3CG6A

Crystal structure of gadd45 gamma
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
131
Chain Sequence
TARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVDLHCILISNPNWKDPALEKLSLFCEESRSFNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible 45 gamma
publication title The crystal structure and dimerization interface of GADD45gamma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 43
structure length 131
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cg6A00
1K9MH 3CCSF 3CC4F 3V7EA 2I6DA 3IR9A 1GO0A 2CZWA 1N8RH 5EWRA 3NMUC 4BW0B 3JCMM 3CPWF 3CCLF 1Q7YH 1YIJF 1W42A 3FFMA 3SIVA 3HAXD 1KQSF 3CCUF 1RLGA 1YJ9F 2JNBA 1IPAA 3OBWA 3GYQA 3LWVC 3CG6A 2OTLF 1PXWA 3CCJF 3E1YA 1VQ5F 3N4YA 1SDSA 1GO1A 3E20B 3J81M 1VQNF 1Q81H 2BO1A 3SIUA 1S72F 1NJIH 3VI6A 4BY9D 5GINC 1K8AH 3PLAC 1W3EX 2KTUA 3J80M 1E7KA 2FC3A 5EO3A 1M90H 1T0KB 3OBYA 1YJWF 3LWPC 2VGMA 3LWRC 3AGKA 1CK2A 3G71F 2AIFA 1YI2F 3MCAB 3CCQF 2LBXA 3CC2F 3CC7F 3WXMB 3NK6A 3CCRF 2WALA 5FLXM 4LCKA 4X3LA 1X7PA 2OTJF 1H7MA 3ON1A 3G4SF 2ALEA 3LWOC 1DT9A 5GANK 1KC8H 1X7OA 2QEXF 5G4UC 3N4ZA 3RA6A 2LBWA 3O85A 5GAPK 1ZWZA 1CN7A 1JJ2F 1NMUB 3NK7A 1YJNF 5G4VC 1QVFF 3J7AR 1VQ9F 1W40A 1W41A 1VQLF 3CMAF 1KD1H 1VQKF 4C4WC 3G6EF 3CCVF 3CCMF 3HJWC 1M1KH 5DCVA 1RA4A 2HVYD 5IT9M 3I55F 1VQ8F 2KTVA 1QVGF 3V7QA 3I56F 3NVIB 2KG4A 2OZBA 3CPQA 1X52A 3JAMM 4TZZA 1Q86H 3LFOA 3CXCF 3CCEF 1Q82H 2QA4F 1VQMF 1VQ6F 5GIPC 5FJ4C 1YITF 3CD6F 3VMFB 5A2QM 2OHWA 3PAFA 3CMEF 1VQ7F 1VQOF 1K73H 4NUTA 2QI2A 3LWQC 3NVKE 1XBIA 2VGNA 3RA5A 5GIOC 3OW2F 1VQPF 4X3MA 1VQ4F 1YHQF 1W2BF 1GZ0A
chains in the Genus database with same CATH superfamily
3S06A 1K9MH 3CC4F 1H48A 5LXTB 4BT7A 1GX1A 4ZOLA 3IR9A 4IHJA 3JAWB 3WPXA 4EB6B 1QAHA 4B45A 3KJKA 2Z1TA 3HKBA 3VYSC 3HAXD 5EIBC 1FNJA 2JNBA 4B5CA 5HP7A 4C82A 2RHLA 3E1YA 1FNKA 1GO1A 1VQNF 5EYPA 3J81M 3HKEA 5ITZA 4KWEA 1S72F 3ZO8A 1TVKB 3VI6A 3HKCB 2LBTA 1IV1A 4TV8B 3PLAC 2GLZA 1COMA 1W3EX 1U43A 3WGLA 3BYQA 3QUWA 1T0KB 5JVDB 2OTMA 2BTUA 2R751 2VGMA 4F6RA 3LWRC 1PF5A 4BT6A 1YI2F 2V9YA 3CCQF 3QHDA 2P6YA 3WGNA 3CCRF 2EWCA 2WALA 3F0DA 1YQNA 5LOVB 4LCKA 3U0OA 5HY0A 1H7MA 3ON1A 3N2KA 4R40B 1KC8H 5KMGB 4I4TB 2HS4A 1XV2A 4O4IB 2HS0A 3D00A 4O4JA 4O2BA 4X1YA 3HKDB 1NMUB 3F0GA 3N2GB 5LA6B 1QVFF 4C4WC 1W40A 4DRXA 1KD1H 5MN5A 5LXTA 3VOAA 4O4LA 3CCMF 1M1KH 1SA0B 2HVYD 4G4VA 2IAFA 4M8IA 1IV3A 3JARB 1UI9A 1H47A 3TD4A 4EB6A 3MQWA 5MN6A 3V7QA 2VAPA 3F6MA 3KE1A 1X52A 3F0EA 4IIJB 2VAWA 3LFOA 5FNVB 2AIZP 2QA4F 1VQMF 1VQ6F 5FJ4C 3FPIA 5A2QM 2OHWA 3PAFA 4ZI7B 1U3LA 4TUYB 4NWOB 1K73H 3ESJA 2VXYA 3LWQC 1TVKA 2VGNA 2ZAUA 3RA5A 2Z1FA 3HKCA 3ZP7A 3NVKE 4TV8A 1W2BF 4LNUB 5LP6C 3WPWA 5HP8A 5JVDA 2BTOA 4ZHQB 3WJPA 5GONB 2KGWA 4EI7A 2I6DA 2RHJA 4EI8A 3OONA 1GO0A 2CZWA 2HS3A 2CHSA 2W8BC 3NMUC 3FD6A 5LOVA 4HNAB 3HWUA 4B46A 1U3PA 3JAKB 3S03A 5J2TB 5HXZA 1RLGA 5KMGA 3VO8A 4I4TA 4O4IA 1IPAA 1W55A 3GYQA 3D54A 3T80A 1ONIA 1VQ5F 4WBNA 1SDSA 3SIUA 1XHOA 5HY2A 3F0FA 3N2GA 5LA6A 1K8AH 1Z5VA 3VYUC 4B62A 3C8LA 2KTUA 3J80M 1SA0A 3OBYA 1YJWF 2HX0A 2HRYA 3JARA 2RB9A 1QD9A 2QTPA 3AGKA 4C8EA 3G71F 3CYPB 2AIFA 3CC7F 3IKEA 1OAPA 4IIJA 5FNVA 3R0PA 3VIUA 4G4XA 3C9RA 4NQ3A 4G4WA 4X3LA 5IJ9B 1W57A 1TUBB 1X7PA 3KJJA 2OTJF 3G4SF 5GANK 4ZI7A 2NMUA 4TUYA 2H6LA 1X7OA 5G4UC 3N4ZA 5EAZA 4BT2A 2LBWA 1R1MA 1JN1A 4BVQA 1FFXB 3JATA 3RYCB 4U3JA 5KX5B 3Q8HA 3V4DA 3S0YA 4DXDA 3KIZA 5G4VC 2VAMA 1JFFB 1VQ9F 4ZHQA 3MDOA 4BVSA 5GONA 3GTZA 3CCVF 3HJWC 4YJ2B 2Q1YA 1KNKA 3B6NA 2HP3A 3I55F 3GHZA 2CW4A 1VQ8F 3HTNA 2UYJA 4X20B 3RE3A 4HNAA 5JH7B 4BT5A 1QVGF 4PWTA 4U39A 1FSZA 1SZQA 3JAKA 3TD5A 2OZBA 3CPQA 5J2TA 4E6EA 4TZZA 4YJ3B 3CXCF 4O2AB 3CCEF 2YYEA 1JY8A 3IEWA 5EIBD 1VQVA 1UFYA 3E22A 4I50B 5CA1B 3CMEF 3CD6F 2I6RA 1VQOF 1XBIA 1T0AA 5LP6B 5CA0B 4ERHA 1VH8A 2GZLA 3FD5A 4RHAA 3JAWA 4X1IB 3KHNA 2HP0B 1GZ0A 3JVHA 2GVIA 1W5EA 3L7QA 3K2XA 4G4ZA 3S0WA 3S02A 3V3TA 1CLIA 5IYZB 4BT3A 3M4SA 2DT4A 5EZYB 2PHNA 3WGKA 2RHHA 2BTQB 3JCMM 5IJ9A 3CCLF 1Q7YH 1J7HA 1W42A 4IHJB 2UYPA 1KQSF 1YJ9F 2HQSC 1IV2A 3K12A 1IV4A 3OBWA 3LWVC 2H8EA 2OTLF 1PXWA 4TV9B 2ZF8A 5J2UB 1FFXA 1Q81H 3MBMA 2BO1A 3ELCA 5KX5A 3S0HA 3C9UA 3VTIC 1W5FA 3RYHB 2ZODA 1ODEA 4I55B 2L26A 4YJ2A 5EO3A 2F9ZC 3K14A 5JCOA 5JH7A 2UZHA 1Q8RA 3MCAB 2K1SA 2Z1EA 2IG8A 3WGJA 2CVLA 3NK6A 3LYBA 3CB2A 4YJ3A 4O2AA 4C8IA 3RYIB 3LWOC 3HKDA 4I50A 5CA1A 5CB4B 2IQQA 2QEXF 2Z1UA 2DYYA 3JALB 5HY4A 5LP6A 3O85A 5GAPK 1ZWZA 1CN7A 1VK3A 1KNJA 2HP0A 3N2KB 5IJ0B 1RQ7A 2LCAA 1YGYA 3J7AR 1W41A 3CMAF 5B8FA 1DBFA 3G6EF 1NQ3A 5HWEA 5DCVA 1RA4A 5IT9M 5EZYA 3P4EA 5JQGB 2KTVA 4DRXB 4X1KB 2ZVYA 2HRUA 4ZHYB 4O4LB 3I56F 3NVIB 1Q86H 3VYTC 2H8CA 1Q82H 1W581 1W5AA 2Q1XA 2CHTA 3I7TA 1YITF 4TV9A 4LNUA 1VQ7F 5J2UA 3P10A 3M1XA 3TD3A 3I3FA 1RQ2A 3OW2F 1VQ4F 4X3MA 4C81A 3RYHA 4I55A 3WJQA 3CCSF 3JASB 3DDNA 3V7EA 4G88A 3RYFB 1Z5WA 3WJRA 2CSLA 1N8RH 2UYNB 5EB0A 2ZOVA 4FFBB 5EWRA 4BW0B 3RYIA 3CPWF 2UYKA 1XRGA 1YIJF 3FFMA 3DC2A 5CB4A 3SIVA 5C8YB 3CCUF 4O4HB 1OFUA 5BMVB 2B33A 3JALA 3CG6A 5LYJB 3CCJF 3N4YA 3E20B 3LDTA 1QU9A 5IJ0A 1NJIH 3ERNA 4BY9D 3UT5B 5GINC 4BT4A 2MQEA 4BVTA 2FGYA 4WBNB 1E7KA 2FC3A 3P0ZA 1M90H 3CYQA 4ZHVA 5JQGA 3LWPC 3EORA 3IKFA 1TUBA 1W59A 1CK2A 4ZOLB 4X1KA 2YXZA 2LBXA 3FBAA 2ZVZA 3WXMB 3CC2F 5EB1B 3VOBA 5FLXM 3IEQA 2ALEA 3HKBB 1DT9A 5JCOC 3RYCA 1U40A 3QTYA 5HXUA 2RHOA 1JFFA 2AMTA 3RA6A 1JJ2F 5AVMA 3NK7A 5EYPB 3ZP4A 3C9TA 3HKEB 5ITZB 1RLUA 5MN4A 1YJNF 4X20A 1VQLF 3JASA 1VQKF 5HY1A 3VCZA 3RYFA 1JD1A 3C9SA 3JATB 2N48A 4U3JB 2UYNA 4XCQA 3LMEA 4FFBA 4F6RB 3M84A 4ZK7A 1W5BA 1VHAA 2KG4A 3JAMM 4BVRA 5C8YA 3K0TA 4O4HA 4C8GA 4G4YA 3IMPA 5BMVA 2Z01A 3MCQA 5GIPC 5CA0A 3VMFB 5LYJA 4X1IA 4RQOA 3ZOPA 2R6R1 4ZHWA 4NUTA 1X25A 2QI2A 4O4JB 2G9IA 2PMPA 5GIOC 4O2BB 3UT5A 1VQPF 2CWJA 1YHQF 4X1YB 3D01A 3WGMA 5IYZA 3E22B 4EI9A
chains in the Genus database with same CATH topology
1K9MH 3CCSF 3CC4F 3V7EA 3V3TA 4EI7A 2I6DA 4EI8A 3IR9A 1GO0A 2CZWA 1N8RH 5EWRA 3NMUC 4BW0B 3JCMM 3CPWF 3CCLF 1Q7YH 1YIJF 1W42A 3FFMA 3SIVA 3HAXD 1KQSF 3CCUF 5HXZA 1RLGA 1YJ9F 2JNBA 1IPAA 3OBWA 3GYQA 3LWVC 3CG6A 2OTLF 1PXWA 3CCJF 3E1YA 1VQ5F 3N4YA 1SDSA 1GO1A 3E20B 3J81M 1VQNF 1Q81H 2BO1A 3SIUA 1S72F 5HY2A 1NJIH 3VI6A 4BY9D 5GINC 4C4WC 1K8AH 3PLAC 2GLZA 1W3EX 4BVTA 2FGYA 2KTUA 3J80M 1E7KA 2FC3A 5EO3A 1M90H 1T0KB 3OBYA 2F9ZC 1YJWF 3LWPC 2VGMA 3LWRC 3AGKA 1CK2A 3G71F 2AIFA 1YI2F 3MCAB 3CCQF 2LBXA 3CC2F 3CC7F 3WXMB 3NK6A 3CCRF 2WALA 5FLXM 4NQ3A 4LCKA 4X3LA 5HY0A 1X7PA 2OTJF 1H7MA 3ON1A 3G4SF 2ALEA 3LWOC 1DT9A 5GANK 1KC8H 5HXUA 1X7OA 2QEXF 5G4UC 3N4ZA 3D00A 5HY4A 2LBWA 3RA6A 3O85A 5GAPK 1ZWZA 1CN7A 1JJ2F 4BVQA 1NMUB 3NK7A 1YJNF 5G4VC 1QVFF 3J7AR 1VQ9F 1W40A 1W41A 1VQLF 3CMAF 1KD1H 1VQKF 4BVSA 5HY1A 3G6EF 3CCVF 3CCMF 3HJWC 1M1KH 5HWEA 5DCVA 1RA4A 2HVYD 5IT9M 4XCQA 3I55F 1VQ8F 2KTVA 1QVGF 3V7QA 3I56F 3NVIB 2KG4A 2OZBA 3CPQA 1X52A 4BVRA 3JAMM 4TZZA 1Q86H 3LFOA 3CXCF 3CCEF 1Q82H 2QA4F 1VQMF 1VQ6F 5GIPC 5FJ4C 1YITF 3CD6F 3VMFB 5A2QM 2OHWA 3PAFA 3CMEF 1VQ7F 1VQOF 1K73H 4NUTA 2QI2A 3LWQC 3NVKE 1XBIA 2VGNA 3RA5A 5GIOC 3OW2F 1VQPF 4X3MA 1VQ4F 1YHQF 1W2BF 4EI9A 1GZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M H;  3CCS F;  3CC4 F;  3V7E A;  2I6D A;  3IR9 A;  1GO0 A;  2CZW A;  1N8R H;  5EWR A;  3NMU C;  4BW0 B;  3JCM M;  3CPW F;  3CCL F;  1Q7Y H;  1YIJ F;  1W42 A;  3FFM A;  3SIV A;  3HAX D;  1KQS F;  3CCU F;  1RLG A;  1YJ9 F;  2JNB A;  1IPA A;  3OBW A;  3GYQ A;  3LWV C;  3CG6 A;  2OTL F;  1PXW A;  3CCJ F;  3E1Y A;  1VQ5 F;  3N4Y A;  1SDS A;  1GO1 A;  3E20 B;  3J81 M;  1VQN F;  1Q81 H;  2BO1 A;  3SIU A;  1S72 F;  1NJI H;  3VI6 A;  4BY9 D;  5GIN C;  1K8A H;  3PLA C;  1W3E X;  2KTU A;  3J80 M;  1E7K A;  2FC3 A;  5EO3 A;  1M90 H;  1T0K B;  3OBY A;  1YJW F;  3LWP C;  2VGM A;  3LWR C;  3AGK A;  1CK2 A;  3G71 F;  2AIF A;  1YI2 F;  3MCA B;  3CCQ F;  2LBX A;  3CC2 F;  3CC7 F;  3WXM B;  3NK6 A;  3CCR F;  2WAL A;  5FLX M;  4LCK A;  4X3L A;  1X7P A;  2OTJ F;  1H7M A;  3ON1 A;  3G4S F;  2ALE A;  3LWO C;  1DT9 A;  5GAN K;  1KC8 H;  1X7O A;  2QEX F;  5G4U C;  3N4Z A;  3RA6 A;  2LBW A;  3O85 A;  5GAP K;  1ZWZ A;  1CN7 A;  1JJ2 F;  1NMU B;  3NK7 A;  1YJN F;  5G4V C;  1QVF F;  3J7A R;  1VQ9 F;  1W40 A;  1W41 A;  1VQL F;  3CMA F;  1KD1 H;  1VQK F;  4C4W C;  3G6E F;  3CCV F;  3CCM F;  3HJW C;  1M1K H;  5DCV A;  1RA4 A;  2HVY D;  5IT9 M;  3I55 F;  1VQ8 F;  2KTV A;  1QVG F;  3V7Q A;  3I56 F;  3NVI B;  2KG4 A;  2OZB A;  3CPQ A;  1X52 A;  3JAM M;  4TZZ A;  1Q86 H;  3LFO A;  3CXC F;  3CCE F;  1Q82 H;  2QA4 F;  1VQM F;  1VQ6 F;  5GIP C;  5FJ4 C;  1YIT F;  3CD6 F;  3VMF B;  5A2Q M;  2OHW A;  3PAF A;  3CME F;  1VQ7 F;  1VQO F;  1K73 H;  4NUT A;  2QI2 A;  3LWQ C;  3NVK E;  1XBI A;  2VGN A;  3RA5 A;  5GIO C;  3OW2 F;  1VQP F;  4X3M A;  1VQ4 F;  1YHQ F;  1W2B F;  1GZ0 A; 
#chains in the Genus database with same CATH topology
 3S06 A;  1K9M H;  3CC4 F;  1H48 A;  5LXT B;  4BT7 A;  1GX1 A;  4ZOL A;  3IR9 A;  4IHJ A;  3JAW B;  3WPX A;  4EB6 B;  1QAH A;  4B45 A;  3KJK A;  2Z1T A;  3HKB A;  3VYS C;  3HAX D;  5EIB C;  1FNJ A;  2JNB A;  4B5C A;  5HP7 A;  4C82 A;  2RHL A;  3E1Y A;  1FNK A;  1GO1 A;  1VQN F;  5EYP A;  3J81 M;  3HKE A;  5ITZ A;  4KWE A;  1S72 F;  3ZO8 A;  1TVK B;  3VI6 A;  3HKC B;  2LBT A;  1IV1 A;  4TV8 B;  3PLA C;  2GLZ A;  1COM A;  1W3E X;  1U43 A;  3WGL A;  3BYQ A;  3QUW A;  1T0K B;  5JVD B;  2OTM A;  2BTU A;  2R75 1;  2VGM A;  4F6R A;  3LWR C;  1PF5 A;  4BT6 A;  1YI2 F;  2V9Y A;  3CCQ F;  3QHD A;  2P6Y A;  3WGN A;  3CCR F;  2EWC A;  2WAL A;  3F0D A;  1YQN A;  5LOV B;  4LCK A;  3U0O A;  5HY0 A;  1H7M A;  3ON1 A;  3N2K A;  4R40 B;  1KC8 H;  5KMG B;  4I4T B;  2HS4 A;  1XV2 A;  4O4I B;  2HS0 A;  3D00 A;  4O4J A;  4O2B A;  4X1Y A;  3HKD B;  1NMU B;  3F0G A;  3N2G B;  5LA6 B;  1QVF F;  4C4W C;  1W40 A;  4DRX A;  1KD1 H;  5MN5 A;  5LXT A;  3VOA A;  4O4L A;  3CCM F;  1M1K H;  1SA0 B;  2HVY D;  4G4V A;  2IAF A;  4M8I A;  1IV3 A;  3JAR B;  1UI9 A;  1H47 A;  3TD4 A;  4EB6 A;  3MQW A;  5MN6 A;  3V7Q A;  2VAP A;  3F6M A;  3KE1 A;  1X52 A;  3F0E A;  4IIJ B;  2VAW A;  3LFO A;  5FNV B;  2AIZ P;  2QA4 F;  1VQM F;  1VQ6 F;  5FJ4 C;  3FPI A;  5A2Q M;  2OHW A;  3PAF A;  4ZI7 B;  1U3L A;  4TUY B;  4NWO B;  1K73 H;  3ESJ A;  2VXY A;  3LWQ C;  1TVK A;  2VGN A;  2ZAU A;  3RA5 A;  2Z1F A;  3HKC A;  3ZP7 A;  3NVK E;  4TV8 A;  1W2B F;  4LNU B;  5LP6 C;  3WPW A;  5HP8 A;  5JVD A;  2BTO A;  4ZHQ B;  3WJP A;  5GON B;  2KGW A;  4EI7 A;  2I6D A;  2RHJ A;  4EI8 A;  3OON A;  1GO0 A;  2CZW A;  2HS3 A;  2CHS A;  2W8B C;  3NMU C;  3FD6 A;  5LOV A;  4HNA B;  3HWU A;  4B46 A;  1U3P A;  3JAK B;  3S03 A;  5J2T B;  5HXZ A;  1RLG A;  5KMG A;  3VO8 A;  4I4T A;  4O4I A;  1IPA A;  1W55 A;  3GYQ A;  3D54 A;  3T80 A;  1ONI A;  1VQ5 F;  4WBN A;  1SDS A;  3SIU A;  1XHO A;  5HY2 A;  3F0F A;  3N2G A;  5LA6 A;  1K8A H;  1Z5V A;  3VYU C;  4B62 A;  3C8L A;  2KTU A;  3J80 M;  1SA0 A;  3OBY A;  1YJW F;  2HX0 A;  2HRY A;  3JAR A;  2RB9 A;  1QD9 A;  2QTP A;  3AGK A;  4C8E A;  3G71 F;  3CYP B;  2AIF A;  3CC7 F;  3IKE A;  1OAP A;  4IIJ A;  5FNV A;  3R0P A;  3VIU A;  4G4X A;  3C9R A;  4NQ3 A;  4G4W A;  4X3L A;  5IJ9 B;  1W57 A;  1TUB B;  1X7P A;  3KJJ A;  2OTJ F;  3G4S F;  5GAN K;  4ZI7 A;  2NMU A;  4TUY A;  2H6L A;  1X7O A;  5G4U C;  3N4Z A;  5EAZ A;  4BT2 A;  2LBW A;  1R1M A;  1JN1 A;  4BVQ A;  1FFX B;  3JAT A;  3RYC B;  4U3J A;  5KX5 B;  3Q8H A;  3V4D A;  3S0Y A;  4DXD A;  3KIZ A;  5G4V C;  2VAM A;  1JFF B;  1VQ9 F;  4ZHQ A;  3MDO A;  4BVS A;  5GON A;  3GTZ A;  3CCV F;  3HJW C;  4YJ2 B;  2Q1Y A;  1KNK A;  3B6N A;  2HP3 A;  3I55 F;  3GHZ A;  2CW4 A;  1VQ8 F;  3HTN A;  2UYJ A;  4X20 B;  3RE3 A;  4HNA A;  5JH7 B;  4BT5 A;  1QVG F;  4PWT A;  4U39 A;  1FSZ A;  1SZQ A;  3JAK A;  3TD5 A;  2OZB A;  3CPQ A;  5J2T A;  4E6E A;  4TZZ A;  4YJ3 B;  3CXC F;  4O2A B;  3CCE F;  2YYE A;  1JY8 A;  3IEW A;  5EIB D;  1VQV A;  1UFY A;  3E22 A;  4I50 B;  5CA1 B;  3CME F;  3CD6 F;  2I6R A;  1VQO F;  1XBI A;  1T0A A;  5LP6 B;  5CA0 B;  4ERH A;  1VH8 A;  2GZL A;  3FD5 A;  4RHA A;  3JAW A;  4X1I B;  3KHN A;  2HP0 B;  1GZ0 A;  3JVH A;  2GVI A;  1W5E A;  3L7Q A;  3K2X A;  4G4Z A;  3S0W A;  3S02 A;  3V3T A;  1CLI A;  5IYZ B;  4BT3 A;  3M4S A;  2DT4 A;  5EZY B;  2PHN A;  3WGK A;  2RHH A;  2BTQ B;  3JCM M;  5IJ9 A;  3CCL F;  1Q7Y H;  1J7H A;  1W42 A;  4IHJ B;  2UYP A;  1KQS F;  1YJ9 F;  2HQS C;  1IV2 A;  3K12 A;  1IV4 A;  3OBW A;  3LWV C;  2H8E A;  2OTL F;  1PXW A;  4TV9 B;  2ZF8 A;  5J2U B;  1FFX A;  1Q81 H;  3MBM A;  2BO1 A;  3ELC A;  5KX5 A;  3S0H A;  3C9U A;  3VTI C;  1W5F A;  3RYH B;  2ZOD A;  1ODE A;  4I55 B;  2L26 A;  4YJ2 A;  5EO3 A;  2F9Z C;  3K14 A;  5JCO A;  5JH7 A;  2UZH A;  1Q8R A;  3MCA B;  2K1S A;  2Z1E A;  2IG8 A;  3WGJ A;  2CVL A;  3NK6 A;  3LYB A;  3CB2 A;  4YJ3 A;  4O2A A;  4C8I A;  3RYI B;  3LWO C;  3HKD A;  4I50 A;  5CA1 A;  5CB4 B;  2IQQ A;  2QEX F;  2Z1U A;  2DYY A;  3JAL B;  5HY4 A;  5LP6 A;  3O85 A;  5GAP K;  1ZWZ A;  1CN7 A;  1VK3 A;  1KNJ A;  2HP0 A;  3N2K B;  5IJ0 B;  1RQ7 A;  2LCA A;  1YGY A;  3J7A R;  1W41 A;  3CMA F;  5B8F A;  1DBF A;  3G6E F;  1NQ3 A;  5HWE A;  5DCV A;  1RA4 A;  5IT9 M;  5EZY A;  3P4E A;  5JQG B;  2KTV A;  4DRX B;  4X1K B;  2ZVY A;  2HRU A;  4ZHY B;  4O4L B;  3I56 F;  3NVI B;  1Q86 H;  3VYT C;  2H8C A;  1Q82 H;  1W58 1;  1W5A A;  2Q1X A;  2CHT A;  3I7T A;  1YIT F;  4TV9 A;  4LNU A;  1VQ7 F;  5J2U A;  3P10 A;  3M1X A;  3TD3 A;  3I3F A;  1RQ2 A;  3OW2 F;  1VQ4 F;  4X3M A;  4C81 A;  3RYH A;  4I55 A;  3WJQ A;  3CCS F;  3JAS B;  3DDN A;  3V7E A;  4G88 A;  3RYF B;  1Z5W A;  3WJR A;  2CSL A;  1N8R H;  2UYN B;  5EB0 A;  2ZOV A;  4FFB B;  5EWR A;  4BW0 B;  3RYI A;  3CPW F;  2UYK A;  1XRG A;  1YIJ F;  3FFM A;  3DC2 A;  5CB4 A;  3SIV A;  5C8Y B;  3CCU F;  4O4H B;  1OFU A;  5BMV B;  2B33 A;  3JAL A;  3CG6 A;  5LYJ B;  3CCJ F;  3N4Y A;  3E20 B;  3LDT A;  1QU9 A;  5IJ0 A;  1NJI H;  3ERN A;  4BY9 D;  3UT5 B;  5GIN C;  4BT4 A;  2MQE A;  4BVT A;  2FGY A;  4WBN B;  1E7K A;  2FC3 A;  3P0Z A;  1M90 H;  3CYQ A;  4ZHV A;  5JQG A;  3LWP C;  3EOR A;  3IKF A;  1TUB A;  1W59 A;  1CK2 A;  4ZOL B;  4X1K A;  2YXZ A;  2LBX A;  3FBA A;  2ZVZ A;  3WXM B;  3CC2 F;  5EB1 B;  3VOB A;  5FLX M;  3IEQ A;  2ALE A;  3HKB B;  1DT9 A;  5JCO C;  3RYC A;  1U40 A;  3QTY A;  5HXU A;  2RHO A;  1JFF A;  2AMT A;  3RA6 A;  1JJ2 F;  5AVM A;  3NK7 A;  5EYP B;  3ZP4 A;  3C9T A;  3HKE B;  5ITZ B;  1RLU A;  5MN4 A;  1YJN F;  4X20 A;  1VQL F;  3JAS A;  1VQK F;  5HY1 A;  3VCZ A;  3RYF A;  1JD1 A;  3C9S A;  3JAT B;  2N48 A;  4U3J B;  2UYN A;  4XCQ A;  3LME A;  4FFB A;  4F6R B;  3M84 A;  4ZK7 A;  1W5B A;  1VHA A;  2KG4 A;  3JAM M;  4BVR A;  5C8Y A;  3K0T A;  4O4H A;  4C8G A;  4G4Y A;  3IMP A;  5BMV A;  2Z01 A;  3MCQ A;  5GIP C;  5CA0 A;  3VMF B;  5LYJ A;  4X1I A;  4RQO A;  3ZOP A;  2R6R 1;  4ZHW A;  4NUT A;  1X25 A;  2QI2 A;  4O4J B;  2G9I A;  2PMP A;  5GIO C;  4O2B B;  3UT5 A;  1VQP F;  2CWJ A;  1YHQ F;  4X1Y B;  3D01 A;  3WGM A;  5IYZ A;  3E22 B;  4EI9 A; 
#chains in the Genus database with same CATH homology
 1K9M H;  3CCS F;  3CC4 F;  3V7E A;  3V3T A;  4EI7 A;  2I6D A;  4EI8 A;  3IR9 A;  1GO0 A;  2CZW A;  1N8R H;  5EWR A;  3NMU C;  4BW0 B;  3JCM M;  3CPW F;  3CCL F;  1Q7Y H;  1YIJ F;  1W42 A;  3FFM A;  3SIV A;  3HAX D;  1KQS F;  3CCU F;  5HXZ A;  1RLG A;  1YJ9 F;  2JNB A;  1IPA A;  3OBW A;  3GYQ A;  3LWV C;  3CG6 A;  2OTL F;  1PXW A;  3CCJ F;  3E1Y A;  1VQ5 F;  3N4Y A;  1SDS A;  1GO1 A;  3E20 B;  3J81 M;  1VQN F;  1Q81 H;  2BO1 A;  3SIU A;  1S72 F;  5HY2 A;  1NJI H;  3VI6 A;  4BY9 D;  5GIN C;  4C4W C;  1K8A H;  3PLA C;  2GLZ A;  1W3E X;  4BVT A;  2FGY A;  2KTU A;  3J80 M;  1E7K A;  2FC3 A;  5EO3 A;  1M90 H;  1T0K B;  3OBY A;  2F9Z C;  1YJW F;  3LWP C;  2VGM A;  3LWR C;  3AGK A;  1CK2 A;  3G71 F;  2AIF A;  1YI2 F;  3MCA B;  3CCQ F;  2LBX A;  3CC2 F;  3CC7 F;  3WXM B;  3NK6 A;  3CCR F;  2WAL A;  5FLX M;  4NQ3 A;  4LCK A;  4X3L A;  5HY0 A;  1X7P A;  2OTJ F;  1H7M A;  3ON1 A;  3G4S F;  2ALE A;  3LWO C;  1DT9 A;  5GAN K;  1KC8 H;  5HXU A;  1X7O A;  2QEX F;  5G4U C;  3N4Z A;  3D00 A;  5HY4 A;  2LBW A;  3RA6 A;  3O85 A;  5GAP K;  1ZWZ A;  1CN7 A;  1JJ2 F;  4BVQ A;  1NMU B;  3NK7 A;  1YJN F;  5G4V C;  1QVF F;  3J7A R;  1VQ9 F;  1W40 A;  1W41 A;  1VQL F;  3CMA F;  1KD1 H;  1VQK F;  4BVS A;  5HY1 A;  3G6E F;  3CCV F;  3CCM F;  3HJW C;  1M1K H;  5HWE A;  5DCV A;  1RA4 A;  2HVY D;  5IT9 M;  4XCQ A;  3I55 F;  1VQ8 F;  2KTV A;  1QVG F;  3V7Q A;  3I56 F;  3NVI B;  2KG4 A;  2OZB A;  3CPQ A;  1X52 A;  4BVR A;  3JAM M;  4TZZ A;  1Q86 H;  3LFO A;  3CXC F;  3CCE F;  1Q82 H;  2QA4 F;  1VQM F;  1VQ6 F;  5GIP C;  5FJ4 C;  1YIT F;  3CD6 F;  3VMF B;  5A2Q M;  2OHW A;  3PAF A;  3CME F;  1VQ7 F;  1VQO F;  1K73 H;  4NUT A;  2QI2 A;  3LWQ C;  3NVK E;  1XBI A;  2VGN A;  3RA5 A;  5GIO C;  3OW2 F;  1VQP F;  4X3M A;  1VQ4 F;  1YHQ F;  1W2B F;  4EI9 A;  1GZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...