3CG6A

Crystal structure of gadd45 gamma
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
131
Chain Sequence
TARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVDLHCILISNPNWKDPALEKLSLFCEESRSFNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Growth arrest and DNA-damage-inducible 45 gamma
publication title The crystal structure and dimerization interface of GADD45gamma.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 131
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cg6A00
3CC7F 3CCLF 5A2QM 1YITF 5GINC 5EO3A 1VQOF 1PXWA 5IT9M 3OW2F 3LWVC 3CCMF 1VQKF 1YIJF 3SIVA 2KG4A 4TZZA 3NVIB 1YJ9F 3CCVF 3ON1A 1NJIH 1VQPF 1VQ7F 5GAPK 4NUTA 1X7OA 3LWOC 1K73H 1M1KH 1YJNF 2OTJF 1VQ9F 2OHWA 3CPQA 1N8RH 3CPWF 5EWRA 1S72F 1RA4A 3I56F 1IPAA 1GZ0A 2LBWA 3CG6A 5DCVA 3HJWC 3G71F 2CZWA 1K9MH 1E7KA 1X52A 2ALEA 1W40A 2VGMA 1VQ5F 1KC8H 3J7AR 1GO0A 3CCSF 1KQSF 3NMUC 4X3LA 5G4VC 3OBWA 3NK6A 3LWQC 2HVYD 3RA6A 3PAFA 3N4YA 1VQMF 2BO1A 3CCUF 2QI2A 1Q86H 3PLAC 3GYQA 3CC4F 2KTVA 1RLGA 3G6EF 5G4UC 5GANK 3HAXD 1Q81H 5GIOC 3CD6F 1VQ8F 1XBIA 3G4SF 1DT9A 3FFMA 4LCKA 1CK2A 1YJWF 3CXCF 2I6DA 2KTUA 3J81M 3CC2F 2FC3A 2QA4F 1W41A 1W2BF 1CN7A 3MCAB 1NMUB 4C4WC 2WALA 3LWRC 3LFOA 3WXMB 3CCEF 1H7MA 1X7PA 1VQ6F 3E1YA 3CMEF 3NVKE 2OZBA 3CMAF 3CCRF 1M90H 1ZWZA 3RA5A 1VQLF 1Q82H 1QVGF 1K8AH 1VQ4F 1YHQF 2OTLF 2LBXA 3E20B 3OBYA 3VI6A 3CCQF 1T0KB 1W42A 3SIUA 1YI2F 1Q7YH 1GO1A 5GIPC 3V7EA 1QVFF 1W3EX 4X3MA 1JJ2F 3VMFB 4BW0B 3LWPC 2VGNA 5FJ4C 2JNBA 3CCJF 3JCMM 5FLXM 2QEXF 3AGKA 3O85A 2AIFA 3IR9A 3V7QA 3NK7A 3JAMM 3J80M 4BY9D 1VQNF 1SDSA 1KD1H 3I55F 3N4ZA
chains in the Genus database with same CATH superfamily
5HXUA 3CC7F 3CCLF 4C8EA 1SA0B 4TUYA 1VQOF 2VXYA 5IYZA 1RQ2A 2RHLA 3LWVC 3LMEA 3IKEA 3SIVA 3S0HA 3UT5B 3NVIB 4G4VA 4BT4A 3F0EA 3ON1A 2GZLA 3CYQA 3F6MA 2HRYA 4I55A 1M1KH 2IAFA 2H6LA 2OTJF 3K0TA 1S72F 1VH8A 1VQVA 3I56F 3Q8HA 3VCZA 3C8LA 4ZHVA 4X20A 2PHNA 3CG6A 3G71F 1Q8RA 1XV2A 5C8YA 1E7KA 3J7AR 1VQ5F 1KC8H 4M8IA 1GO0A 2BTOA 2K1SA 2NMUA 1TUBA 5JH7B 3NMUC 2ZF8A 3OBWA 3KHNA 1U43A 5FNVA 1KNJA 5MN4A 1VQMF 2ZOVA 4XCQA 3WPXA 2QI2A 3VOBA 1W5BA 4YJ2A 3MCQA 3E22A 2KTVA 4LNUB 3IEWA 5EIBC 4X1YB 3G6EF 3TD4A 1Q81H 3F0DA 3CD6F 3P10A 1XBIA 5IJ0B 3FFMA 2R6R1 5KX5B 1YJWF 3GHZA 2KTUA 3CC2F 2QA4F 5LXTB 1W2BF 3QUWA 3LDTA 1UI9A 4NQ3A 1Z5WA 5AVMA 3IMPA 3M4SA 4C4WC 3WXMB 3TD3A 1H7MA 2BTUA 3N2GA 1VQ6F 2HS3A 4EI8A 2Q1XA 3NVKE 3CMAF 3D01A 2I6RA 5HXZA 3KJJA 2RHOA 1ZWZA 3HTNA 1Q82H 1SZQA 2DT4A 1W57A 4HNAB 4ERHA 3S0WA 3JAKB 3CCQF 2Z1FA 1W581 4B62A 2HS4A 4C82A 3IKFA 3VIUA 3ZP7A 1GO1A 3HKCA 3JARA 1W3EX 3RYCA 4R40B 3N2KA 1JJ2F 4G88A 3JCMM 3O85A 3ZOPA 2HP3A 4TV9B 3J80M 1K9MH 1VQNF 3KE1A 4IHJB 5JCOC 4U3JB 4ZOLA 5A2QM 3RYHB 2AMTA 1X25A 4I4TA 2RHHA 4BVQA 3D00A 3RYIA 3ZP4A 1YIJF 2KG4A 3JALA 4BVRA 3S02A 5LOVB 2RHJA 5CB4A 3P4EA 1YJ9F 3DDNA 1NJIH 5GAPK 4NUTA 1K73H 3TD5A 3VYSC 3WJPA 1FSZA 2UYJA 1NQ3A 2YYEA 3ELCA 2OHWA 3CPQA 5HY1A 1R1MA 3JAWB 5KMGA 2F9ZC 3OONA 5EYPA 4TUYB 5IYZB 2VAMA 5DCVA 2CSLA 1H47A 2L26A 3HKEA 4O4JA 2VGMA 3MBMA 1VK3A 4X1KA 5BMVA 4I55B 3NK6A 4ZK7A 3LWQC 5MN5A 1W5AA 2HVYD 5HWEA 3RA6A 1UFYA 3PAFA 3F0FA 3F0GA 3CC4F 3V3TA 4DXDA 4B46A 4X20B 4ZHQA 1U3PA 5G4UC 1RLUA 5C8YB 3T80A 1VQ8F 1ONIA 1DBFA 1TUBB 3LYBA 2DYYA 3HKBA 2I6DA 3HKDA 5JVDA 2EWCA 5FNVB 1JN1A 2CHSA 2LBTA 4EB6A 2Z1EA 5EAZA 3CYPB 2MQEA 3E22B 4YJ2B 3I3FA 3CCEF 1JFFA 4YJ3A 4IIJA 4I50A 3E1YA 2Q1YA 1KNKA 3WJRA 3CCRF 3WGLA 1U3LA 3B6NA 2P6YA 3C9TA 2VAWA 4G4XA 4G4ZA 5IJ9A 1VQLF 2KGWA 3CB2A 3WGMA 2QTPA 1IV1A 1YHQF 2ZVYA 3GTZA 3E20B 5LP6A 1RQ7A 3SIUA 2VAPA 1T0AA 4BT5A 2CWJA 5ITZA 3M1XA 3N2GB 4ZI7A 4G4YA 4X3MA 3VYTC 3VMFB 4BW0B 5FJ4C 2VGNA 3MQWA 4BT3A 5J2TA 3WJQA 4B5CA 2H8EA 3KIZA 3JAMM 1SDSA 3I55F 5IT9M 3N4ZA 3IEQA 4F6RA 1IV3A 4BT2A 1J7HA 5GINC 5EB1B 2V9YA 1GX1A 3OW2F 3RE3A 4FFBA 5LA6A 4TV8A 3D54A 4TZZA 5JQGA 1W59A 5CA0A 1TVKA 3CCVF 1U40A 3RYFA 3HKCB 3JARB 3WGKA 3RYCB 1VQPF 3N2KB 3ERNA 3LWOC 2FGYA 2GLZA 1VQ9F 1FFXA 2GVIA 1N8RH 2HS0A 3CPWF 4O2AA 5EWRA 1RA4A 3I7TA 4ZOLB 4O4LA 1GZ0A 3QHDA 4I4TB 3RYIB 2UYNA 3JALB 5MN6A 5CB4B 5EB0A 3K2XA 1W40A 2UYKA 4U39A 4X1IA 4O2BA 3P0ZA 5LYJA 3R0PA 5HY2A 5GONA 4BVTA 1Q86H 5KMGB 2Z1TA 3PLAC 3K14A 3GYQA 5EYPB 3JATA 5CA1A 4EI9A 5HP8A 2Z1UA 5LP6C 3HAXD 1QAHA 3EORA 3FD5A 5J2UA 2W8BC 3HKEB 4O4JB 4O4HA 1DT9A 4LCKA 2HP0A 1CK2A 4X1KB 5BMVB 3CXCF 3J81M 3VO8A 1H48A 1Z5VA 4BT7A 4WBNA 2CHTA 3MCAB 1VHAA 2OTMA 4C8IA 3LFOA 4DRXA 1QD9A 4ZHQB 2BTQB 5EZYA 2N48A 4O4IA 3CMEF 1W5FA 3JASA 1QU9A 2OZBA 1M90H 4BT6A 4RQOA 4B45A 1SA0A 3HKBB 1QVGF 1JY8A 3HKDB 5JVDB 1K8AH 1VQ4F 3FD6A 5HY0A 5HP7A 3OBYA 4EB6B 1W42A 1XRGA 3UT5A 3FBAA 1COMA 1JFFB 3C9SA 1ODEA 3WPWA 3VYUC 2JNBA 4YJ3B 4IIJB 1YGYA 4I50B 5B8FA 2QEXF 1KD1H 2YXZA 3ZO8A 1PF5A 3V7QA 3DC2A 4BY9D 4NWOB 3ESJA 1YITF 5EO3A 5IJ9B 1PXWA 2G9IA 5LP6B 3CCMF 1VQKF 5JCOA 3S0YA 2IG8A 5ITZB 3L7QA 2ZVZA 1W5EA 3QTYA 4ZI7B 5JH7A 3K12A 1VQ7F 1X7OA 5J2TB 1YJNF 4E6EA 4F6RB 1OAPA 1JD1A 1IPAA 4LNUA 2LBWA 5EIBD 4X1YA 2HQSC 4FFBB 2ZODA 3VTIC 5LA6B 3HJWC 4TV8B 2HRUA 3C9RA 2Z01A 2UYPA 5JQGB 3C9UA 5CA0B 1TVKB 2CZWA 5IJ0A 1X52A 2ALEA 3WGNA 1XHOA 4ZHYB 3CCSF 3RYFB 1KQSF 1FNJA 2UZHA 5KX5A 4X3LA 5G4VC 2HX0A 5LXTA 3N4YA 2BO1A 3CCUF 1FFXB 2H8CA 2LCAA 4O2AB 4O4LB 2R751 1IV2A 1RLGA 5GANK 2IQQA 2UYNB 5GIOC 3G4SF 4X1IB 3JVHA 4O2BB 1FNKA 4HNAA 5LYJB 2FC3A 3JAKA 1W41A 3M84A 3V4DA 1CN7A 4G4WA 5GONB 4C8GA 3KJKA 1NMUB 2WALA 3LWRC 3MDOA 1IV4A 3JATB 5CA1B 1X7PA 4RHAA 4PWTA 5J2UB 3WGJA 2RB9A 1CLIA 4O4HB 4TV9A 4IHJA 2HP0B 4U3JA 5HY4A 3RA5A 3VOAA 3S06A 3RYHA 3BYQA 2OTLF 2LBXA 1W55A 3FPIA 3VI6A 1T0KB 4BVSA 4WBNB 5LOVA 1YI2F 4EI7A 4C81A 1Q7YH 4DRXB 4ZHWA 2AIZP 5GIPC 3V7EA 2ZAUA 3S03A 1QVFF 2CW4A 1OFUA 5EZYB 3LWPC 3CCJF 1YQNA 4O4IB 4KWEA 5FLXM 3AGKA 2CVLA 2B33A 2AIFA 3U0OA 3IR9A 3JASB 3NK7A 3HWUA 3JAWA 2PMPA
chains in the Genus database with same CATH topology
5HXUA 3CC7F 3CCLF 5A2QM 1YITF 5GINC 5EO3A 1VQOF 1PXWA 5IT9M 3OW2F 3LWVC 3CCMF 4BVQA 1VQKF 3D00A 1YIJF 3SIVA 2KG4A 4BVRA 4TZZA 3NVIB 1YJ9F 3CCVF 3ON1A 1NJIH 1VQPF 1VQ7F 5GAPK 4NUTA 1X7OA 3LWOC 1K73H 1M1KH 1YJNF 2FGYA 2GLZA 2OTJF 1VQ9F 5HY1A 2OHWA 3CPQA 1N8RH 3CPWF 5EWRA 1S72F 1RA4A 2F9ZC 3I56F 1IPAA 1GZ0A 2LBWA 3CG6A 5DCVA 3HJWC 3G71F 2CZWA 1K9MH 1E7KA 1X52A 2ALEA 1W40A 2VGMA 1VQ5F 1KC8H 3J7AR 1GO0A 3CCSF 1KQSF 3NMUC 4X3LA 5G4VC 3OBWA 3NK6A 3LWQC 2HVYD 5HWEA 3RA6A 3PAFA 3N4YA 5HY2A 1VQMF 2BO1A 4XCQA 3CCUF 4BVTA 2QI2A 1Q86H 3PLAC 3GYQA 3CC4F 2KTVA 3V3TA 4EI9A 1RLGA 3G6EF 5G4UC 5GANK 3HAXD 1Q81H 5GIOC 3CD6F 1VQ8F 1XBIA 3G4SF 1DT9A 3FFMA 4LCKA 1CK2A 1YJWF 3CXCF 2I6DA 2KTUA 3J81M 3CC2F 2FC3A 2QA4F 1W41A 1W2BF 1CN7A 4NQ3A 3MCAB 1NMUB 4C4WC 2WALA 3LWRC 3LFOA 3WXMB 3CCEF 1H7MA 1X7PA 1VQ6F 4EI8A 3E1YA 3CMEF 3NVKE 2OZBA 3CMAF 3CCRF 5HXZA 1M90H 1ZWZA 5HY4A 3RA5A 1VQLF 1Q82H 1QVGF 1K8AH 1VQ4F 1YHQF 5HY0A 2LBXA 3E20B 2OTLF 3OBYA 3VI6A 3CCQF 1T0KB 1W42A 4BVSA 3SIUA 1YI2F 4EI7A 1Q7YH 1GO1A 5GIPC 3V7EA 1QVFF 1W3EX 4X3MA 1JJ2F 3VMFB 4BW0B 3LWPC 2VGNA 5FJ4C 2JNBA 3CCJF 3JCMM 5FLXM 2QEXF 3AGKA 3O85A 2AIFA 3IR9A 3V7QA 3NK7A 3JAMM 3J80M 4BY9D 1VQNF 1SDSA 1KD1H 3I55F 3N4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 F;  3CCL F;  5A2Q M;  1YIT F;  5GIN C;  5EO3 A;  1VQO F;  1PXW A;  5IT9 M;  3OW2 F;  3LWV C;  3CCM F;  1VQK F;  1YIJ F;  3SIV A;  2KG4 A;  4TZZ A;  3NVI B;  1YJ9 F;  3CCV F;  3ON1 A;  1NJI H;  1VQP F;  1VQ7 F;  5GAP K;  4NUT A;  1X7O A;  3LWO C;  1K73 H;  1M1K H;  1YJN F;  2OTJ F;  1VQ9 F;  2OHW A;  3CPQ A;  1N8R H;  3CPW F;  5EWR A;  1S72 F;  1RA4 A;  3I56 F;  1IPA A;  1GZ0 A;  2LBW A;  3CG6 A;  5DCV A;  3HJW C;  3G71 F;  2CZW A;  1K9M H;  1E7K A;  1X52 A;  2ALE A;  1W40 A;  2VGM A;  1VQ5 F;  1KC8 H;  3J7A R;  1GO0 A;  3CCS F;  1KQS F;  3NMU C;  4X3L A;  5G4V C;  3OBW A;  3NK6 A;  3LWQ C;  2HVY D;  3RA6 A;  3PAF A;  3N4Y A;  1VQM F;  2BO1 A;  3CCU F;  2QI2 A;  1Q86 H;  3PLA C;  3GYQ A;  3CC4 F;  2KTV A;  1RLG A;  3G6E F;  5G4U C;  5GAN K;  3HAX D;  1Q81 H;  5GIO C;  3CD6 F;  1VQ8 F;  1XBI A;  3G4S F;  1DT9 A;  3FFM A;  4LCK A;  1CK2 A;  1YJW F;  3CXC F;  2I6D A;  2KTU A;  3J81 M;  3CC2 F;  2FC3 A;  2QA4 F;  1W41 A;  1W2B F;  1CN7 A;  3MCA B;  1NMU B;  4C4W C;  2WAL A;  3LWR C;  3LFO A;  3WXM B;  3CCE F;  1H7M A;  1X7P A;  1VQ6 F;  3E1Y A;  3CME F;  3NVK E;  2OZB A;  3CMA F;  3CCR F;  1M90 H;  1ZWZ A;  3RA5 A;  1VQL F;  1Q82 H;  1QVG F;  1K8A H;  1VQ4 F;  1YHQ F;  2OTL F;  2LBX A;  3E20 B;  3OBY A;  3VI6 A;  3CCQ F;  1T0K B;  1W42 A;  3SIU A;  1YI2 F;  1Q7Y H;  1GO1 A;  5GIP C;  3V7E A;  1QVF F;  1W3E X;  4X3M A;  1JJ2 F;  3VMF B;  4BW0 B;  3LWP C;  2VGN A;  5FJ4 C;  2JNB A;  3CCJ F;  3JCM M;  5FLX M;  2QEX F;  3AGK A;  3O85 A;  2AIF A;  3IR9 A;  3V7Q A;  3NK7 A;  3JAM M;  3J80 M;  4BY9 D;  1VQN F;  1SDS A;  1KD1 H;  3I55 F;  3N4Z A; 
#chains in the Genus database with same CATH topology
 5HXU A;  3CC7 F;  3CCL F;  4C8E A;  1SA0 B;  4TUY A;  1VQO F;  2VXY A;  5IYZ A;  1RQ2 A;  2RHL A;  3LWV C;  3LME A;  3IKE A;  3SIV A;  3S0H A;  3UT5 B;  3NVI B;  4G4V A;  4BT4 A;  3F0E A;  3ON1 A;  2GZL A;  3CYQ A;  3F6M A;  2HRY A;  4I55 A;  1M1K H;  2IAF A;  2H6L A;  2OTJ F;  3K0T A;  1S72 F;  1VH8 A;  1VQV A;  3I56 F;  3Q8H A;  3VCZ A;  3C8L A;  4ZHV A;  4X20 A;  2PHN A;  3CG6 A;  3G71 F;  1Q8R A;  1XV2 A;  5C8Y A;  1E7K A;  3J7A R;  1VQ5 F;  1KC8 H;  4M8I A;  1GO0 A;  2BTO A;  2K1S A;  2NMU A;  1TUB A;  5JH7 B;  3NMU C;  2ZF8 A;  3OBW A;  3KHN A;  1U43 A;  5FNV A;  1KNJ A;  5MN4 A;  1VQM F;  2ZOV A;  4XCQ A;  3WPX A;  2QI2 A;  3VOB A;  1W5B A;  4YJ2 A;  3MCQ A;  3E22 A;  2KTV A;  4LNU B;  3IEW A;  5EIB C;  4X1Y B;  3G6E F;  3TD4 A;  1Q81 H;  3F0D A;  3CD6 F;  3P10 A;  1XBI A;  5IJ0 B;  3FFM A;  2R6R 1;  5KX5 B;  1YJW F;  3GHZ A;  2KTU A;  3CC2 F;  2QA4 F;  5LXT B;  1W2B F;  3QUW A;  3LDT A;  1UI9 A;  4NQ3 A;  1Z5W A;  5AVM A;  3IMP A;  3M4S A;  4C4W C;  3WXM B;  3TD3 A;  1H7M A;  2BTU A;  3N2G A;  1VQ6 F;  2HS3 A;  4EI8 A;  2Q1X A;  3NVK E;  3CMA F;  3D01 A;  2I6R A;  5HXZ A;  3KJJ A;  2RHO A;  1ZWZ A;  3HTN A;  1Q82 H;  1SZQ A;  2DT4 A;  1W57 A;  4HNA B;  4ERH A;  3S0W A;  3JAK B;  3CCQ F;  2Z1F A;  1W58 1;  4B62 A;  2HS4 A;  4C82 A;  3IKF A;  3VIU A;  3ZP7 A;  1GO1 A;  3HKC A;  3JAR A;  1W3E X;  3RYC A;  4R40 B;  3N2K A;  1JJ2 F;  4G88 A;  3JCM M;  3O85 A;  3ZOP A;  2HP3 A;  4TV9 B;  3J80 M;  1K9M H;  1VQN F;  3KE1 A;  4IHJ B;  5JCO C;  4U3J B;  4ZOL A;  5A2Q M;  3RYH B;  2AMT A;  1X25 A;  4I4T A;  2RHH A;  4BVQ A;  3D00 A;  3RYI A;  3ZP4 A;  1YIJ F;  2KG4 A;  3JAL A;  4BVR A;  3S02 A;  5LOV B;  2RHJ A;  5CB4 A;  3P4E A;  1YJ9 F;  3DDN A;  1NJI H;  5GAP K;  4NUT A;  1K73 H;  3TD5 A;  3VYS C;  3WJP A;  1FSZ A;  2UYJ A;  1NQ3 A;  2YYE A;  3ELC A;  2OHW A;  3CPQ A;  5HY1 A;  1R1M A;  3JAW B;  5KMG A;  2F9Z C;  3OON A;  5EYP A;  4TUY B;  5IYZ B;  2VAM A;  5DCV A;  2CSL A;  1H47 A;  2L26 A;  3HKE A;  4O4J A;  2VGM A;  3MBM A;  1VK3 A;  4X1K A;  5BMV A;  4I55 B;  3NK6 A;  4ZK7 A;  3LWQ C;  5MN5 A;  1W5A A;  2HVY D;  5HWE A;  3RA6 A;  1UFY A;  3PAF A;  3F0F A;  3F0G A;  3CC4 F;  3V3T A;  4DXD A;  4B46 A;  4X20 B;  4ZHQ A;  1U3P A;  5G4U C;  1RLU A;  5C8Y B;  3T80 A;  1VQ8 F;  1ONI A;  1DBF A;  1TUB B;  3LYB A;  2DYY A;  3HKB A;  2I6D A;  3HKD A;  5JVD A;  2EWC A;  5FNV B;  1JN1 A;  2CHS A;  2LBT A;  4EB6 A;  2Z1E A;  5EAZ A;  3CYP B;  2MQE A;  3E22 B;  4YJ2 B;  3I3F A;  3CCE F;  1JFF A;  4YJ3 A;  4IIJ A;  4I50 A;  3E1Y A;  2Q1Y A;  1KNK A;  3WJR A;  3CCR F;  3WGL A;  1U3L A;  3B6N A;  2P6Y A;  3C9T A;  2VAW A;  4G4X A;  4G4Z A;  5IJ9 A;  1VQL F;  2KGW A;  3CB2 A;  3WGM A;  2QTP A;  1IV1 A;  1YHQ F;  2ZVY A;  3GTZ A;  3E20 B;  5LP6 A;  1RQ7 A;  3SIU A;  2VAP A;  1T0A A;  4BT5 A;  2CWJ A;  5ITZ A;  3M1X A;  3N2G B;  4ZI7 A;  4G4Y A;  4X3M A;  3VYT C;  3VMF B;  4BW0 B;  5FJ4 C;  2VGN A;  3MQW A;  4BT3 A;  5J2T A;  3WJQ A;  4B5C A;  2H8E A;  3KIZ A;  3JAM M;  1SDS A;  3I55 F;  5IT9 M;  3N4Z A;  3IEQ A;  4F6R A;  1IV3 A;  4BT2 A;  1J7H A;  5GIN C;  5EB1 B;  2V9Y A;  1GX1 A;  3OW2 F;  3RE3 A;  4FFB A;  5LA6 A;  4TV8 A;  3D54 A;  4TZZ A;  5JQG A;  1W59 A;  5CA0 A;  1TVK A;  3CCV F;  1U40 A;  3RYF A;  3HKC B;  3JAR B;  3WGK A;  3RYC B;  1VQP F;  3N2K B;  3ERN A;  3LWO C;  2FGY A;  2GLZ A;  1VQ9 F;  1FFX A;  2GVI A;  1N8R H;  2HS0 A;  3CPW F;  4O2A A;  5EWR A;  1RA4 A;  3I7T A;  4ZOL B;  4O4L A;  1GZ0 A;  3QHD A;  4I4T B;  3RYI B;  2UYN A;  3JAL B;  5MN6 A;  5CB4 B;  5EB0 A;  3K2X A;  1W40 A;  2UYK A;  4U39 A;  4X1I A;  4O2B A;  3P0Z A;  5LYJ A;  3R0P A;  5HY2 A;  5GON A;  4BVT A;  1Q86 H;  5KMG B;  2Z1T A;  3PLA C;  3K14 A;  3GYQ A;  5EYP B;  3JAT A;  5CA1 A;  4EI9 A;  5HP8 A;  2Z1U A;  5LP6 C;  3HAX D;  1QAH A;  3EOR A;  3FD5 A;  5J2U A;  2W8B C;  3HKE B;  4O4J B;  4O4H A;  1DT9 A;  4LCK A;  2HP0 A;  1CK2 A;  4X1K B;  5BMV B;  3CXC F;  3J81 M;  3VO8 A;  1H48 A;  1Z5V A;  4BT7 A;  4WBN A;  2CHT A;  3MCA B;  1VHA A;  2OTM A;  4C8I A;  3LFO A;  4DRX A;  1QD9 A;  4ZHQ B;  2BTQ B;  5EZY A;  2N48 A;  4O4I A;  3CME F;  1W5F A;  3JAS A;  1QU9 A;  2OZB A;  1M90 H;  4BT6 A;  4RQO A;  4B45 A;  1SA0 A;  3HKB B;  1QVG F;  1JY8 A;  3HKD B;  5JVD B;  1K8A H;  1VQ4 F;  3FD6 A;  5HY0 A;  5HP7 A;  3OBY A;  4EB6 B;  1W42 A;  1XRG A;  3UT5 A;  3FBA A;  1COM A;  1JFF B;  3C9S A;  1ODE A;  3WPW A;  3VYU C;  2JNB A;  4YJ3 B;  4IIJ B;  1YGY A;  4I50 B;  5B8F A;  2QEX F;  1KD1 H;  2YXZ A;  3ZO8 A;  1PF5 A;  3V7Q A;  3DC2 A;  4BY9 D;  4NWO B;  3ESJ A;  1YIT F;  5EO3 A;  5IJ9 B;  1PXW A;  2G9I A;  5LP6 B;  3CCM F;  1VQK F;  5JCO A;  3S0Y A;  2IG8 A;  5ITZ B;  3L7Q A;  2ZVZ A;  1W5E A;  3QTY A;  4ZI7 B;  5JH7 A;  3K12 A;  1VQ7 F;  1X7O A;  5J2T B;  1YJN F;  4E6E A;  4F6R B;  1OAP A;  1JD1 A;  1IPA A;  4LNU A;  2LBW A;  5EIB D;  4X1Y A;  2HQS C;  4FFB B;  2ZOD A;  3VTI C;  5LA6 B;  3HJW C;  4TV8 B;  2HRU A;  3C9R A;  2Z01 A;  2UYP A;  5JQG B;  3C9U A;  5CA0 B;  1TVK B;  2CZW A;  5IJ0 A;  1X52 A;  2ALE A;  3WGN A;  1XHO A;  4ZHY B;  3CCS F;  3RYF B;  1KQS F;  1FNJ A;  2UZH A;  5KX5 A;  4X3L A;  5G4V C;  2HX0 A;  5LXT A;  3N4Y A;  2BO1 A;  3CCU F;  1FFX B;  2H8C A;  2LCA A;  4O2A B;  4O4L B;  2R75 1;  1IV2 A;  1RLG A;  5GAN K;  2IQQ A;  2UYN B;  5GIO C;  3G4S F;  4X1I B;  3JVH A;  4O2B B;  1FNK A;  4HNA A;  5LYJ B;  2FC3 A;  3JAK A;  1W41 A;  3M84 A;  3V4D A;  1CN7 A;  4G4W A;  5GON B;  4C8G A;  3KJK A;  1NMU B;  2WAL A;  3LWR C;  3MDO A;  1IV4 A;  3JAT B;  5CA1 B;  1X7P A;  4RHA A;  4PWT A;  5J2U B;  3WGJ A;  2RB9 A;  1CLI A;  4O4H B;  4TV9 A;  4IHJ A;  2HP0 B;  4U3J A;  5HY4 A;  3RA5 A;  3VOA A;  3S06 A;  3RYH A;  3BYQ A;  2OTL F;  2LBX A;  1W55 A;  3FPI A;  3VI6 A;  1T0K B;  4BVS A;  4WBN B;  5LOV A;  1YI2 F;  4EI7 A;  4C81 A;  1Q7Y H;  4DRX B;  4ZHW A;  2AIZ P;  5GIP C;  3V7E A;  2ZAU A;  3S03 A;  1QVF F;  2CW4 A;  1OFU A;  5EZY B;  3LWP C;  3CCJ F;  1YQN A;  4O4I B;  4KWE A;  5FLX M;  3AGK A;  2CVL A;  2B33 A;  2AIF A;  3U0O A;  3IR9 A;  3JAS B;  3NK7 A;  3HWU A;  3JAW A;  2PMP A; 
#chains in the Genus database with same CATH homology
 5HXU A;  3CC7 F;  3CCL F;  5A2Q M;  1YIT F;  5GIN C;  5EO3 A;  1VQO F;  1PXW A;  5IT9 M;  3OW2 F;  3LWV C;  3CCM F;  4BVQ A;  1VQK F;  3D00 A;  1YIJ F;  3SIV A;  2KG4 A;  4BVR A;  4TZZ A;  3NVI B;  1YJ9 F;  3CCV F;  3ON1 A;  1NJI H;  1VQP F;  1VQ7 F;  5GAP K;  4NUT A;  1X7O A;  3LWO C;  1K73 H;  1M1K H;  1YJN F;  2FGY A;  2GLZ A;  2OTJ F;  1VQ9 F;  5HY1 A;  2OHW A;  3CPQ A;  1N8R H;  3CPW F;  5EWR A;  1S72 F;  1RA4 A;  2F9Z C;  3I56 F;  1IPA A;  1GZ0 A;  2LBW A;  3CG6 A;  5DCV A;  3HJW C;  3G71 F;  2CZW A;  1K9M H;  1E7K A;  1X52 A;  2ALE A;  1W40 A;  2VGM A;  1VQ5 F;  1KC8 H;  3J7A R;  1GO0 A;  3CCS F;  1KQS F;  3NMU C;  4X3L A;  5G4V C;  3OBW A;  3NK6 A;  3LWQ C;  2HVY D;  5HWE A;  3RA6 A;  3PAF A;  3N4Y A;  5HY2 A;  1VQM F;  2BO1 A;  4XCQ A;  3CCU F;  4BVT A;  2QI2 A;  1Q86 H;  3PLA C;  3GYQ A;  3CC4 F;  2KTV A;  3V3T A;  4EI9 A;  1RLG A;  3G6E F;  5G4U C;  5GAN K;  3HAX D;  1Q81 H;  5GIO C;  3CD6 F;  1VQ8 F;  1XBI A;  3G4S F;  1DT9 A;  3FFM A;  4LCK A;  1CK2 A;  1YJW F;  3CXC F;  2I6D A;  2KTU A;  3J81 M;  3CC2 F;  2FC3 A;  2QA4 F;  1W41 A;  1W2B F;  1CN7 A;  4NQ3 A;  3MCA B;  1NMU B;  4C4W C;  2WAL A;  3LWR C;  3LFO A;  3WXM B;  3CCE F;  1H7M A;  1X7P A;  1VQ6 F;  4EI8 A;  3E1Y A;  3CME F;  3NVK E;  2OZB A;  3CMA F;  3CCR F;  5HXZ A;  1M90 H;  1ZWZ A;  5HY4 A;  3RA5 A;  1VQL F;  1Q82 H;  1QVG F;  1K8A H;  1VQ4 F;  1YHQ F;  5HY0 A;  2LBX A;  3E20 B;  2OTL F;  3OBY A;  3VI6 A;  3CCQ F;  1T0K B;  1W42 A;  4BVS A;  3SIU A;  1YI2 F;  4EI7 A;  1Q7Y H;  1GO1 A;  5GIP C;  3V7E A;  1QVF F;  1W3E X;  4X3M A;  1JJ2 F;  3VMF B;  4BW0 B;  3LWP C;  2VGN A;  5FJ4 C;  2JNB A;  3CCJ F;  3JCM M;  5FLX M;  2QEX F;  3AGK A;  3O85 A;  2AIF A;  3IR9 A;  3V7Q A;  3NK7 A;  3JAM M;  3J80 M;  4BY9 D;  1VQN F;  1SDS A;  1KD1 H;  3I55 F;  3N4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...