3CG6A

Crystal structure of gadd45 gamma
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
131
Chain Sequence
TARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVDLHCILISNPNWKDPALEKLSLFCEESRSFNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure and dimerization interface of GADD45gamma.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
molecule keywords Growth arrest and DNA-damage-inducible 45 gamma
total genus 43
structure length 131
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cg6A00
1XBIA 3NK6A 1VQ5F 1X7PA 3CCSF 1ZWZA 1VQ4F 3I56F 2OTLF 5EO3A 2OTJF 1KC8H 1KD1H 5GANK 1GO0A 1VQ6F 3OBYA 2BO1A 2KTUA 3CD6F 1VQ7F 3CCJF 2CZWA 1W3EX 1M90H 2KTVA 1YI2F 5A2QM 3J7AR 1W42A 3VI6A 3PLAC 1YJNF 3SIVA 1VQ8F 2QI2A 1SDSA 2OHWA 1Q7YH 3RA6A 3CC7F 3V7QA 3I55F 3OBWA 4BW0B 3LWVC 3NK7A 1JJ2F 1RLGA 3NMUC 1T0KB 3CPWF 3PAFA 3LWQC 2WALA 1YHQF 4C4WC 3G4SF 3G71F 3IR9A 3CC4F 5GIOC 1Q86H 1X52A 1K73H 5G4UC 3J81M 2QEXF 5IT9M 1VQMF 4LCKA 2VGNA 2ALEA 3LWRC 3ON1A 2JNBA 1VQLF 2AIFA 5GINC 1VQOF 3V7EA 1RA4A 5GIPC 2KG4A 5GAPK 1VQNF 5FLXM 3WXMB 1W40A 1M1KH 3CCMF 1YITF 1NMUB 3CCEF 1K8AH 3NVKE 1CK2A 1S72F 2FC3A 3FFMA 3CCLF 3SIUA 2LBWA 1W41A 1GZ0A 3CPQA 3AGKA 3CCRF 1X7OA 1N8RH 3VMFB 4BY9D 2LBXA 3N4YA 1K9MH 3RA5A 4X3LA 3CCQF 3CG6A 3LFOA 1W2BF 2VGMA 3CCVF 1YJ9F 5G4VC 1VQPF 2OZBA 5FJ4C 1GO1A 3GYQA 3CMEF 3CCUF 1NJIH 3O85A 1H7MA 3MCAB 4X3MA 5EWRA 1PXWA 3N4ZA 3E20B 1QVGF 3J80M 1VQKF 1QVFF 3OW2F 1Q81H 3HJWC 1YJWF 1IPAA 3NVIB 3CC2F 3LWPC 4TZZA 2I6DA 3LWOC 3CXCF 5DCVA 1DT9A 4NUTA 1Q82H 3JAMM 3JCMM 1CN7A 2QA4F 3HAXD 3E1YA 3G6EF 3CMAF 1YIJF 2HVYD 1E7KA 1VQ9F 1KQSF
chains in the Genus database with same CATH superfamily
3D54A 4X1IA 1VQ5F 2I6RA 3CCSF 1ZWZA 4C82A 3I56F 5EO3A 1JFFA 4B5CA 1RLUA 1RQ2A 1KD1H 5GANK 5CB4B 3C9TA 5ITZB 3I7TA 4TV8B 4O4LA 5LA6B 1YGYA 3JASB 1ONIA 4TUYB 2YXZA 2BTOA 4ZOLA 5JCOA 3CYPB 5MN6A 2LCAA 2RHOA 2QI2A 4G88A 2OHWA 1IV1A 5EB1B 5EB0A 3I55F 3FBAA 1JJ2F 5IJ9A 3CPWF 3F0GA 3JAKB 2WALA 4G4YA 3G4SF 3CC4F 5GIOC 1Q86H 3VOAA 3MCQA 3WGKA 2QEXF 1VQMF 5HP7A 2ALEA 4O4HB 2KGWA 2AIFA 1RA4A 4M8IA 5LA6A 1IV2A 5GIPC 5GAPK 2CVLA 2B33A 3WXMB 4BVRA 4BT7A 3CCMF 3RYCA 3NVKE 4YJ2B 4B62A 3JATA 4I55A 5CA0A 3CPQA 2HS0A 2PHNA 5KMGA 3VMFB 1VQVA 4R40B 3E22B 3HKEB 4YJ3A 2F9ZC 3C9SA 4ZI7B 2PMPA 5CA1B 2R6R1 2IG8A 4X3LA 3CCQF 3CG6A 3FD6A 2HQSC 5HXZA 2OZBA 3GYQA 3CMEF 3CCUF 1FNJA 3O85A 1H7MA 3S0WA 3CB2A 3N4ZA 3E22A 3HKEA 5AVMA 4O4IB 3HKBA 4EI7A 3JAWA 3FPIA 4YJ3B 4X20B 3VOBA 4I50A 5LP6B 1VHAA 1U40A 4C8EA 3LWOC 3VYTC 2RHHA 4O2BB 4IIJA 1DT9A 3KE1A 5KX5B 4YJ2A 3JAMM 3JCMM 4O4IA 1VH8A 2Z1TA 3F0FA 2ZF8A 3P0ZA 1R1MA 3E1YA 1T0AA 3TD5A 2HS4A 4F6RB 2H6LA 3IKFA 3VCZA 1GX1A 4RHAA 4C81A 2VXYA 1ODEA 1TUBB 2UYJA 2CHTA 4BVQA 1KQSF 1JN1A 1PF5A 5J2TB 3VYSC 4TV9B 3TD4A 3NK6A 1X7PA 2RB9A 3JALA 5BMVA 4E6EA 2OTLF 3JAKA 4TV9A 3L7QA 1W5FA 3ELCA 1FFXB 1GO0A 1VQ6F 5GONB 5EIBD 1W3EX 1M90H 3S06A 3J7AR 1YI2F 2CW4A 5EZYA 3WGJA 4ERHA 2FGYA 1VQ8F 4FFBB 3FD5A 4BW0B 3OBWA 4I50B 5LP6A 3NK7A 5J2UB 5HWEA 1T0KB 4C8IA 5CA0B 3PAFA 1KNKA 3UT5B 2N48A 5LXTA 1H48A 3G71F 2VAMA 5LOVA 1X52A 1K73H 4ZHQA 5MN5A 5MN4A 4DRXA 5HXUA 3WJPA 3ERNA 2K1SA 5GINC 4C8GA 3V7EA 2KG4A 4NQ3A 4O4HA 1W40A 3QHDA 1FNKA 2HS3A 3ZOPA 3S0YA 1NMUB 3ZO8A 2H8EA 1W59A 3LDTA 2H8CA 5C8YA 1W41A 2BTQB 3AGKA 5LXTB 4O4JA 3GHZA 1UFYA 3N2GA 4BT4A 2L26A 3M1XA 1K9MH 1W581 3JARA 4DXDA 4ZK7A 1J7HA 4G4ZA 3F6MA 5IYZA 5G4VC 5JH7B 1NJIH 5HP8A 4X3MA 1U3PA 3IMPA 3WPWA 3E20B 1QVGF 1UI9A 3N2GB 1QVFF 4IHJB 3JARB 1Q81H 5JVDB 3HJWC 1IPAA 3LYBA 3IEQA 4I4TB 1KNJA 3LWPC 2V9YA 1IV3A 1X25A 3HKBB 3JAWB 2I6DA 3N2KB 3C9UA 5LP6C 4IHJA 2VAWA 5EYPA 1Z5WA 3V3TA 4F6RA 3GTZA 2ZODA 1YIJF 3R0PA 3S02A 2HVYD 3DDNA 2MQEA 1FSZA 3RYHA 5LOVB 1U43A 3B6NA 3ZP4A 1XBIA 1JFFB 1IV4A 3D01A 1VQ4F 3UT5A 2OTJF 4FFBA 2RHLA 3OONA 4BT5A 4NWOB 5J2UA 1KC8H 3WGLA 2BO1A 2KTUA 3CD6F 3CCJF 4B45A 5GONA 2CZWA 1FFXA 5A2QM 1H47A 1W42A 2R751 1YJNF 4O2AB 2UZHA 2CSLA 4X1YA 3V7QA 4B46A 1XRGA 3RYIA 3NMUC 1W5AA 2CHSA 4BT2A 3LWQC 5IJ9B 5KMGB 4C4WC 3IR9A 4HNAA 3J81M 2W8BC 5IT9M 2UYPA 3Q8HA 3ON1A 2JNBA 3K2XA 3MDOA 3K12A 1VQOF 4U3JB 4O4LB 5FLXM 2EWCA 2IAFA 1W5BA 1M1KH 1YITF 1W5EA 4G4XA 4ZHQB 4EI9A 1CK2A 1S72F 2FC3A 5KX5A 3FFMA 3KJKA 3SIUA 4ZHYB 3F0EA 3KHNA 3C9RA 1U3LA 1X7OA 3HTNA 1N8RH 3TD3A 3K0TA 4LNUB 5J2TA 1JY8A 3N4YA 3QTYA 2BTUA 4BT3A 3M4SA 1CLIA 3LFOA 2G9IA 3CCVF 1YJ9F 1VQPF 1GO1A 1NQ3A 2DYYA 3D00A 1JD1A 4X1KA 3MCAB 3HKCA 5EWRA 1PXWA 5FNVA 5B8FA 1W55A 4LNUA 1QU9A 2UYKA 1VQKF 2AMTA 4DRXB 3OW2F 3MQWA 4EI8A 4RQOA 3NVIB 5HY0A 2UYNA 3CC2F 1DBFA 1TVKA 4BVTA 5HY2A 4TZZA 2P6YA 5DCVA 1Q82H 3JATB 5EAZA 4EB6A 1CN7A 2QA4F 2QTPA 5EZYB 3HKCB 5FNVB 3T80A 3CMAF 3EORA 3CYQA 4EB6B 4ZHVA 2HX0A 4U3JA 1E7KA 1VQ9F 3WGNA 4HNAB 4O4JB 2IQQA 3JALB 5BMVB 1XV2A 3KIZA 3K14A 4KWEA 1YQNA 2HRUA 2CWJA 5JVDA 3I3FA 3JVHA 3WJRA 3OBYA 4TUYA 3VIUA 2ZVYA 2HP0A 1VQ7F 2KTVA 2NMUA 3C8LA 3M84A 4ZI7A 1W57A 3VI6A 3PLAC 5EIBC 3IKEA 3SIVA 2GVIA 1SDSA 1Q7YH 3RA6A 2YYEA 3CC7F 1SZQA 3LWVC 1TVKB 1RLGA 2LBTA 2Z1UA 4X1IB 2Z01A 3S03A 1YHQF 3V4DA 4U39A 3HWUA 5IJ0A 2Q1YA 1Q8RA 2UYNB 5G4UC 4X20A 3U0OA 1OAPA 2GLZA 3KJJA 3QUWA 2AIZP 3RYHB 5LYJA 2VGNA 4LCKA 4X1KB 3LWRC 1VQLF 3ESJA 3MBMA 2HP0B 3ZP7A 1VQNF 4ZOLB 3RYFA 2RHJA 4BT6A 3P4EA 2HRYA 4G4VA 3F0DA 3CCEF 1K8AH 5CA1A 5LYJB 3N2KA 1OFUA 3DC2A 3CCLF 2LBWA 3VTIC 4BVSA 1GZ0A 4I55B 3LMEA 4PWTA 3S0HA 3CCRF 3BYQA 1TUBA 4WBNA 2Q1XA 1QAHA 2HP3A 1XHOA 4O2AA 4BY9D 2LBXA 4XCQA 3VO8A 2VAPA 3RA5A 3WJQA 1VK3A 2Z1EA 5HY4A 3RYCB 1W2BF 2VGMA 3WGMA 5FJ4C 2ZOVA 5ITZA 5JH7A 3P10A 5IYZB 4O2BA 5JQGA 1SA0B 3J80M 4WBNB 5HY1A 1Z5VA 2OTMA 1YJWF 2ZAUA 2GZLA 4I4TA 4ZHWA 4G4WA 4X1YB 2ZVZA 5C8YB 3CXCF 3HKDB 3RYIB 4NUTA 1RQ7A 3RYFB 1SA0A 3HAXD 5JQGB 3RE3A 2DT4A 3G6EF 5EYPB 4TV8A 3IEWA 3WPXA 2Z1FA 3JASA 3VYUC 3HKDA 1QD9A 1COMA 5CB4A 5JCOC 5IJ0B 4IIJB
chains in the Genus database with same CATH topology
1XBIA 3NK6A 1VQ5F 1X7PA 3CCSF 1ZWZA 1VQ4F 3I56F 2OTLF 5EO3A 2OTJF 1KC8H 1KD1H 5GANK 1GO0A 1VQ6F 3OBYA 2BO1A 2KTUA 3CD6F 1VQ7F 3CCJF 2CZWA 1W3EX 1M90H 2KTVA 1YI2F 5A2QM 3J7AR 1W42A 3VI6A 3PLAC 1YJNF 2FGYA 1VQ8F 3SIVA 2QI2A 1SDSA 2OHWA 1Q7YH 3RA6A 3CC7F 3V7QA 3OBWA 4BW0B 3LWVC 3NK7A 5HWEA 3I55F 1JJ2F 1RLGA 3NMUC 1T0KB 3CPWF 3PAFA 3LWQC 2WALA 1YHQF 4C4WC 3G4SF 3G71F 3IR9A 3CC4F 5GIOC 1Q86H 1X52A 1K73H 5G4UC 3J81M 2GLZA 2QEXF 5IT9M 1VQMF 4LCKA 2VGNA 2ALEA 3LWRC 5HXUA 3ON1A 2JNBA 1VQLF 2AIFA 5GINC 1VQOF 3V7EA 1RA4A 5GIPC 2KG4A 5GAPK 1VQNF 5FLXM 3WXMB 4NQ3A 1W40A 4BVRA 1M1KH 3CCMF 1YITF 1NMUB 4EI9A 3CCEF 1K8AH 3NVKE 1CK2A 1S72F 2FC3A 3FFMA 3CCLF 3SIUA 2LBWA 4BVSA 1W41A 1GZ0A 3CPQA 3AGKA 3CCRF 1X7OA 1N8RH 3VMFB 4BY9D 2LBXA 4XCQA 2F9ZC 3N4YA 1K9MH 3RA5A 4X3LA 3CCQF 5HY4A 3CG6A 3LFOA 1W2BF 2VGMA 3CCVF 5HXZA 1YJ9F 5G4VC 1VQPF 2OZBA 5FJ4C 1GO1A 3GYQA 3D00A 3CMEF 3CCUF 1NJIH 3O85A 1H7MA 3MCAB 4X3MA 5EWRA 1PXWA 3N4ZA 3E20B 1QVGF 3J80M 1VQKF 1QVFF 5HY1A 3OW2F 4EI7A 1Q81H 3HJWC 4EI8A 1YJWF 1IPAA 3NVIB 5HY0A 3CC2F 4BVTA 5HY2A 3LWPC 4TZZA 2I6DA 3LWOC 3CXCF 5DCVA 1DT9A 4NUTA 1Q82H 3JAMM 3JCMM 1CN7A 2QA4F 3HAXD 3E1YA 3G6EF 3V3TA 3CMAF 1YIJF 2HVYD 1E7KA 1VQ9F 4BVQA 1KQSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBI A;  3NK6 A;  1VQ5 F;  1X7P A;  3CCS F;  1ZWZ A;  1VQ4 F;  3I56 F;  2OTL F;  5EO3 A;  2OTJ F;  1KC8 H;  1KD1 H;  5GAN K;  1GO0 A;  1VQ6 F;  3OBY A;  2BO1 A;  2KTU A;  3CD6 F;  1VQ7 F;  3CCJ F;  2CZW A;  1W3E X;  1M90 H;  2KTV A;  1YI2 F;  5A2Q M;  3J7A R;  1W42 A;  3VI6 A;  3PLA C;  1YJN F;  3SIV A;  1VQ8 F;  2QI2 A;  1SDS A;  2OHW A;  1Q7Y H;  3RA6 A;  3CC7 F;  3V7Q A;  3I55 F;  3OBW A;  4BW0 B;  3LWV C;  3NK7 A;  1JJ2 F;  1RLG A;  3NMU C;  1T0K B;  3CPW F;  3PAF A;  3LWQ C;  2WAL A;  1YHQ F;  4C4W C;  3G4S F;  3G71 F;  3IR9 A;  3CC4 F;  5GIO C;  1Q86 H;  1X52 A;  1K73 H;  5G4U C;  3J81 M;  2QEX F;  5IT9 M;  1VQM F;  4LCK A;  2VGN A;  2ALE A;  3LWR C;  3ON1 A;  2JNB A;  1VQL F;  2AIF A;  5GIN C;  1VQO F;  3V7E A;  1RA4 A;  5GIP C;  2KG4 A;  5GAP K;  1VQN F;  5FLX M;  3WXM B;  1W40 A;  1M1K H;  3CCM F;  1YIT F;  1NMU B;  3CCE F;  1K8A H;  3NVK E;  1CK2 A;  1S72 F;  2FC3 A;  3FFM A;  3CCL F;  3SIU A;  2LBW A;  1W41 A;  1GZ0 A;  3CPQ A;  3AGK A;  3CCR F;  1X7O A;  1N8R H;  3VMF B;  4BY9 D;  2LBX A;  3N4Y A;  1K9M H;  3RA5 A;  4X3L A;  3CCQ F;  3CG6 A;  3LFO A;  1W2B F;  2VGM A;  3CCV F;  1YJ9 F;  5G4V C;  1VQP F;  2OZB A;  5FJ4 C;  1GO1 A;  3GYQ A;  3CME F;  3CCU F;  1NJI H;  3O85 A;  1H7M A;  3MCA B;  4X3M A;  5EWR A;  1PXW A;  3N4Z A;  3E20 B;  1QVG F;  3J80 M;  1VQK F;  1QVF F;  3OW2 F;  1Q81 H;  3HJW C;  1YJW F;  1IPA A;  3NVI B;  3CC2 F;  3LWP C;  4TZZ A;  2I6D A;  3LWO C;  3CXC F;  5DCV A;  1DT9 A;  4NUT A;  1Q82 H;  3JAM M;  3JCM M;  1CN7 A;  2QA4 F;  3HAX D;  3E1Y A;  3G6E F;  3CMA F;  1YIJ F;  2HVY D;  1E7K A;  1VQ9 F;  1KQS F; 
#chains in the Genus database with same CATH topology
 3D54 A;  4X1I A;  1VQ5 F;  2I6R A;  3CCS F;  1ZWZ A;  4C82 A;  3I56 F;  5EO3 A;  1JFF A;  4B5C A;  1RLU A;  1RQ2 A;  1KD1 H;  5GAN K;  5CB4 B;  3C9T A;  5ITZ B;  3I7T A;  4TV8 B;  4O4L A;  5LA6 B;  1YGY A;  3JAS B;  1ONI A;  4TUY B;  2YXZ A;  2BTO A;  4ZOL A;  5JCO A;  3CYP B;  5MN6 A;  2LCA A;  2RHO A;  2QI2 A;  4G88 A;  2OHW A;  1IV1 A;  5EB1 B;  5EB0 A;  3I55 F;  3FBA A;  1JJ2 F;  5IJ9 A;  3CPW F;  3F0G A;  3JAK B;  2WAL A;  4G4Y A;  3G4S F;  3CC4 F;  5GIO C;  1Q86 H;  3VOA A;  3MCQ A;  3WGK A;  2QEX F;  1VQM F;  5HP7 A;  2ALE A;  4O4H B;  2KGW A;  2AIF A;  1RA4 A;  4M8I A;  5LA6 A;  1IV2 A;  5GIP C;  5GAP K;  2CVL A;  2B33 A;  3WXM B;  4BVR A;  4BT7 A;  3CCM F;  3RYC A;  3NVK E;  4YJ2 B;  4B62 A;  3JAT A;  4I55 A;  5CA0 A;  3CPQ A;  2HS0 A;  2PHN A;  5KMG A;  3VMF B;  1VQV A;  4R40 B;  3E22 B;  3HKE B;  4YJ3 A;  2F9Z C;  3C9S A;  4ZI7 B;  2PMP A;  5CA1 B;  2R6R 1;  2IG8 A;  4X3L A;  3CCQ F;  3CG6 A;  3FD6 A;  2HQS C;  5HXZ A;  2OZB A;  3GYQ A;  3CME F;  3CCU F;  1FNJ A;  3O85 A;  1H7M A;  3S0W A;  3CB2 A;  3N4Z A;  3E22 A;  3HKE A;  5AVM A;  4O4I B;  3HKB A;  4EI7 A;  3JAW A;  3FPI A;  4YJ3 B;  4X20 B;  3VOB A;  4I50 A;  5LP6 B;  1VHA A;  1U40 A;  4C8E A;  3LWO C;  3VYT C;  2RHH A;  4O2B B;  4IIJ A;  1DT9 A;  3KE1 A;  5KX5 B;  4YJ2 A;  3JAM M;  3JCM M;  4O4I A;  1VH8 A;  2Z1T A;  3F0F A;  2ZF8 A;  3P0Z A;  1R1M A;  3E1Y A;  1T0A A;  3TD5 A;  2HS4 A;  4F6R B;  2H6L A;  3IKF A;  3VCZ A;  1GX1 A;  4RHA A;  4C81 A;  2VXY A;  1ODE A;  1TUB B;  2UYJ A;  2CHT A;  4BVQ A;  1KQS F;  1JN1 A;  1PF5 A;  5J2T B;  3VYS C;  4TV9 B;  3TD4 A;  3NK6 A;  1X7P A;  2RB9 A;  3JAL A;  5BMV A;  4E6E A;  2OTL F;  3JAK A;  4TV9 A;  3L7Q A;  1W5F A;  3ELC A;  1FFX B;  1GO0 A;  1VQ6 F;  5GON B;  5EIB D;  1W3E X;  1M90 H;  3S06 A;  3J7A R;  1YI2 F;  2CW4 A;  5EZY A;  3WGJ A;  4ERH A;  2FGY A;  1VQ8 F;  4FFB B;  3FD5 A;  4BW0 B;  3OBW A;  4I50 B;  5LP6 A;  3NK7 A;  5J2U B;  5HWE A;  1T0K B;  4C8I A;  5CA0 B;  3PAF A;  1KNK A;  3UT5 B;  2N48 A;  5LXT A;  1H48 A;  3G71 F;  2VAM A;  5LOV A;  1X52 A;  1K73 H;  4ZHQ A;  5MN5 A;  5MN4 A;  4DRX A;  5HXU A;  3WJP A;  3ERN A;  2K1S A;  5GIN C;  4C8G A;  3V7E A;  2KG4 A;  4NQ3 A;  4O4H A;  1W40 A;  3QHD A;  1FNK A;  2HS3 A;  3ZOP A;  3S0Y A;  1NMU B;  3ZO8 A;  2H8E A;  1W59 A;  3LDT A;  2H8C A;  5C8Y A;  1W41 A;  2BTQ B;  3AGK A;  5LXT B;  4O4J A;  3GHZ A;  1UFY A;  3N2G A;  4BT4 A;  2L26 A;  3M1X A;  1K9M H;  1W58 1;  3JAR A;  4DXD A;  4ZK7 A;  1J7H A;  4G4Z A;  3F6M A;  5IYZ A;  5G4V C;  5JH7 B;  1NJI H;  5HP8 A;  4X3M A;  1U3P A;  3IMP A;  3WPW A;  3E20 B;  1QVG F;  1UI9 A;  3N2G B;  1QVF F;  4IHJ B;  3JAR B;  1Q81 H;  5JVD B;  3HJW C;  1IPA A;  3LYB A;  3IEQ A;  4I4T B;  1KNJ A;  3LWP C;  2V9Y A;  1IV3 A;  1X25 A;  3HKB B;  3JAW B;  2I6D A;  3N2K B;  3C9U A;  5LP6 C;  4IHJ A;  2VAW A;  5EYP A;  1Z5W A;  3V3T A;  4F6R A;  3GTZ A;  2ZOD A;  1YIJ F;  3R0P A;  3S02 A;  2HVY D;  3DDN A;  2MQE A;  1FSZ A;  3RYH A;  5LOV B;  1U43 A;  3B6N A;  3ZP4 A;  1XBI A;  1JFF B;  1IV4 A;  3D01 A;  1VQ4 F;  3UT5 A;  2OTJ F;  4FFB A;  2RHL A;  3OON A;  4BT5 A;  4NWO B;  5J2U A;  1KC8 H;  3WGL A;  2BO1 A;  2KTU A;  3CD6 F;  3CCJ F;  4B45 A;  5GON A;  2CZW A;  1FFX A;  5A2Q M;  1H47 A;  1W42 A;  2R75 1;  1YJN F;  4O2A B;  2UZH A;  2CSL A;  4X1Y A;  3V7Q A;  4B46 A;  1XRG A;  3RYI A;  3NMU C;  1W5A A;  2CHS A;  4BT2 A;  3LWQ C;  5IJ9 B;  5KMG B;  4C4W C;  3IR9 A;  4HNA A;  3J81 M;  2W8B C;  5IT9 M;  2UYP A;  3Q8H A;  3ON1 A;  2JNB A;  3K2X A;  3MDO A;  3K12 A;  1VQO F;  4U3J B;  4O4L B;  5FLX M;  2EWC A;  2IAF A;  1W5B A;  1M1K H;  1YIT F;  1W5E A;  4G4X A;  4ZHQ B;  4EI9 A;  1CK2 A;  1S72 F;  2FC3 A;  5KX5 A;  3FFM A;  3KJK A;  3SIU A;  4ZHY B;  3F0E A;  3KHN A;  3C9R A;  1U3L A;  1X7O A;  3HTN A;  1N8R H;  3TD3 A;  3K0T A;  4LNU B;  5J2T A;  1JY8 A;  3N4Y A;  3QTY A;  2BTU A;  4BT3 A;  3M4S A;  1CLI A;  3LFO A;  2G9I A;  3CCV F;  1YJ9 F;  1VQP F;  1GO1 A;  1NQ3 A;  2DYY A;  3D00 A;  1JD1 A;  4X1K A;  3MCA B;  3HKC A;  5EWR A;  1PXW A;  5FNV A;  5B8F A;  1W55 A;  4LNU A;  1QU9 A;  2UYK A;  1VQK F;  2AMT A;  4DRX B;  3OW2 F;  3MQW A;  4EI8 A;  4RQO A;  3NVI B;  5HY0 A;  2UYN A;  3CC2 F;  1DBF A;  1TVK A;  4BVT A;  5HY2 A;  4TZZ A;  2P6Y A;  5DCV A;  1Q82 H;  3JAT B;  5EAZ A;  4EB6 A;  1CN7 A;  2QA4 F;  2QTP A;  5EZY B;  3HKC B;  5FNV B;  3T80 A;  3CMA F;  3EOR A;  3CYQ A;  4EB6 B;  4ZHV A;  2HX0 A;  4U3J A;  1E7K A;  1VQ9 F;  3WGN A;  4HNA B;  4O4J B;  2IQQ A;  3JAL B;  5BMV B;  1XV2 A;  3KIZ A;  3K14 A;  4KWE A;  1YQN A;  2HRU A;  2CWJ A;  5JVD A;  3I3F A;  3JVH A;  3WJR A;  3OBY A;  4TUY A;  3VIU A;  2ZVY A;  2HP0 A;  1VQ7 F;  2KTV A;  2NMU A;  3C8L A;  3M84 A;  4ZI7 A;  1W57 A;  3VI6 A;  3PLA C;  5EIB C;  3IKE A;  3SIV A;  2GVI A;  1SDS A;  1Q7Y H;  3RA6 A;  2YYE A;  3CC7 F;  1SZQ A;  3LWV C;  1TVK B;  1RLG A;  2LBT A;  2Z1U A;  4X1I B;  2Z01 A;  3S03 A;  1YHQ F;  3V4D A;  4U39 A;  3HWU A;  5IJ0 A;  2Q1Y A;  1Q8R A;  2UYN B;  5G4U C;  4X20 A;  3U0O A;  1OAP A;  2GLZ A;  3KJJ A;  3QUW A;  2AIZ P;  3RYH B;  5LYJ A;  2VGN A;  4LCK A;  4X1K B;  3LWR C;  1VQL F;  3ESJ A;  3MBM A;  2HP0 B;  3ZP7 A;  1VQN F;  4ZOL B;  3RYF A;  2RHJ A;  4BT6 A;  3P4E A;  2HRY A;  4G4V A;  3F0D A;  3CCE F;  1K8A H;  5CA1 A;  5LYJ B;  3N2K A;  1OFU A;  3DC2 A;  3CCL F;  2LBW A;  3VTI C;  4BVS A;  1GZ0 A;  4I55 B;  3LME A;  4PWT A;  3S0H A;  3CCR F;  3BYQ A;  1TUB A;  4WBN A;  2Q1X A;  1QAH A;  2HP3 A;  1XHO A;  4O2A A;  4BY9 D;  2LBX A;  4XCQ A;  3VO8 A;  2VAP A;  3RA5 A;  3WJQ A;  1VK3 A;  2Z1E A;  5HY4 A;  3RYC B;  1W2B F;  2VGM A;  3WGM A;  5FJ4 C;  2ZOV A;  5ITZ A;  5JH7 A;  3P10 A;  5IYZ B;  4O2B A;  5JQG A;  1SA0 B;  3J80 M;  4WBN B;  5HY1 A;  1Z5V A;  2OTM A;  1YJW F;  2ZAU A;  2GZL A;  4I4T A;  4ZHW A;  4G4W A;  4X1Y B;  2ZVZ A;  5C8Y B;  3CXC F;  3HKD B;  3RYI B;  4NUT A;  1RQ7 A;  3RYF B;  1SA0 A;  3HAX D;  5JQG B;  3RE3 A;  2DT4 A;  3G6E F;  5EYP B;  4TV8 A;  3IEW A;  3WPX A;  2Z1F A;  3JAS A;  3VYU C;  3HKD A;  1QD9 A;  1COM A;  5CB4 A;  5JCO C;  5IJ0 B;  4IIJ B; 
#chains in the Genus database with same CATH homology
 1XBI A;  3NK6 A;  1VQ5 F;  1X7P A;  3CCS F;  1ZWZ A;  1VQ4 F;  3I56 F;  2OTL F;  5EO3 A;  2OTJ F;  1KC8 H;  1KD1 H;  5GAN K;  1GO0 A;  1VQ6 F;  3OBY A;  2BO1 A;  2KTU A;  3CD6 F;  1VQ7 F;  3CCJ F;  2CZW A;  1W3E X;  1M90 H;  2KTV A;  1YI2 F;  5A2Q M;  3J7A R;  1W42 A;  3VI6 A;  3PLA C;  1YJN F;  2FGY A;  1VQ8 F;  3SIV A;  2QI2 A;  1SDS A;  2OHW A;  1Q7Y H;  3RA6 A;  3CC7 F;  3V7Q A;  3OBW A;  4BW0 B;  3LWV C;  3NK7 A;  5HWE A;  3I55 F;  1JJ2 F;  1RLG A;  3NMU C;  1T0K B;  3CPW F;  3PAF A;  3LWQ C;  2WAL A;  1YHQ F;  4C4W C;  3G4S F;  3G71 F;  3IR9 A;  3CC4 F;  5GIO C;  1Q86 H;  1X52 A;  1K73 H;  5G4U C;  3J81 M;  2GLZ A;  2QEX F;  5IT9 M;  1VQM F;  4LCK A;  2VGN A;  2ALE A;  3LWR C;  5HXU A;  3ON1 A;  2JNB A;  1VQL F;  2AIF A;  5GIN C;  1VQO F;  3V7E A;  1RA4 A;  5GIP C;  2KG4 A;  5GAP K;  1VQN F;  5FLX M;  3WXM B;  4NQ3 A;  1W40 A;  4BVR A;  1M1K H;  3CCM F;  1YIT F;  1NMU B;  4EI9 A;  3CCE F;  1K8A H;  3NVK E;  1CK2 A;  1S72 F;  2FC3 A;  3FFM A;  3CCL F;  3SIU A;  2LBW A;  4BVS A;  1W41 A;  1GZ0 A;  3CPQ A;  3AGK A;  3CCR F;  1X7O A;  1N8R H;  3VMF B;  4BY9 D;  2LBX A;  4XCQ A;  2F9Z C;  3N4Y A;  1K9M H;  3RA5 A;  4X3L A;  3CCQ F;  5HY4 A;  3CG6 A;  3LFO A;  1W2B F;  2VGM A;  3CCV F;  5HXZ A;  1YJ9 F;  5G4V C;  1VQP F;  2OZB A;  5FJ4 C;  1GO1 A;  3GYQ A;  3D00 A;  3CME F;  3CCU F;  1NJI H;  3O85 A;  1H7M A;  3MCA B;  4X3M A;  5EWR A;  1PXW A;  3N4Z A;  3E20 B;  1QVG F;  3J80 M;  1VQK F;  1QVF F;  5HY1 A;  3OW2 F;  4EI7 A;  1Q81 H;  3HJW C;  4EI8 A;  1YJW F;  1IPA A;  3NVI B;  5HY0 A;  3CC2 F;  4BVT A;  5HY2 A;  3LWP C;  4TZZ A;  2I6D A;  3LWO C;  3CXC F;  5DCV A;  1DT9 A;  4NUT A;  1Q82 H;  3JAM M;  3JCM M;  1CN7 A;  2QA4 F;  3HAX D;  3E1Y A;  3G6E F;  3V3T A;  3CMA F;  1YIJ F;  2HVY D;  1E7K A;  1VQ9 F;  4BVQ A;  1KQS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...