5EWRA

C merolae u4 snrnp protein snu13
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
DPRAYPFAPADLVVEILDLVQQASHYKQIKKGLNEVLKSMNRGLAEFVVLAADTQPLEILLSAPLVAEDKAVPYVFVPSKAALGRACGVSRPVIACAVLRADMSQLRNQITALRTKIEQLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Box C/D snoRNP and U4 snRNP component Snu13p
publication title Conserved structure of Snu13 from the highly reduced spliceosome of Cyanidioschyzon merolae.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
molecule tags Rna binding protein
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ewrA00
3OBYA 3OBWA 2LBWA 3CPWF 3CCLF 1YHQF 3NVIB 3E20B 3RA6A 1W40A 1GO1A 3J80M 1YIJF 3SIVA 2KTVA 3CPQA 1YJWF 5G4VC 3CXCF 2LBXA 4C4WC 1W41A 1W42A 1YJNF 1JJ2F 5GIPC 3N4YA 3CCMF 1VQKF 1W3EX 4NUTA 3PLAC 5FJ4C 3PAFA 1Q7YH 2QA4F 3GYQA 3NK6A 3J81M 3LWQC 2JNBA 3FFMA 3CCSF 3N4ZA 3MCAB 1NJIH 5GINC 3CC7F 1Q81H 1VQMF 2OHWA 2BO1A 2CZWA 5GIOC 1W2BF 3I55F 3CCQF 1KQSF 4TZZA 3V7EA 1VQ7F 3E1YA 1VQPF 3CD6F 1VQNF 3NMUC 1X52A 3G4SF 1XBIA 1IPAA 1M1KH 3JAMM 3JCMM 2VGMA 5GANK 1X7PA 1K8AH 3CCRF 3V7QA 2HVYD 1VQ6F 3NVKE 1H7MA 1NMUB 4BY9D 3O85A 2KG4A 2QEXF 1T0KB 1YJ9F 1E7KA 3ON1A 4X3LA 3G71F 5EWRA 1X7OA 1N8RH 1CN7A 3SIUA 2AIFA 2VGNA 2OTJF 1VQLF 1RA4A 1KD1H 1RLGA 3J7AR 3VMFB 3LFOA 3LWPC 3OW2F 3AGKA 3G6EF 3CMEF 4LCKA 5FLXM 3HJWC 3CMAF 3IR9A 3CCJF 1CK2A 2QI2A 1YI2F 1VQ4F 2I6DA 3NK7A 5G4UC 3RA5A 2OZBA 3VI6A 5EO3A 1Q82H 3CG6A 3WXMB 3CCVF 1K9MH 1K73H 1QVFF 1Q86H 5A2QM 3CCEF 1VQ5F 1SDSA 1VQ9F 3CCUF 3CC4F 5DCVA 5GAPK 2KTUA 1QVGF 2FC3A 3LWOC 3LWRC 2ALEA 3HAXD 4X3MA 5IT9M 1S72F 3LWVC 1PXWA 1DT9A 1GZ0A 1GO0A 2OTLF 1ZWZA 2WALA 3CC2F 1VQOF 1YITF 4BW0B 3I56F 1M90H 1KC8H 1VQ8F
chains in the Genus database with same CATH superfamily
3N2GB 3OBWA 5JVDB 3JATB 2H6LA 2AMTA 3C9TA 4KWEA 3RA6A 5ITZA 3J80M 3VYUC 4TV9A 3SIVA 1SZQA 2L26A 3JALA 3CXCF 2HRUA 5J2TB 3V3TA 3RYIA 4C4WC 3HKEA 1R1MA 4ZI7B 2H8EA 2ZVYA 1JJ2F 2ZF8A 1W57A 3CB2A 3ZP7A 4EI8A 3MQWA 3PLAC 4I55B 4WBNB 1TVKA 5EIBD 5EAZA 2PMPA 2QA4F 3LWQC 2R6R1 3RYFA 5GINC 2Q1YA 2HS4A 5EZYA 3C9UA 3FBAA 3JASA 1FFXA 1W2BF 1UI9A 3JVHA 3I3FA 4TZZA 3F0EA 1XV2A 4BVSA 1VQPF 3CD6F 3NMUC 4YJ2B 3G4SF 1XBIA 3LDTA 4NWOB 3WJPA 3B6NA 3JCMM 5GANK 5IJ9A 4O4JB 5JCOA 5KX5B 2AIZP 3N2GA 5JVDA 4I4TB 1U43A 3JATA 4BY9D 3O85A 1J7HA 4C82A 2KG4A 1YJ9F 4EI7A 3G71F 1X7OA 1N8RH 1JD1A 4IHJB 4G88A 2HQSC 2NMUA 4C8GA 3WJRA 1UFYA 2OTJF 5J2TA 1IV2A 1RA4A 4IIJB 1SA0B 3HKCB 3J7AR 3F0DA 1VK3A 3LWPC 4ZI7A 2RHHA 3D00A 4BT3A 4ZOLB 1JFFB 3CCJF 4I55A 1VQ4F 3NK7A 5LOVB 3RA5A 5HY2A 4TV8B 1K9MH 4X20A 3C9RA 5A2QM 3CCEF 1X25A 4I50B 3VIUA 4G4YA 3WGJA 5DCVA 2DT4A 4E6EA 2KTUA 5FNVB 5IT9M 2VAMA 4B46A 5HY4A 3S0YA 3TD5A 1NQ3A 1ZWZA 2N48A 3JAKA 1M90H 4YJ2A 4G4ZA 3KJJA 3OBYA 2EWCA 5CA0B 4BVTA 4ZHQA 1YHQF 3NVIB 3E20B 3K14A 4R40B 4O4JA 5J2UB 5C8YB 3RYHB 4C81A 3LMEA 2LBXA 2YXZA 4O2AA 1W41A 4F6RB 1W42A 2GVIA 3K2XA 3U0OA 3K12A 2ZODA 2HS3A 4IHJA 1VQKF 1W3EX 4NUTA 3UT5B 3HWUA 5HWEA 1SA0A 3HKCA 1VH8A 5HXUA 1W5BA 3N4ZA 1NJIH 5KMGB 4ZOLA 4X1IB 3JARB 4YJ3B 1JFFA 4BT2A 4O4HA 3FD5A 2R751 1XRGA 5GIOC 2CW4A 2HX0A 4TV8A 3LYBA 1KQSF 5BMVA 5JCOC 3V7EA 3VOBA 3E1YA 2HP0A 4G4WA 1VQNF 2BTQB 1X52A 3RYCB 1IPAA 4DXDA 1TUBB 5GONB 4ZHYB 2LBTA 3V4DA 1JY8A 3VO8A 5EB1B 3CCRF 5JQGA 3JAWA 3BYQA 5HP7A 3ZOPA 5HP8A 5CA0A 1NMUB 4PWTA 5LP6B 1RQ2A 1T0KB 4X3LA 3QTYA 3WJQA 3SIUA 5J2UA 1W55A 5C8YA 3RYHA 1KD1H 1PF5A 3N2KB 2ZVZA 4F6RA 2ZAUA 3LFOA 3FD6A 2UYNA 3AGKA 3G6EF 3CMEF 4LCKA 3KIZA 5FLXM 3HJWC 2Z1TA 1Z5WA 2F9ZC 3UT5A 2QI2A 4BT7A 5G4UC 2OZBA 4RQOA 5LYJB 5KMGA 4X1IA 3JARA 1FNKA 4YJ3A 3S0WA 5EB0A 5GAPK 5LA6B 1DBFA 1QD9A 1QU9A 2ALEA 3WPXA 1U40A 1DT9A 2QTPA 3VYSC 3C9SA 3CC2F 1YITF 3CYPB 1KC8H 2B33A 3M1XA 3P4EA 3QUWA 1TUBA 3ZO8A 1VQ8F 2LBWA 3M84A 1IV3A 4WBNA 3HKBB 1W40A 2CHTA 1KNJA 2W8BC 2KTVA 3D54A 3CPQA 2RHOA 4X1KB 5LP6A 4EB6B 5EYPB 1ODEA 3VYTC 1ONIA 5CA1B 3CCMF 2HP3A 3IEQA 2UYJA 1FSZA 5MN5A 1JN1A 4O2BB 5FJ4C 3GYQA 3NK6A 3N2KA 1W5EA 4O4IB 3J81M 2JNBA 3CCSF 2IAFA 1OFUA 4U3JB 3CC7F 3HKEB 2VXYA 2BO1A 5CB4B 3I55F 3CCQF 5KX5A 4HNAB 4I4TA 2UYPA 4C8IA 1VQ7F 4G4XA 3M4SA 2Q1XA 1Z5VA 2P6YA 5LA6A 3IEWA 1M1KH 4NQ3A 1QAHA 4IIJA 1X7PA 2IQQA 3CYQA 2IG8A 3MBMA 3JASB 3IKFA 1VQVA 1YGYA 3TD4A 3V7QA 1VQ6F 3HTNA 2CWJA 1RLUA 1U3LA 2G9IA 2K1SA 5JH7B 3P10A 5MN6A 3EORA 2UYKA 1E7KA 3ON1A 3HKBA 2GLZA 5EWRA 5LOVA 1W5AA 1CN7A 2VGNA 3OONA 4I50A 4LNUB 1XHOA 3E22B 1RLGA 4X1KA 5IYZB 4EB6A 3VMFB 5EYPA 3S06A 5FNVA 5CA1A 1T0AA 3IR9A 5IJ0B 3WGMA 2I6RA 3VOAA 4O2BA 2CVLA 2I6DA 4O4IA 5MN4A 3HKDB 1Q82H 3CG6A 3CCVF 2RHJA 2Z1FA 1K73H 5EIBC 1SDSA 4U3JA 1RQ7A 3L7QA 3CC4F 1KNKA 3ESJA 5CB4A 1QVGF 2FC3A 3LWOC 3HAXD 4FFBB 4DRXB 1S72F 4HNAA 2CSLA 1GO0A 2WALA 2YYEA 4BW0B 2VAPA 3I56F 5LP6C 2LCAA 4X20B 2HRYA 1COMA 3CPWF 1Q8RA 1W5FA 4BT6A 4O4LB 2UZHA 3CCLF 4TUYB 3VTIC 1GO1A 2PHNA 1YIJF 3MCQA 1YJWF 5G4VC 1OAPA 2Z1UA 3K0TA 5JH7A 3MDOA 2H8CA 3JAKB 1CLIA 1H48A 1YJNF 3T80A 4M8IA 5GIPC 3N4YA 3IMPA 1IV4A 3KJKA 1W59A 4ZHQB 3PAFA 1Q7YH 4LNUA 3E22A 5IYZA 3WGKA 2DYYA 3FFMA 5HY0A 3RYCA 3MCAB 3QHDA 5GONA 4X1YB 1Q81H 5IJ0A 2FGYA 2OTMA 1VQMF 3DC2A 4O2AB 2OHWA 5B8FA 2CZWA 2Z1EA 2MQEA 3HKDA 2GZLA 3C8LA 3F0GA 3KHNA 4B62A 4ZHWA 3F0FA 5LXTB 3ZP4A 2HS0A 2CHSA 1VHAA 3VCZA 4FFBA 2BTUA 4ZK7A 4BVQA 3S02A 4DRXA 3JAMM 3I7TA 4G4VA 4ZHVA 3S03A 2VAWA 2VGMA 1H47A 4O4HB 3Q8HA 3D01A 1K8AH 5ITZB 2HVYD 4TV9B 3GTZA 3RE3A 2ZOVA 3NVKE 3FPIA 3JALB 5BMVB 1IV1A 1H7MA 3ELCA 3RYIB 2KGWA 4O4LA 2HP0B 4TUYA 2QEXF 3KE1A 4RHAA 5LYJA 2AIFA 3ERNA 2Z01A 4B5CA 3WPWA 4BT5A 1TVKB 1VQLF 1GX1A 3R0PA 2RHLA 3WGLA 4XCQA 3OW2F 2RB9A 4BVRA 5JQGB 3JAWB 1YQNA 3RYFB 4ERHA 3CMAF 1CK2A 1FNJA 5EZYB 3DDNA 1YI2F 1FFXB 3IKEA 3VI6A 5EO3A 3WXMB 1QVFF 3TD3A 4X1YA 1Q86H 1VQ5F 2BTOA 1VQ9F 3CCUF 3P0ZA 4B45A 3WGNA 2UYNB 1W581 3GHZA 3LWRC 4X3MA 5HY1A 1U3PA 3LWVC 1PXWA 1GZ0A 5IJ9B 4BT4A 4C8EA 2OTLF 4U39A 4EI9A 3S0HA 1VQOF 5AVMA 2V9YA 5LXTA 5HXZA 3F6MA
chains in the Genus database with same CATH topology
3OBYA 3OBWA 2LBWA 3CPWF 4BVTA 3CCLF 1YHQF 3NVIB 3E20B 3RA6A 1W40A 1GO1A 3J80M 1YIJF 3SIVA 2KTVA 3CPQA 1YJWF 5G4VC 3CXCF 2LBXA 3V3TA 4C4WC 1W41A 1W42A 1YJNF 1JJ2F 5GIPC 3N4YA 3CCMF 1VQKF 4EI8A 1W3EX 4NUTA 3PLAC 5FJ4C 3PAFA 5HWEA 1Q7YH 2QA4F 3GYQA 3NK6A 5HXUA 3J81M 3LWQC 2JNBA 3FFMA 5HY0A 3CCSF 3N4ZA 3MCAB 1NJIH 5GINC 3CC7F 1Q81H 2FGYA 1VQMF 2OHWA 2BO1A 2CZWA 5GIOC 1W2BF 3I55F 3CCQF 1KQSF 4TZZA 3V7EA 1VQ7F 3E1YA 1VQPF 4BVSA 3CD6F 1VQNF 3NMUC 1X52A 3G4SF 1XBIA 1IPAA 1M1KH 4BVQA 3JAMM 4NQ3A 3JCMM 2VGMA 5GANK 1X7PA 1K8AH 3CCRF 3V7QA 2HVYD 1VQ6F 3NVKE 1H7MA 1NMUB 4BY9D 3O85A 2KG4A 2QEXF 1T0KB 1YJ9F 1E7KA 3ON1A 4X3LA 4EI7A 2GLZA 3G71F 5EWRA 1X7OA 1N8RH 1CN7A 3SIUA 2AIFA 2VGNA 2OTJF 1VQLF 1RA4A 1KD1H 1RLGA 3J7AR 3VMFB 3LFOA 3LWPC 4XCQA 3OW2F 3AGKA 4BVRA 3G6EF 3CMEF 4LCKA 3D00A 5FLXM 3HJWC 3CMAF 3IR9A 3CCJF 1CK2A 2F9ZC 2QI2A 1YI2F 1VQ4F 2I6DA 3NK7A 5G4UC 3RA5A 5HY2A 2OZBA 3VI6A 5EO3A 1Q82H 3CG6A 3WXMB 3CCVF 1K9MH 1K73H 1QVFF 1Q86H 5A2QM 3CCEF 1VQ5F 1SDSA 1VQ9F 3CCUF 3CC4F 5DCVA 5GAPK 2KTUA 1QVGF 2FC3A 3LWOC 3LWRC 2ALEA 3HAXD 4X3MA 5IT9M 5HY1A 1S72F 3LWVC 1PXWA 5HY4A 1DT9A 1GZ0A 1GO0A 2OTLF 1ZWZA 2WALA 3CC2F 4EI9A 1VQOF 1YITF 4BW0B 3I56F 1M90H 1KC8H 5HXZA 1VQ8F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBY A;  3OBW A;  2LBW A;  3CPW F;  3CCL F;  1YHQ F;  3NVI B;  3E20 B;  3RA6 A;  1W40 A;  1GO1 A;  3J80 M;  1YIJ F;  3SIV A;  2KTV A;  3CPQ A;  1YJW F;  5G4V C;  3CXC F;  2LBX A;  4C4W C;  1W41 A;  1W42 A;  1YJN F;  1JJ2 F;  5GIP C;  3N4Y A;  3CCM F;  1VQK F;  1W3E X;  4NUT A;  3PLA C;  5FJ4 C;  3PAF A;  1Q7Y H;  2QA4 F;  3GYQ A;  3NK6 A;  3J81 M;  3LWQ C;  2JNB A;  3FFM A;  3CCS F;  3N4Z A;  3MCA B;  1NJI H;  5GIN C;  3CC7 F;  1Q81 H;  1VQM F;  2OHW A;  2BO1 A;  2CZW A;  5GIO C;  1W2B F;  3I55 F;  3CCQ F;  1KQS F;  4TZZ A;  3V7E A;  1VQ7 F;  3E1Y A;  1VQP F;  3CD6 F;  1VQN F;  3NMU C;  1X52 A;  3G4S F;  1XBI A;  1IPA A;  1M1K H;  3JAM M;  3JCM M;  2VGM A;  5GAN K;  1X7P A;  1K8A H;  3CCR F;  3V7Q A;  2HVY D;  1VQ6 F;  3NVK E;  1H7M A;  1NMU B;  4BY9 D;  3O85 A;  2KG4 A;  2QEX F;  1T0K B;  1YJ9 F;  1E7K A;  3ON1 A;  4X3L A;  3G71 F;  5EWR A;  1X7O A;  1N8R H;  1CN7 A;  3SIU A;  2AIF A;  2VGN A;  2OTJ F;  1VQL F;  1RA4 A;  1KD1 H;  1RLG A;  3J7A R;  3VMF B;  3LFO A;  3LWP C;  3OW2 F;  3AGK A;  3G6E F;  3CME F;  4LCK A;  5FLX M;  3HJW C;  3CMA F;  3IR9 A;  3CCJ F;  1CK2 A;  2QI2 A;  1YI2 F;  1VQ4 F;  2I6D A;  3NK7 A;  5G4U C;  3RA5 A;  2OZB A;  3VI6 A;  5EO3 A;  1Q82 H;  3CG6 A;  3WXM B;  3CCV F;  1K9M H;  1K73 H;  1QVF F;  1Q86 H;  5A2Q M;  3CCE F;  1VQ5 F;  1SDS A;  1VQ9 F;  3CCU F;  3CC4 F;  5DCV A;  5GAP K;  2KTU A;  1QVG F;  2FC3 A;  3LWO C;  3LWR C;  2ALE A;  3HAX D;  4X3M A;  5IT9 M;  1S72 F;  3LWV C;  1PXW A;  1DT9 A;  1GZ0 A;  1GO0 A;  2OTL F;  1ZWZ A;  2WAL A;  3CC2 F;  1VQO F;  1YIT F;  4BW0 B;  3I56 F;  1M90 H;  1KC8 H;  1VQ8 F; 
#chains in the Genus database with same CATH topology
 3N2G B;  3OBW A;  5JVD B;  3JAT B;  2H6L A;  2AMT A;  3C9T A;  4KWE A;  3RA6 A;  5ITZ A;  3J80 M;  3VYU C;  4TV9 A;  3SIV A;  1SZQ A;  2L26 A;  3JAL A;  3CXC F;  2HRU A;  5J2T B;  3V3T A;  3RYI A;  4C4W C;  3HKE A;  1R1M A;  4ZI7 B;  2H8E A;  2ZVY A;  1JJ2 F;  2ZF8 A;  1W57 A;  3CB2 A;  3ZP7 A;  4EI8 A;  3MQW A;  3PLA C;  4I55 B;  4WBN B;  1TVK A;  5EIB D;  5EAZ A;  2PMP A;  2QA4 F;  3LWQ C;  2R6R 1;  3RYF A;  5GIN C;  2Q1Y A;  2HS4 A;  5EZY A;  3C9U A;  3FBA A;  3JAS A;  1FFX A;  1W2B F;  1UI9 A;  3JVH A;  3I3F A;  4TZZ A;  3F0E A;  1XV2 A;  4BVS A;  1VQP F;  3CD6 F;  3NMU C;  4YJ2 B;  3G4S F;  1XBI A;  3LDT A;  4NWO B;  3WJP A;  3B6N A;  3JCM M;  5GAN K;  5IJ9 A;  4O4J B;  5JCO A;  5KX5 B;  2AIZ P;  3N2G A;  5JVD A;  4I4T B;  1U43 A;  3JAT A;  4BY9 D;  3O85 A;  1J7H A;  4C82 A;  2KG4 A;  1YJ9 F;  4EI7 A;  3G71 F;  1X7O A;  1N8R H;  1JD1 A;  4IHJ B;  4G88 A;  2HQS C;  2NMU A;  4C8G A;  3WJR A;  1UFY A;  2OTJ F;  5J2T A;  1IV2 A;  1RA4 A;  4IIJ B;  1SA0 B;  3HKC B;  3J7A R;  3F0D A;  1VK3 A;  3LWP C;  4ZI7 A;  2RHH A;  3D00 A;  4BT3 A;  4ZOL B;  1JFF B;  3CCJ F;  4I55 A;  1VQ4 F;  3NK7 A;  5LOV B;  3RA5 A;  5HY2 A;  4TV8 B;  1K9M H;  4X20 A;  3C9R A;  5A2Q M;  3CCE F;  1X25 A;  4I50 B;  3VIU A;  4G4Y A;  3WGJ A;  5DCV A;  2DT4 A;  4E6E A;  2KTU A;  5FNV B;  5IT9 M;  2VAM A;  4B46 A;  5HY4 A;  3S0Y A;  3TD5 A;  1NQ3 A;  1ZWZ A;  2N48 A;  3JAK A;  1M90 H;  4YJ2 A;  4G4Z A;  3KJJ A;  3OBY A;  2EWC A;  5CA0 B;  4BVT A;  4ZHQ A;  1YHQ F;  3NVI B;  3E20 B;  3K14 A;  4R40 B;  4O4J A;  5J2U B;  5C8Y B;  3RYH B;  4C81 A;  3LME A;  2LBX A;  2YXZ A;  4O2A A;  1W41 A;  4F6R B;  1W42 A;  2GVI A;  3K2X A;  3U0O A;  3K12 A;  2ZOD A;  2HS3 A;  4IHJ A;  1VQK F;  1W3E X;  4NUT A;  3UT5 B;  3HWU A;  5HWE A;  1SA0 A;  3HKC A;  1VH8 A;  5HXU A;  1W5B A;  3N4Z A;  1NJI H;  5KMG B;  4ZOL A;  4X1I B;  3JAR B;  4YJ3 B;  1JFF A;  4BT2 A;  4O4H A;  3FD5 A;  2R75 1;  1XRG A;  5GIO C;  2CW4 A;  2HX0 A;  4TV8 A;  3LYB A;  1KQS F;  5BMV A;  5JCO C;  3V7E A;  3VOB A;  3E1Y A;  2HP0 A;  4G4W A;  1VQN F;  2BTQ B;  1X52 A;  3RYC B;  1IPA A;  4DXD A;  1TUB B;  5GON B;  4ZHY B;  2LBT A;  3V4D A;  1JY8 A;  3VO8 A;  5EB1 B;  3CCR F;  5JQG A;  3JAW A;  3BYQ A;  5HP7 A;  3ZOP A;  5HP8 A;  5CA0 A;  1NMU B;  4PWT A;  5LP6 B;  1RQ2 A;  1T0K B;  4X3L A;  3QTY A;  3WJQ A;  3SIU A;  5J2U A;  1W55 A;  5C8Y A;  3RYH A;  1KD1 H;  1PF5 A;  3N2K B;  2ZVZ A;  4F6R A;  2ZAU A;  3LFO A;  3FD6 A;  2UYN A;  3AGK A;  3G6E F;  3CME F;  4LCK A;  3KIZ A;  5FLX M;  3HJW C;  2Z1T A;  1Z5W A;  2F9Z C;  3UT5 A;  2QI2 A;  4BT7 A;  5G4U C;  2OZB A;  4RQO A;  5LYJ B;  5KMG A;  4X1I A;  3JAR A;  1FNK A;  4YJ3 A;  3S0W A;  5EB0 A;  5GAP K;  5LA6 B;  1DBF A;  1QD9 A;  1QU9 A;  2ALE A;  3WPX A;  1U40 A;  1DT9 A;  2QTP A;  3VYS C;  3C9S A;  3CC2 F;  1YIT F;  3CYP B;  1KC8 H;  2B33 A;  3M1X A;  3P4E A;  3QUW A;  1TUB A;  3ZO8 A;  1VQ8 F;  2LBW A;  3M84 A;  1IV3 A;  4WBN A;  3HKB B;  1W40 A;  2CHT A;  1KNJ A;  2W8B C;  2KTV A;  3D54 A;  3CPQ A;  2RHO A;  4X1K B;  5LP6 A;  4EB6 B;  5EYP B;  1ODE A;  3VYT C;  1ONI A;  5CA1 B;  3CCM F;  2HP3 A;  3IEQ A;  2UYJ A;  1FSZ A;  5MN5 A;  1JN1 A;  4O2B B;  5FJ4 C;  3GYQ A;  3NK6 A;  3N2K A;  1W5E A;  4O4I B;  3J81 M;  2JNB A;  3CCS F;  2IAF A;  1OFU A;  4U3J B;  3CC7 F;  3HKE B;  2VXY A;  2BO1 A;  5CB4 B;  3I55 F;  3CCQ F;  5KX5 A;  4HNA B;  4I4T A;  2UYP A;  4C8I A;  1VQ7 F;  4G4X A;  3M4S A;  2Q1X A;  1Z5V A;  2P6Y A;  5LA6 A;  3IEW A;  1M1K H;  4NQ3 A;  1QAH A;  4IIJ A;  1X7P A;  2IQQ A;  3CYQ A;  2IG8 A;  3MBM A;  3JAS B;  3IKF A;  1VQV A;  1YGY A;  3TD4 A;  3V7Q A;  1VQ6 F;  3HTN A;  2CWJ A;  1RLU A;  1U3L A;  2G9I A;  2K1S A;  5JH7 B;  3P10 A;  5MN6 A;  3EOR A;  2UYK A;  1E7K A;  3ON1 A;  3HKB A;  2GLZ A;  5EWR A;  5LOV A;  1W5A A;  1CN7 A;  2VGN A;  3OON A;  4I50 A;  4LNU B;  1XHO A;  3E22 B;  1RLG A;  4X1K A;  5IYZ B;  4EB6 A;  3VMF B;  5EYP A;  3S06 A;  5FNV A;  5CA1 A;  1T0A A;  3IR9 A;  5IJ0 B;  3WGM A;  2I6R A;  3VOA A;  4O2B A;  2CVL A;  2I6D A;  4O4I A;  5MN4 A;  3HKD B;  1Q82 H;  3CG6 A;  3CCV F;  2RHJ A;  2Z1F A;  1K73 H;  5EIB C;  1SDS A;  4U3J A;  1RQ7 A;  3L7Q A;  3CC4 F;  1KNK A;  3ESJ A;  5CB4 A;  1QVG F;  2FC3 A;  3LWO C;  3HAX D;  4FFB B;  4DRX B;  1S72 F;  4HNA A;  2CSL A;  1GO0 A;  2WAL A;  2YYE A;  4BW0 B;  2VAP A;  3I56 F;  5LP6 C;  2LCA A;  4X20 B;  2HRY A;  1COM A;  3CPW F;  1Q8R A;  1W5F A;  4BT6 A;  4O4L B;  2UZH A;  3CCL F;  4TUY B;  3VTI C;  1GO1 A;  2PHN A;  1YIJ F;  3MCQ A;  1YJW F;  5G4V C;  1OAP A;  2Z1U A;  3K0T A;  5JH7 A;  3MDO A;  2H8C A;  3JAK B;  1CLI A;  1H48 A;  1YJN F;  3T80 A;  4M8I A;  5GIP C;  3N4Y A;  3IMP A;  1IV4 A;  3KJK A;  1W59 A;  4ZHQ B;  3PAF A;  1Q7Y H;  4LNU A;  3E22 A;  5IYZ A;  3WGK A;  2DYY A;  3FFM A;  5HY0 A;  3RYC A;  3MCA B;  3QHD A;  5GON A;  4X1Y B;  1Q81 H;  5IJ0 A;  2FGY A;  2OTM A;  1VQM F;  3DC2 A;  4O2A B;  2OHW A;  5B8F A;  2CZW A;  2Z1E A;  2MQE A;  3HKD A;  2GZL A;  3C8L A;  3F0G A;  3KHN A;  4B62 A;  4ZHW A;  3F0F A;  5LXT B;  3ZP4 A;  2HS0 A;  2CHS A;  1VHA A;  3VCZ A;  4FFB A;  2BTU A;  4ZK7 A;  4BVQ A;  3S02 A;  4DRX A;  3JAM M;  3I7T A;  4G4V A;  4ZHV A;  3S03 A;  2VAW A;  2VGM A;  1H47 A;  4O4H B;  3Q8H A;  3D01 A;  1K8A H;  5ITZ B;  2HVY D;  4TV9 B;  3GTZ A;  3RE3 A;  2ZOV A;  3NVK E;  3FPI A;  3JAL B;  5BMV B;  1IV1 A;  1H7M A;  3ELC A;  3RYI B;  2KGW A;  4O4L A;  2HP0 B;  4TUY A;  2QEX F;  3KE1 A;  4RHA A;  5LYJ A;  2AIF A;  3ERN A;  2Z01 A;  4B5C A;  3WPW A;  4BT5 A;  1TVK B;  1VQL F;  1GX1 A;  3R0P A;  2RHL A;  3WGL A;  4XCQ A;  3OW2 F;  2RB9 A;  4BVR A;  5JQG B;  3JAW B;  1YQN A;  3RYF B;  4ERH A;  3CMA F;  1CK2 A;  1FNJ A;  5EZY B;  3DDN A;  1YI2 F;  1FFX B;  3IKE A;  3VI6 A;  5EO3 A;  3WXM B;  1QVF F;  3TD3 A;  4X1Y A;  1Q86 H;  1VQ5 F;  2BTO A;  1VQ9 F;  3CCU F;  3P0Z A;  4B45 A;  3WGN A;  2UYN B;  1W58 1;  3GHZ A;  3LWR C;  4X3M A;  5HY1 A;  1U3P A;  3LWV C;  1PXW A;  1GZ0 A;  5IJ9 B;  4BT4 A;  4C8E A;  2OTL F;  4U39 A;  4EI9 A;  3S0H A;  1VQO F;  5AVM A;  2V9Y A;  5LXT A;  5HXZ A;  3F6M A; 
#chains in the Genus database with same CATH homology
 3OBY A;  3OBW A;  2LBW A;  3CPW F;  4BVT A;  3CCL F;  1YHQ F;  3NVI B;  3E20 B;  3RA6 A;  1W40 A;  1GO1 A;  3J80 M;  1YIJ F;  3SIV A;  2KTV A;  3CPQ A;  1YJW F;  5G4V C;  3CXC F;  2LBX A;  3V3T A;  4C4W C;  1W41 A;  1W42 A;  1YJN F;  1JJ2 F;  5GIP C;  3N4Y A;  3CCM F;  1VQK F;  4EI8 A;  1W3E X;  4NUT A;  3PLA C;  5FJ4 C;  3PAF A;  5HWE A;  1Q7Y H;  2QA4 F;  3GYQ A;  3NK6 A;  5HXU A;  3J81 M;  3LWQ C;  2JNB A;  3FFM A;  5HY0 A;  3CCS F;  3N4Z A;  3MCA B;  1NJI H;  5GIN C;  3CC7 F;  1Q81 H;  2FGY A;  1VQM F;  2OHW A;  2BO1 A;  2CZW A;  5GIO C;  1W2B F;  3I55 F;  3CCQ F;  1KQS F;  4TZZ A;  3V7E A;  1VQ7 F;  3E1Y A;  1VQP F;  4BVS A;  3CD6 F;  1VQN F;  3NMU C;  1X52 A;  3G4S F;  1XBI A;  1IPA A;  1M1K H;  4BVQ A;  3JAM M;  4NQ3 A;  3JCM M;  2VGM A;  5GAN K;  1X7P A;  1K8A H;  3CCR F;  3V7Q A;  2HVY D;  1VQ6 F;  3NVK E;  1H7M A;  1NMU B;  4BY9 D;  3O85 A;  2KG4 A;  2QEX F;  1T0K B;  1YJ9 F;  1E7K A;  3ON1 A;  4X3L A;  4EI7 A;  2GLZ A;  3G71 F;  5EWR A;  1X7O A;  1N8R H;  1CN7 A;  3SIU A;  2AIF A;  2VGN A;  2OTJ F;  1VQL F;  1RA4 A;  1KD1 H;  1RLG A;  3J7A R;  3VMF B;  3LFO A;  3LWP C;  4XCQ A;  3OW2 F;  3AGK A;  4BVR A;  3G6E F;  3CME F;  4LCK A;  3D00 A;  5FLX M;  3HJW C;  3CMA F;  3IR9 A;  3CCJ F;  1CK2 A;  2F9Z C;  2QI2 A;  1YI2 F;  1VQ4 F;  2I6D A;  3NK7 A;  5G4U C;  3RA5 A;  5HY2 A;  2OZB A;  3VI6 A;  5EO3 A;  1Q82 H;  3CG6 A;  3WXM B;  3CCV F;  1K9M H;  1K73 H;  1QVF F;  1Q86 H;  5A2Q M;  3CCE F;  1VQ5 F;  1SDS A;  1VQ9 F;  3CCU F;  3CC4 F;  5DCV A;  5GAP K;  2KTU A;  1QVG F;  2FC3 A;  3LWO C;  3LWR C;  2ALE A;  3HAX D;  4X3M A;  5IT9 M;  5HY1 A;  1S72 F;  3LWV C;  1PXW A;  5HY4 A;  1DT9 A;  1GZ0 A;  1GO0 A;  2OTL F;  1ZWZ A;  2WAL A;  3CC2 F;  4EI9 A;  1VQO F;  1YIT F;  4BW0 B;  3I56 F;  1M90 H;  1KC8 H;  5HXZ A;  1VQ8 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...