 A;  4RQO A;  5EB0 A;  3P10 A;  5EYP A;  1VHA A;  3CCE F;  5EWR A;  1VQ5 F;  1TVK B;  5IT9 M;  3U0O A;  4IIJ B;  1X25 A;  1DT9 A;  3WGL A;  3WPW A;  2RHH A;  1YIT F;  3LWQ C;  3S03 A;  1W2B F;  4EI7 A;  5CA0 A;  5HXU A;  5BMV A;  3D54 A;  3QHD A;  2LBX A;  3WJR A;  2V9Y A;  3FD5 A;  4C4W C;  4ZHQ B;  5B8F A;  1GO0 A;  1W57 A;  3N2K A;  3VI6 A;  3IKE A;  1RLG A;  5LYJ B;  1FFX A;  3NMU C;  3WGK A;  3HWU A;  4X1Y B;  5LXT A;  2LBT A;  4ZOL A;  1XBI A;  3K14 A;  2BTQ B;  2N48 A;  1M90 H;  1W59 A;  3JAW B;  4BT5 A;  2FGY A;  4EI8 A;  5FNV A;  4F6R A;  1PXW A;  2P6Y A;  3C9R A;  3C8L A;  3RYH A;  4X1I A;  3LFO A;  5JQG A;  1SA0 A;  3RYC B;  5MN5 A;  5HY2 A;  2UYN B;  2QEX F;  5J2T A;  3JAT A;  5LA6 B;  1GO1 A;  4R40 B;  4TV9 B;  3J7A R;  2AIF A;  3ZP4 A;  4YJ2 B;  5MN4 A;  2Z1U A;  1JFF B;  3IKF A;  1CN7 A;  2HS4 A;  3L7Q A;  1VQ7 F;  3B6N A;  5GON A;  1SDS A;  2HRU A;  5IJ9 B;  3J80 M;  2R6R 1;  2ZOV A;  2H8E A;  4G4Y A;  1W55 A;  4NWO B;  1W5B A;  5G4V C;  1U43 A;  3S06 A;  3VYU C;  1Q81 H;  3O85 A;  2ZOD A;  4M8I A;  1X52 A;  3LME A;  3CC7 F;  3IEQ A;  3PAF A;  2GZL A;  1R1M A;  5EB1 B;  3UT5 A;  5KX5 A;  2CVL A;  4WBN B;  3N4Y A;  5MN6 A;  5JVD B;  4BY9 D;  2BO1 A;  4O2A A;  1VQP F;  4DXD A;  4TUY B;  3VOB A;  5GAP K;  3F0D A;  2LCA A;  2VAW A;  4LNU B;  1YI2 F;  3NK6 A;  3M4S A;  3CC2 F;  2KG4 A;  3P0Z A;  1T0A A;  3RA5 A;  4B46 A;  4C82 A;  4O4L A;  1Q7Y H;  3N2G A;  3FBA A;  2QA4 F;  3I56 F;  3CCM F;  5LOV B;  1N8R H;  4BT4 A;  4X20 A;  3ESJ A;  2OHW A;  5HP7 A;  2UZH A;  3QUW A;  1W40 A;  5EYP B;  3R0P A;  2ZAU A;  5JCO A;  3G4S F;  3S02 A;  3V3T A;  1FNJ A;  1TUB B;  1NJI H;  2Z01 A;  3RE3 A;  5HWE A;  3JAM M;  5ITZ B;  1YQN A;  4I55 A;  5BMV B;  3IMP A;  5J2U A;  3P4E A;  5JH7 A;  2CWJ A;  2DT4 A;  2KTV A;  4TZZ A;  1NMU B;  2ZVZ A;  4O2B A;  1FFX B;  3MBM A;  2UYJ A;  4ZI7 A;  4X1K A;  3JAK B;  1H48 A;  4O4I B;  5EAZ A;  1YJN F;  4U3J A;  5GAN K;  1KNJ A;  3CYQ A;  3D00 A;  2ALE A;  3RYH B;  3S0Y A;  2I6R A;  3IR9 A;  1YGY A;  2DYY A;  1RA4 A;  3QTY A;  4C81 A;  3WGN A;  3D01 A;  3CCS F;  2HP3 A;  5C8Y A;  1UI9 A;  2LBW A;  5EZY A;  3FD6 A;  3RYF A;  5AVM A;  2HS0 A;  3M1X A;  5LP6 A;  1VQK F;  3E1Y A;  5GON B;  3C9T A;  5GIN C;  1RQ7 A;  5IJ0 A;  3E22 A;  5GIP C;  4BT3 A;  3WJP A;  3NVI B;  1W5F A;  3CCJ F;  3HKB B;  4E6E A;  5G4U C;  2GLZ A;  3AGK A;  2BTU A;  3WPX A;  2KTU A;  3CYP B;  3NK7 A;  3LYB A;  3GYQ A;  3WGJ A;  3GTZ A;  4YJ3 A;  1OAP A;  4G4W A;  4DRX A;  2UYK A;  2KGW A;  5KX5 B;  1QVG F;  3HKD A;  4FFB A;  3I55 F;  3F0E A;  1IV4 A;  3T80 A;  4BT7 A;  4EI9 A;  3J81 M;  1ONI A;  3TD5 A;  4IHJ A;  1W5A A;  4ZHV A;  2HP0 A;  4BVQ A;  3EOR A;  3V4D A;  4O4L B;  2WAL A;  2CSL A;  3N2G B;  1RLU A;  3VCZ A;  2Q1X A;  1CLI A;  4BVT A;  2IQQ A;  4X20 B;  5CB4 B;  1VQ8 F;  2CZW A;  5KMG B;  1W5E A;  4O4H B;  1Q8R A;  3KE1 A;  3JAR A;  4X3M A;  2B33 A;  1W3E X;  1QU9 A;  3FPI A;  4C8E A;  2AMT A;  2PHN A;  1KD1 H;  2CHT A;  2Z1F A;  2OZB A;  2VAP A;  4ZHQ A;  5DCV A;  4TV8 A;  3CPQ A;  3JAL B;  1KC8 H;  4I50 B;  5CA1 B;  4I55 B;  4X1Y A;  1K73 H;  3C9U A;  3GHZ A;  2Z1T A;  3MCA B;  4LCK A;  2YXZ A;  1U3P A;  1IV1 A;  1ODE A;  3WJQ A;  1U40 A;  3JAW A;  1VK3 A;  3G71 F;  1U3L A;  2QI2 A;  1H47 A;  1JJ2 F;  5IYZ B;  2F9Z C;  3LWP C;  3HKC A;  4X1K B;  3HKE B;  2UYN A;  3SIU A;  3ERN A;  3TD3 A;  2PMP A;  4NUT A;  1M1K H;  4I4T A;  4B5C A;  3CPW F;  3I3F A;  3VOA A;  2HQS C;  4O4J A;  4RHA A;  1JFF A;  1KQS F;  1GX1 A;  1QAH A;  5CA0 B;  3DC2 A;  3WGM A;  5HY0 A;  3CMA F;  5EZY B;  1Z5W A;  3FFM A;  3N2K B;  5LP6 B;  2VGN A;  3N4Z A;  1VQ6 F;  2Q1Y A;  2HS3 A;  2JNB A;  3JAS A;  4KWE A;  4B45 A;  5LXT B;  1J7H A;  5HY1 A;  4ZOL B;  2W8B C;  3CME F;  5JCO C;  2NMU A;  5FLX M;  4WBN A;  5JVD A;  4F6R B;  5FNV B;  3VTI C;  3ELC A;  3TD4 A;  1JN1 A;  3ZP7 A;  4X1I B;  2OTJ F;  5JQG B;  1SA0 B;  4C8I A;  3OW2 F;  4LNU A;  3KHN A;  5J2T B;  2EWC A;  2VAM A;  3JAT B;  3Q8H A;  1Q82 H;  4DRX B;  1VH8 A;  1VQV A;  3LWO C;  3CC4 F;  1S72 F;  3S0W A;  4BVS A;  5LOV A;  1VQ4 F;  2I6D A;  1K9M H;  3KJK A;  4IHJ B;  5FJ4 C;  3CXC F;  2HVY D;  2HP0 B;  2HRY A;  2Z1E A;  3HJW C;  1H7M A;  1YHQ F;  4B62 A;  5EO3 A;  1TUB A;  2R75 1;  2RHO A;  5GIO C;  4U39 A;  1W42 A;  4BT2 A;  5ITZ A;  1K8A H;  1QVF F;  3JAR B;  3MQW A;  2VGM A;  1T0K B;  3MCQ A;  2OTL F;  3SIV A;  2UYP A;  3HAX D;  4TV8 B;  4G88 A;  3HTN A;  2IG8 A;  3UT5 B;  4PWT A;  4O2A B;  5LP6 C;  1GZ0 A;  2GVI A;  4HNA A;  3JAK A;  5A2Q M;  4O4I A;  1KNK A;  3CCL F;  1YJW F;  4EB6 A;  1FNK A;  3LWR C;  3ON1 A;  3RYI A;  1YJ9 F;  2RHL A;  4BW0 B;  1QD9 A;  3E20 B;  2H6L A;  3HKC B;  1TVK A;  3KIZ A;  3VO8 A;  3CD6 F;  2AIZ P;  2FC3 A;  3BYQ A;  4IIJ A;  3PLA C;  2IAF A;  3LDT A;  3M84 A;  1JY8 A;  2RB9 A;  3KJJ A;  1JD1 A;  1IPA A;  3K0T A;  4ZK7 A;  1VQO F;  4I4T B;  2MQE A;  3S0H A;  3CCV F;  4O4J B;  3V7Q A;  3CCQ F;  2ZVY A;  5LYJ A;  1E7K A;  1Z5V A;  3K2X A;  3CB2 A;  1UFY A;  2H8C A;  1XV2 A;  1ZWZ A;  3HKB A;  3RA6 A;  5J2U B;  5JH7 B;  3ZOP A;  3F6M A;  3VMF B;  3CCR F;  4O2B B;  4XCQ A;  1YIJ F;  5EIB C;  3F0G A;  4BT6 A;  2CW4 A;  3JAS B;  4ZI7 B;  3RYC A;  1NQ3 A;  4G4V A;  3V7E A;  5HY4 A;  4U3J B;  5LA6 A;  4G4X A;  3JCM M;  4ERH A;  3JVH A;  4TV9 A;  4NQ3 A;  3C9S A;  1W58 1;  3OBW A;  1VQN F;  3ZO8 A;  5HXZ A;  3G6E F;  2BTO A;  4YJ2 A;  2HX0 A;  3I7T A;  3VIU A;  3CCU F;  5IJ9 A;  1X7O A;  1CK2 A;  3DDN A;  4BVR A;  4G4Z A;  2L26 A;  5C8Y B;  2G9I A;  1VQM F;  1IV3 A;  5CB4 A;  3RYF B;  3VYS C;  5KMG A;  4O4H A;  1W41 A;  1VQ9 F;  1XRG A;  2K1S A;  5IJ0 B;  3IEW A;  3E22 B;  5HP8 A;  3F0F A;  1DBF A;  3OON A;  3VYT C;  4ZHW A;  3K12 A;  3JAL A;  1SZQ A;  2QTP A;  3NVK E;  4I50 A;  5CA1 A;  3MDO A;  4C8G A;  1COM A;  2OTM A;  4TUY A;  3OBY A;  1VQL F;  2YYE A; 
#chains in the Genus database with same CATH homology
 2KG4 A;  1K8A H;  3CG6 A;  1QVF F;  3RA5 A;  3WXM B;  2VGM A;  1VQ8 F;  2CZW A;  1Q7Y H;  1T0K B;  2QA4 F;  3I56 F;  3CCM F;  1N8R H;  2OTL F;  3SIV A;  4X3L A;  4X3M A;  3LWV C;  1W3E X;  2OHW A;  3HAX D;  1Q86 H;  1KD1 H;  1X7P A;  2OZB A;  5DCV A;  1GZ0 A;  1W40 A;  3CPQ A;  1KC8 H;  3G4S F;  5A2Q M;  3V3T A;  4BVT A;  3CCL F;  1YJW F;  1K73 H;  3LWR C;  1NJI H;  3ON1 A;  5HWE A;  3JAM M;  3MCA B;  1YJ9 F;  3CCE F;  4LCK A;  5EWR A;  1VQ5 F;  5IT9 M;  4BW0 B;  3G71 F;  3E20 B;  1DT9 A;  2QI2 A;  1YIT F;  1JJ2 F;  3LWQ C;  1W2B F;  3CD6 F;  4EI7 A;  2FC3 A;  5HXU A;  3PLA C;  2KTV A;  4TZZ A;  1NMU B;  2F9Z C;  2LBX A;  3LWP C;  1IPA A;  1VQO F;  4C4W C;  1GO0 A;  3SIU A;  4NUT A;  3VI6 A;  1M1K H;  1RLG A;  3NMU C;  1YJN F;  3CCV F;  5GAN K;  3V7Q A;  3CPW F;  3CCQ F;  1E7K A;  1XBI A;  3D00 A;  2ALE A;  1M90 H;  1KQS F;  1ZWZ A;  2FGY A;  3RA6 A;  4EI8 A;  3IR9 A;  1PXW A;  1RA4 A;  3LFO A;  5HY0 A;  3CMA F;  3VMF B;  3CCR F;  5HY2 A;  4XCQ A;  1YIJ F;  2QEX F;  3CCS F;  3FFM A;  2VGN A;  1GO1 A;  3N4Z A;  1VQ6 F;  2LBW A;  3J7A R;  3V7E A;  2JNB A;  5HY4 A;  3JCM M;  1VQK F;  3E1Y A;  5HY1 A;  2AIF A;  4NQ3 A;  5GIN C;  3CME F;  3OBW A;  1VQN F;  5GIP C;  1CN7 A;  5FLX M;  5HXZ A;  3NVI B;  1VQ7 F;  3G6E F;  3CCJ F;  1SDS A;  5G4U C;  2GLZ A;  3J80 M;  3AGK A;  2OTJ F;  3CCU F;  2KTU A;  3OW2 F;  3NK7 A;  1X7O A;  1CK2 A;  4BVR A;  1Q82 H;  5G4V C;  3GYQ A;  3LWO C;  3CC4 F;  1VQM F;  1Q81 H;  3O85 A;  1S72 F;  4BVS A;  1W41 A;  1X52 A;  1VQ4 F;  3CC7 F;  1VQ9 F;  3PAF A;  1QVG F;  2I6D A;  1K9M H;  4BY9 D;  3N4Y A;  5FJ4 C;  3CXC F;  3I55 F;  2BO1 A;  2HVY D;  1VQP F;  3HJW C;  4EI9 A;  3J81 M;  5GAP K;  3NVK E;  1H7M A;  1YHQ F;  4BVQ A;  5EO3 A;  1YI2 F;  3OBY A;  5GIO C;  3NK6 A;  1VQL F;  1W42 A;  2WAL A;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...