5EWRA

C merolae u4 snrnp protein snu13
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
DPRAYPFAPADLVVEILDLVQQASHYKQIKKGLNEVLKSMNRGLAEFVVLAADTQPLEILLSAPLVAEDKAVPYVFVPSKAALGRACGVSRPVIACAVLRADMSQLRNQITALRTKIEQLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Box C/D snoRNP and U4 snRNP component Snu13p
publication title Conserved structure of Snu13 from the highly reduced spliceosome of Cyanidioschyzon merolae.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Rna binding protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ewrA00
3CD6F 2FC3A 1YJ9F 1K8AH 3CCQF 3FFMA 1X7PA 1Q81H 3CCLF 2HVYD 2OTJF 5A2QM 1M90H 1XBIA 5GIPC 1Q86H 4C4WC 1GZ0A 2KTVA 1T0KB 3CCEF 3CCRF 5G4UC 4NUTA 3AGKA 3HAXD 2KTUA 3LWRC 3CC4F 1YHQF 1YI2F 3JAMM 3PLAC 3V7EA 3N4YA 3RA5A 1Q82H 1H7MA 3OBWA 1VQ5F 1GO1A 3NVKE 3CCUF 1S72F 1W3EX 3J7AR 3OBYA 2QA4F 3GYQA 5FJ4C 4X3MA 3J81M 3E1YA 3HJWC 2QEXF 1GO0A 3ON1A 1ZWZA 4X3LA 1JJ2F 5G4VC 3VI6A 1CN7A 2KG4A 1W2BF 1KC8H 2OZBA 1PXWA 3CMEF 3CCMF 3CXCF 1NJIH 5EO3A 3LWQC 1X52A 2JNBA 2VGNA 1YJNF 5GAPK 2AIFA 3E20B 1VQ8F 3RA6A 2CZWA 3IR9A 1KQSF 2LBWA 2ALEA 3WXMB 2OTLF 1K9MH 1VQ4F 1YITF 1Q7YH 4LCKA 3CG6A 2BO1A 3G71F 1X7OA 3SIVA 3V7QA 1VQNF 2QI2A 1VQ9F 3CC7F 1K73H 1RLGA 5GANK 3CPQA 5GINC 3CMAF 3PAFA 2VGMA 1W40A 1IPAA 1M1KH 3CC2F 1KD1H 3OW2F 1VQLF 1RA4A 1DT9A 2OHWA 3LWOC 1SDSA 1QVGF 1N8RH 3NVIB 3LWPC 3CCSF 1E7KA 1W41A 1YIJF 1VQPF 5GIOC 3CCVF 1YJWF 3CCJF 5EWRA 1VQ6F 1QVFF 3NK6A 5DCVA 3I56F 3NMUC 1NMUB 3N4ZA 4TZZA 4BW0B 1CK2A 3J80M 3G4SF 3SIUA 1VQKF 5FLXM 4BY9D 1VQOF 3I55F 2LBXA 3LFOA 1VQMF 3MCAB 3LWVC 3NK7A 3JCMM 3VMFB 1VQ7F 2WALA 2I6DA 5IT9M 3G6EF 1W42A 3CPWF 3O85A
chains in the Genus database with same CATH superfamily
3VCZA 1U3PA 5LP6A 4YJ2A 1YJ9F 4X1KB 1FSZA 5IJ0A 5KMGA 4X1IB 1SA0B 3MDOA 3CYQA 1RQ7A 3DDNA 3CCEF 5G4UC 5JVDB 4NUTA 3LWRC 4FFBA 3CC4F 3WPWA 3N4YA 2R6R1 1Q82H 1VQ5F 3MQWA 4ZK7A 1S72F 1H48A 5ITZB 4ZHWA 2QEXF 1JJ2F 4WBNB 2KG4A 2IG8A 3UT5B 3ERNA 4O4JB 3C9RA 5CA0B 3RYHB 1NJIH 3LWQC 1SZQA 1X52A 2JNBA 2Q1XA 3RYCA 4IIJB 3GHZA 2VAPA 2IQQA 3RA6A 4BT6A 3IR9A 3DC2A 5C8YB 4I4TB 3WPXA 1FFXB 4M8IA 2GVIA 4ZI7A 5J2TA 1K9MH 1JN1A 4B45A 1Q7YH 5HY2A 4LCKA 2ZAUA 2LBTA 5KX5B 2NMUA 2VAMA 3C9UA 3S06A 1RLGA 5GANK 3CPQA 4BT3A 4X1IA 3PAFA 2VGMA 1IPAA 3VTIC 3CC2F 4C8IA 3OW2F 1YQNA 5EIBC 3HWUA 2OHWA 2HRYA 3HKCB 5EB0A 1W57A 1SDSA 3VYUC 3LWPC 1VHAA 2CWJA 1QAHA 2GLZA 5GIOC 3CCVF 1DBFA 5IJ9B 3NK6A 5JH7B 3I56F 5HY1A 1NMUB 5ITZA 3D01A 2QTPA 4BW0B 3J80M 4RQOA 3CB2A 4TV9A 1VQKF 1TUBB 3QHDA 4G4WA 5FLXM 3LYBA 3VYSC 2Z1UA 3P4EA 3I55F 3JAWB 1KNKA 2IAFA 3JVHA 1FNJA 1YGYA 2HP3A 3NK7A 4O2AA 3JCMM 3V3TA 4TV8B 3VMFB 2HS0A 1VQ7F 4IHJA 2WALA 3B6NA 2HP0B 2YYEA 3E22B 3TD4A 5CB4B 3O85A 2FC3A 1K8AH 2HS3A 1T0AA 4G4VA 3CCQF 1FFXA 5JCOA 3VOBA 3CCLF 2RHOA 3IEQA 2Q1YA 1XBIA 3CYPB 5GIPC 1U43A 1Q86H 2Z01A 2K1SA 2UYJA 3HKBB 5GONB 1T0KB 3CCRF 3RYFA 3AGKA 2DT4A 3M84A 3HAXD 2KTUA 5KX5A 4O4IB 1YHQF 2UYKA 4BVSA 4O2BB 3JAMM 1YI2F 3RA5A 5AVMA 2ZVYA 1W3EX 3J7AR 5LA6B 2QA4F 3IMPA 5FJ4C 3J81M 3E1YA 3V4DA 3FPIA 3HKCA 3ON1A 4EB6B 3VIUA 2KGWA 3F6MA 4BVRA 3VI6A 1CN7A 2GZLA 1R1MA 3K0TA 4HNAA 5EYPB 1PXWA 5JH7A 1TVKB 1W59A 4C82A 3CCMF 3JATB 2VGNA 3JASB 3K14A 3ELCA 3FD6A 1JD1A 1TUBA 1W5FA 2AIFA 2CZWA 3RYIB 1JFFB 3HKDB 1KQSF 4ZHQA 3JAKB 5MN5A 3BYQA 1IV3A 3S02A 3IEWA 5IYZB 5EZYB 2R751 2HS4A 4NQ3A 2HP0A 5CB4A 3IKFA 4F6RA 1YITF 4X1YB 2L26A 2BO1A 3G71F 1X7OA 3SIVA 2BTQB 4ZOLB 4C81A 4EI7A 3CC7F 4U3JB 3Q8HA 2AIZP 4DRXB 3KE1A 4XCQA 1DT9A 5GONA 3ZP4A 4I50A 3OONA 5FNVB 5J2UB 3K2XA 4O2BA 1Q8RA 4LNUB 5LYJA 5CA1A 3M1XA 5EWRA 1VK3A 1QVFF 3NMUC 3N2KA 3N4ZA 2ZODA 3HKEB 4O4HB 4C8EA 1NQ3A 4X1KA 2VXYA 1PF5A 2LBXA 3C8LA 3LFOA 2ZVZA 3MCAB 3TD3A 1TVKA 1GX1A 1SA0A 2V9YA 1Z5WA 2PHNA 4DXDA 5LXTB 3JALB 3I7TA 5JVDA 2I6DA 2UYNB 1QU9A 4G4YA 1X25A 1X7PA 1Q81H 4NWOB 4I55B 4ZHVA 2CHSA 3WJPA 1W5AA 5BMVB 5IYZA 1M90H 1RLUA 1U40A 4C4WC 1GZ0A 4WBNA 4YJ3B 2KTVA 4X20B 3UT5A 4ZHYB 3VO8A 4O4JA 5LOVB 2RHHA 3TD5A 5CA0A 3S03A 3RYHA 1OFUA 2H8EA 3V7EA 5LP6B 4YJ2B 3OBWA 2N48A 3C9TA 1ODEA 4IIJA 3P10A 5IJ0B 2RHLA 5KMGB 3HTNA 3KJKA 5LP6C 2RB9A 3U0OA 4B46A 3WJQA 5C8YA 1ZWZA 4I4TA 4R40B 5G4VC 4EI9A 2I6RA 3CMEF 3CXCF 1XHOA 4BVQA 1J7HA 2VAWA 1UI9A 5GAPK 2H8CA 3D54A 2BTUA 3WGJA 2DYYA 3M4SA 4PWTA 5MN4A 1IV2A 2AMTA 5HP7A 1IV4A 4BT4A 3JALA 1VQ4F 2CSLA 2UYNA 3EORA 1COMA 3CG6A 3D00A 3KIZA 3S0WA 2QI2A 2CHTA 5IJ9A 3GTZA 2CW4A 4B62A 2B33A 5BMVA 1M1KH 2UYPA 4TUYB 4KWEA 5J2TB 2BTOA 3S0HA 3LWOC 1W5EA 3JAWA 4G4XA 5B8FA 1N8RH 1KNJA 3F0DA 3ZP7A 1E7KA 1YIJF 2F9ZC 3I3FA 2W8BC 2FGYA 4TV8A 4BT7A 2UZHA 4EI8A 3E22A 3L7QA 4TZZA 2G9IA 1UFYA 3F0EA 3T80A 1CK2A 3G4SF 2ZOVA 4BY9D 3K12A 3F0FA 4U39A 3C9SA 3HKBA 3VYTC 1W42A 1CLIA 4O4IA 3CD6F 4TV9B 3S0YA 1OAPA 3FFMA 4O4LB 3JARB 2HVYD 2OTJF 5A2QM 5LA6A 2HRUA 2ZF8A 4EB6A 4RHAA 4G4ZA 1FNKA 3ZOPA 1W55A 2Z1EA 1IV1A 4O2AB 5JQGB 4IHJB 2H6LA 5EYPA 5HY4A 3RE3A 3PLAC 3JATA 3WGNA 3JASA 1H7MA 1GO1A 3NVKE 3CCUF 2OTMA 4TUYA 3OBYA 3GYQA 5HY0A 4X3MA 3RYIA 1GO0A 1JFFA 3KHNA 3HJWC 3HKDA 5JCOC 3JAKA 3WGLA 4X3LA 5EB1B 1W2BF 3FD5A 3ESJA 3RYFB 1KC8H 2OZBA 3MCQA 1ONIA 5EZYA 5EO3A 1YJNF 1RQ2A 3N2GB 4X1YA 4B5CA 2RHJA 2HX0A 3E20B 1VQ8F 4ZOLA 4BT2A 1JY8A 4U3JA 2HQSC 2ALEA 2P6YA 5HP8A 2LBWA 3IKEA 4DRXA 3WXMB 3QUWA 2MQEA 4HNAB 3VOAA 2LCAA 3WGKA 4BVTA 2OTLF 2CVLA 3P0ZA 5FNVA 3FBAA 5J2UA 4C8GA 2Z1FA 4LNUA 1VH8A 4O4LA 3V7QA 1VQNF 3JARA 4FFBB 1VQ9F 5HWEA 1K73H 4ZHQB 5GINC 3CMAF 1W40A 3HKEA 4O4HA 5EIBD 1KD1H 3ZO8A 1VQLF 1RA4A 5HXZA 4BT5A 1XV2A 5JQGA 3R0PA 1H47A 1QVGF 4F6RB 1Z5VA 3MBMA 3WJRA 3NVIB 5MN6A 3CCSF 1W41A 1VQPF 1YJWF 1XRGA 3CCJF 1VQ6F 5DCVA 5LXTA 1VQVA 3LDTA 3RYCB 3WGMA 1QD9A 3SIUA 1U3LA 2PMPA 4I55A 1VQOF 4I50B 3F0GA 5EAZA 5HXUA 1VQMF 4G88A 3QTYA 4ERHA 5LYJB 3KJJA 3LWVC 2YXZA 2Z1TA 1W581 5CA1B 1W5BA 4YJ3A 3N2GA 4X20A 3LMEA 4ZI7B 5LOVA 5IT9M 3N2KB 3G6EF 4E6EA 3CPWF 2EWCA
chains in the Genus database with same CATH topology
3CD6F 2FC3A 1YJ9F 1K8AH 3CCQF 3FFMA 1X7PA 1Q81H 3CCLF 2HVYD 2OTJF 5A2QM 1M90H 1XBIA 5GIPC 1Q86H 4C4WC 1GZ0A 2KTVA 1T0KB 3CCEF 3CCRF 5G4UC 4NUTA 3AGKA 3HAXD 5HY4A 2KTUA 3LWRC 3CC4F 1YHQF 4BVSA 3JAMM 1YI2F 3PLAC 3V7EA 3N4YA 3RA5A 1Q82H 1H7MA 3OBWA 1VQ5F 1GO1A 3NVKE 3CCUF 1S72F 1W3EX 3J7AR 3OBYA 2QA4F 3GYQA 5HY0A 4X3MA 3J81M 3E1YA 3HJWC 2QEXF 5FJ4C 1GO0A 3ON1A 1ZWZA 4X3LA 1JJ2F 4BVRA 5G4VC 3VI6A 4EI9A 2KG4A 1W2BF 1CN7A 1KC8H 2OZBA 1PXWA 3CMEF 3CCMF 3CXCF 1NJIH 5EO3A 3LWQC 1X52A 2JNBA 2VGNA 1YJNF 4BVQA 5GAPK 2AIFA 3E20B 1VQ8F 3RA6A 2CZWA 3IR9A 1KQSF 2LBWA 2ALEA 3WXMB 2OTLF 4BVTA 1K9MH 1VQ4F 4NQ3A 1YITF 1Q7YH 5HY2A 4LCKA 3CG6A 3D00A 2BO1A 3G71F 1X7OA 3SIVA 3V7QA 1VQNF 2QI2A 1VQ9F 5HWEA 4EI7A 3CC7F 1K73H 1RLGA 5GANK 3CPQA 5GINC 3CMAF 3PAFA 2VGMA 1W40A 1IPAA 1M1KH 3CC2F 1KD1H 4XCQA 3OW2F 1VQLF 1RA4A 1DT9A 5HXZA 2OHWA 3LWOC 1SDSA 1QVGF 1N8RH 3NVIB 3LWPC 3CCSF 1E7KA 1W41A 1YIJF 1VQPF 2GLZA 2F9ZC 5GIOC 3CCVF 3CCJF 2FGYA 5EWRA 1YJWF 3NK6A 1VQ6F 3I56F 1QVFF 5DCVA 5HY1A 3NMUC 1NMUB 4EI8A 3N4ZA 4TZZA 4BW0B 1CK2A 3J80M 3G4SF 3SIUA 1VQKF 5FLXM 4BY9D 1VQOF 3I55F 2LBXA 3LFOA 5HXUA 1VQMF 3MCAB 3LWVC 3NK7A 3JCMM 3V3TA 3VMFB 1VQ7F 2WALA 2I6DA 5IT9M 3G6EF 1W42A 3CPWF 3O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 F;  2FC3 A;  1YJ9 F;  1K8A H;  3CCQ F;  3FFM A;  1X7P A;  1Q81 H;  3CCL F;  2HVY D;  2OTJ F;  5A2Q M;  1M90 H;  1XBI A;  5GIP C;  1Q86 H;  4C4W C;  1GZ0 A;  2KTV A;  1T0K B;  3CCE F;  3CCR F;  5G4U C;  4NUT A;  3AGK A;  3HAX D;  2KTU A;  3LWR C;  3CC4 F;  1YHQ F;  1YI2 F;  3JAM M;  3PLA C;  3V7E A;  3N4Y A;  3RA5 A;  1Q82 H;  1H7M A;  3OBW A;  1VQ5 F;  1GO1 A;  3NVK E;  3CCU F;  1S72 F;  1W3E X;  3J7A R;  3OBY A;  2QA4 F;  3GYQ A;  5FJ4 C;  4X3M A;  3J81 M;  3E1Y A;  3HJW C;  2QEX F;  1GO0 A;  3ON1 A;  1ZWZ A;  4X3L A;  1JJ2 F;  5G4V C;  3VI6 A;  1CN7 A;  2KG4 A;  1W2B F;  1KC8 H;  2OZB A;  1PXW A;  3CME F;  3CCM F;  3CXC F;  1NJI H;  5EO3 A;  3LWQ C;  1X52 A;  2JNB A;  2VGN A;  1YJN F;  5GAP K;  2AIF A;  3E20 B;  1VQ8 F;  3RA6 A;  2CZW A;  3IR9 A;  1KQS F;  2LBW A;  2ALE A;  3WXM B;  2OTL F;  1K9M H;  1VQ4 F;  1YIT F;  1Q7Y H;  4LCK A;  3CG6 A;  2BO1 A;  3G71 F;  1X7O A;  3SIV A;  3V7Q A;  1VQN F;  2QI2 A;  1VQ9 F;  3CC7 F;  1K73 H;  1RLG A;  5GAN K;  3CPQ A;  5GIN C;  3CMA F;  3PAF A;  2VGM A;  1W40 A;  1IPA A;  1M1K H;  3CC2 F;  1KD1 H;  3OW2 F;  1VQL F;  1RA4 A;  1DT9 A;  2OHW A;  3LWO C;  1SDS A;  1QVG F;  1N8R H;  3NVI B;  3LWP C;  3CCS F;  1E7K A;  1W41 A;  1YIJ F;  1VQP F;  5GIO C;  3CCV F;  1YJW F;  3CCJ F;  5EWR A;  1VQ6 F;  1QVF F;  3NK6 A;  5DCV A;  3I56 F;  3NMU C;  1NMU B;  3N4Z A;  4TZZ A;  4BW0 B;  1CK2 A;  3J80 M;  3G4S F;  3SIU A;  1VQK F;  5FLX M;  4BY9 D;  1VQO F;  3I55 F;  2LBX A;  3LFO A;  1VQM F;  3MCA B;  3LWV C;  3NK7 A;  3JCM M;  3VMF B;  1VQ7 F;  2WAL A;  2I6D A;  5IT9 M;  3G6E F;  1W42 A;  3CPW F;  3O85 A; 
#chains in the Genus database with same CATH topology
 3VCZ A;  1U3P A;  5LP6 A;  4YJ2 A;  1YJ9 F;  4X1K B;  1FSZ A;  5IJ0 A;  5KMG A;  4X1I B;  1SA0 B;  3MDO A;  3CYQ A;  1RQ7 A;  3DDN A;  3CCE F;  5G4U C;  5JVD B;  4NUT A;  3LWR C;  4FFB A;  3CC4 F;  3WPW A;  3N4Y A;  2R6R 1;  1Q82 H;  1VQ5 F;  3MQW A;  4ZK7 A;  1S72 F;  1H48 A;  5ITZ B;  4ZHW A;  2QEX F;  1JJ2 F;  4WBN B;  2KG4 A;  2IG8 A;  3UT5 B;  3ERN A;  4O4J B;  3C9R A;  5CA0 B;  3RYH B;  1NJI H;  3LWQ C;  1SZQ A;  1X52 A;  2JNB A;  2Q1X A;  3RYC A;  4IIJ B;  3GHZ A;  2VAP A;  2IQQ A;  3RA6 A;  4BT6 A;  3IR9 A;  3DC2 A;  5C8Y B;  4I4T B;  3WPX A;  1FFX B;  4M8I A;  2GVI A;  4ZI7 A;  5J2T A;  1K9M H;  1JN1 A;  4B45 A;  1Q7Y H;  5HY2 A;  4LCK A;  2ZAU A;  2LBT A;  5KX5 B;  2NMU A;  2VAM A;  3C9U A;  3S06 A;  1RLG A;  5GAN K;  3CPQ A;  4BT3 A;  4X1I A;  3PAF A;  2VGM A;  1IPA A;  3VTI C;  3CC2 F;  4C8I A;  3OW2 F;  1YQN A;  5EIB C;  3HWU A;  2OHW A;  2HRY A;  3HKC B;  5EB0 A;  1W57 A;  1SDS A;  3VYU C;  3LWP C;  1VHA A;  2CWJ A;  1QAH A;  2GLZ A;  5GIO C;  3CCV F;  1DBF A;  5IJ9 B;  3NK6 A;  5JH7 B;  3I56 F;  5HY1 A;  1NMU B;  5ITZ A;  3D01 A;  2QTP A;  4BW0 B;  3J80 M;  4RQO A;  3CB2 A;  4TV9 A;  1VQK F;  1TUB B;  3QHD A;  4G4W A;  5FLX M;  3LYB A;  3VYS C;  2Z1U A;  3P4E A;  3I55 F;  3JAW B;  1KNK A;  2IAF A;  3JVH A;  1FNJ A;  1YGY A;  2HP3 A;  3NK7 A;  4O2A A;  3JCM M;  3V3T A;  4TV8 B;  3VMF B;  2HS0 A;  1VQ7 F;  4IHJ A;  2WAL A;  3B6N A;  2HP0 B;  2YYE A;  3E22 B;  3TD4 A;  5CB4 B;  3O85 A;  2FC3 A;  1K8A H;  2HS3 A;  1T0A A;  4G4V A;  3CCQ F;  1FFX A;  5JCO A;  3VOB A;  3CCL F;  2RHO A;  3IEQ A;  2Q1Y A;  1XBI A;  3CYP B;  5GIP C;  1U43 A;  1Q86 H;  2Z01 A;  2K1S A;  2UYJ A;  3HKB B;  5GON B;  1T0K B;  3CCR F;  3RYF A;  3AGK A;  2DT4 A;  3M84 A;  3HAX D;  2KTU A;  5KX5 A;  4O4I B;  1YHQ F;  2UYK A;  4BVS A;  4O2B B;  3JAM M;  1YI2 F;  3RA5 A;  5AVM A;  2ZVY A;  1W3E X;  3J7A R;  5LA6 B;  2QA4 F;  3IMP A;  5FJ4 C;  3J81 M;  3E1Y A;  3V4D A;  3FPI A;  3HKC A;  3ON1 A;  4EB6 B;  3VIU A;  2KGW A;  3F6M A;  4BVR A;  3VI6 A;  1CN7 A;  2GZL A;  1R1M A;  3K0T A;  4HNA A;  5EYP B;  1PXW A;  5JH7 A;  1TVK B;  1W59 A;  4C82 A;  3CCM F;  3JAT B;  2VGN A;  3JAS B;  3K14 A;  3ELC A;  3FD6 A;  1JD1 A;  1TUB A;  1W5F A;  2AIF A;  2CZW A;  3RYI B;  1JFF B;  3HKD B;  1KQS F;  4ZHQ A;  3JAK B;  5MN5 A;  3BYQ A;  1IV3 A;  3S02 A;  3IEW A;  5IYZ B;  5EZY B;  2R75 1;  2HS4 A;  4NQ3 A;  2HP0 A;  5CB4 A;  3IKF A;  4F6R A;  1YIT F;  4X1Y B;  2L26 A;  2BO1 A;  3G71 F;  1X7O A;  3SIV A;  2BTQ B;  4ZOL B;  4C81 A;  4EI7 A;  3CC7 F;  4U3J B;  3Q8H A;  2AIZ P;  4DRX B;  3KE1 A;  4XCQ A;  1DT9 A;  5GON A;  3ZP4 A;  4I50 A;  3OON A;  5FNV B;  5J2U B;  3K2X A;  4O2B A;  1Q8R A;  4LNU B;  5LYJ A;  5CA1 A;  3M1X A;  5EWR A;  1VK3 A;  1QVF F;  3NMU C;  3N2K A;  3N4Z A;  2ZOD A;  3HKE B;  4O4H B;  4C8E A;  1NQ3 A;  4X1K A;  2VXY A;  1PF5 A;  2LBX A;  3C8L A;  3LFO A;  2ZVZ A;  3MCA B;  3TD3 A;  1TVK A;  1GX1 A;  1SA0 A;  2V9Y A;  1Z5W A;  2PHN A;  4DXD A;  5LXT B;  3JAL B;  3I7T A;  5JVD A;  2I6D A;  2UYN B;  1QU9 A;  4G4Y A;  1X25 A;  1X7P A;  1Q81 H;  4NWO B;  4I55 B;  4ZHV A;  2CHS A;  3WJP A;  1W5A A;  5BMV B;  5IYZ A;  1M90 H;  1RLU A;  1U40 A;  4C4W C;  1GZ0 A;  4WBN A;  4YJ3 B;  2KTV A;  4X20 B;  3UT5 A;  4ZHY B;  3VO8 A;  4O4J A;  5LOV B;  2RHH A;  3TD5 A;  5CA0 A;  3S03 A;  3RYH A;  1OFU A;  2H8E A;  3V7E A;  5LP6 B;  4YJ2 B;  3OBW A;  2N48 A;  3C9T A;  1ODE A;  4IIJ A;  3P10 A;  5IJ0 B;  2RHL A;  5KMG B;  3HTN A;  3KJK A;  5LP6 C;  2RB9 A;  3U0O A;  4B46 A;  3WJQ A;  5C8Y A;  1ZWZ A;  4I4T A;  4R40 B;  5G4V C;  4EI9 A;  2I6R A;  3CME F;  3CXC F;  1XHO A;  4BVQ A;  1J7H A;  2VAW A;  1UI9 A;  5GAP K;  2H8C A;  3D54 A;  2BTU A;  3WGJ A;  2DYY A;  3M4S A;  4PWT A;  5MN4 A;  1IV2 A;  2AMT A;  5HP7 A;  1IV4 A;  4BT4 A;  3JAL A;  1VQ4 F;  2CSL A;  2UYN A;  3EOR A;  1COM A;  3CG6 A;  3D00 A;  3KIZ A;  3S0W A;  2QI2 A;  2CHT A;  5IJ9 A;  3GTZ A;  2CW4 A;  4B62 A;  2B33 A;  5BMV A;  1M1K H;  2UYP A;  4TUY B;  4KWE A;  5J2T B;  2BTO A;  3S0H A;  3LWO C;  1W5E A;  3JAW A;  4G4X A;  5B8F A;  1N8R H;  1KNJ A;  3F0D A;  3ZP7 A;  1E7K A;  1YIJ F;  2F9Z C;  3I3F A;  2W8B C;  2FGY A;  4TV8 A;  4BT7 A;  2UZH A;  4EI8 A;  3E22 A;  3L7Q A;  4TZZ A;  2G9I A;  1UFY A;  3F0E A;  3T80 A;  1CK2 A;  3G4S F;  2ZOV A;  4BY9 D;  3K12 A;  3F0F A;  4U39 A;  3C9S A;  3HKB A;  3VYT C;  1W42 A;  1CLI A;  4O4I A;  3CD6 F;  4TV9 B;  3S0Y A;  1OAP A;  3FFM A;  4O4L B;  3JAR B;  2HVY D;  2OTJ F;  5A2Q M;  5LA6 A;  2HRU A;  2ZF8 A;  4EB6 A;  4RHA A;  4G4Z A;  1FNK A;  3ZOP A;  1W55 A;  2Z1E A;  1IV1 A;  4O2A B;  5JQG B;  4IHJ B;  2H6L A;  5EYP A;  5HY4 A;  3RE3 A;  3PLA C;  3JAT A;  3WGN A;  3JAS A;  1H7M A;  1GO1 A;  3NVK E;  3CCU F;  2OTM A;  4TUY A;  3OBY A;  3GYQ A;  5HY0 A;  4X3M A;  3RYI A;  1GO0 A;  1JFF A;  3KHN A;  3HJW C;  3HKD A;  5JCO C;  3JAK A;  3WGL A;  4X3L A;  5EB1 B;  1W2B F;  3FD5 A;  3ESJ A;  3RYF B;  1KC8 H;  2OZB A;  3MCQ A;  1ONI A;  5EZY A;  5EO3 A;  1YJN F;  1RQ2 A;  3N2G B;  4X1Y A;  4B5C A;  2RHJ A;  2HX0 A;  3E20 B;  1VQ8 F;  4ZOL A;  4BT2 A;  1JY8 A;  4U3J A;  2HQS C;  2ALE A;  2P6Y A;  5HP8 A;  2LBW A;  3IKE A;  4DRX A;  3WXM B;  3QUW A;  2MQE A;  4HNA B;  3VOA A;  2LCA A;  3WGK A;  4BVT A;  2OTL F;  2CVL A;  3P0Z A;  5FNV A;  3FBA A;  5J2U A;  4C8G A;  2Z1F A;  4LNU A;  1VH8 A;  4O4L A;  3V7Q A;  1VQN F;  3JAR A;  4FFB B;  1VQ9 F;  5HWE A;  1K73 H;  4ZHQ B;  5GIN C;  3CMA F;  1W40 A;  3HKE A;  4O4H A;  5EIB D;  1KD1 H;  3ZO8 A;  1VQL F;  1RA4 A;  5HXZ A;  4BT5 A;  1XV2 A;  5JQG A;  3R0P A;  1H47 A;  1QVG F;  4F6R B;  1Z5V A;  3MBM A;  3WJR A;  3NVI B;  5MN6 A;  3CCS F;  1W41 A;  1VQP F;  1YJW F;  1XRG A;  3CCJ F;  1VQ6 F;  5DCV A;  5LXT A;  1VQV A;  3LDT A;  3RYC B;  3WGM A;  1QD9 A;  3SIU A;  1U3L A;  2PMP A;  4I55 A;  1VQO F;  4I50 B;  3F0G A;  5EAZ A;  5HXU A;  1VQM F;  4G88 A;  3QTY A;  4ERH A;  5LYJ B;  3KJJ A;  3LWV C;  2YXZ A;  2Z1T A;  1W58 1;  5CA1 B;  1W5B A;  4YJ3 A;  3N2G A;  4X20 A;  3LME A;  4ZI7 B;  5LOV A;  5IT9 M;  3N2K B;  3G6E F;  4E6E A;  3CPW F;  2EWC A; 
#chains in the Genus database with same CATH homology
 3CD6 F;  2FC3 A;  1YJ9 F;  1K8A H;  3CCQ F;  3FFM A;  1X7P A;  1Q81 H;  3CCL F;  2HVY D;  2OTJ F;  5A2Q M;  1M90 H;  1XBI A;  5GIP C;  1Q86 H;  4C4W C;  1GZ0 A;  2KTV A;  1T0K B;  3CCE F;  3CCR F;  5G4U C;  4NUT A;  3AGK A;  3HAX D;  5HY4 A;  2KTU A;  3LWR C;  3CC4 F;  1YHQ F;  4BVS A;  3JAM M;  1YI2 F;  3PLA C;  3V7E A;  3N4Y A;  3RA5 A;  1Q82 H;  1H7M A;  3OBW A;  1VQ5 F;  1GO1 A;  3NVK E;  3CCU F;  1S72 F;  1W3E X;  3J7A R;  3OBY A;  2QA4 F;  3GYQ A;  5HY0 A;  4X3M A;  3J81 M;  3E1Y A;  3HJW C;  2QEX F;  5FJ4 C;  1GO0 A;  3ON1 A;  1ZWZ A;  4X3L A;  1JJ2 F;  4BVR A;  5G4V C;  3VI6 A;  4EI9 A;  2KG4 A;  1W2B F;  1CN7 A;  1KC8 H;  2OZB A;  1PXW A;  3CME F;  3CCM F;  3CXC F;  1NJI H;  5EO3 A;  3LWQ C;  1X52 A;  2JNB A;  2VGN A;  1YJN F;  4BVQ A;  5GAP K;  2AIF A;  3E20 B;  1VQ8 F;  3RA6 A;  2CZW A;  3IR9 A;  1KQS F;  2LBW A;  2ALE A;  3WXM B;  2OTL F;  4BVT A;  1K9M H;  1VQ4 F;  4NQ3 A;  1YIT F;  1Q7Y H;  5HY2 A;  4LCK A;  3CG6 A;  3D00 A;  2BO1 A;  3G71 F;  1X7O A;  3SIV A;  3V7Q A;  1VQN F;  2QI2 A;  1VQ9 F;  5HWE A;  4EI7 A;  3CC7 F;  1K73 H;  1RLG A;  5GAN K;  3CPQ A;  5GIN C;  3CMA F;  3PAF A;  2VGM A;  1W40 A;  1IPA A;  1M1K H;  3CC2 F;  1KD1 H;  4XCQ A;  3OW2 F;  1VQL F;  1RA4 A;  1DT9 A;  5HXZ A;  2OHW A;  3LWO C;  1SDS A;  1QVG F;  1N8R H;  3NVI B;  3LWP C;  3CCS F;  1E7K A;  1W41 A;  1YIJ F;  1VQP F;  2GLZ A;  2F9Z C;  5GIO C;  3CCV F;  3CCJ F;  2FGY A;  5EWR A;  1YJW F;  3NK6 A;  1VQ6 F;  3I56 F;  1QVF F;  5DCV A;  5HY1 A;  3NMU C;  1NMU B;  4EI8 A;  3N4Z A;  4TZZ A;  4BW0 B;  1CK2 A;  3J80 M;  3G4S F;  3SIU A;  1VQK F;  5FLX M;  4BY9 D;  1VQO F;  3I55 F;  2LBX A;  3LFO A;  5HXU A;  1VQM F;  3MCA B;  3LWV C;  3NK7 A;  3JCM M;  3V3T A;  3VMF B;  1VQ7 F;  2WAL A;  2I6D A;  5IT9 M;  3G6E F;  1W42 A;  3CPW F;  3O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...