5EWRA

C merolae u4 snrnp protein snu13
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
122
Chain Sequence
DPRAYPFAPADLVVEILDLVQQASHYKQIKKGLNEVLKSMNRGLAEFVVLAADTQPLEILLSAPLVAEDKAVPYVFVPSKAALGRACGVSRPVIACAVLRADMSQLRNQITALRTKIEQLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Box C/D snoRNP and U4 snRNP component Snu13p
publication title Conserved structure of Snu13 from the highly reduced spliceosome of Cyanidioschyzon merolae.
pubmed doi rcsb
source organism Cyanidioschyzon merolae
total genus 42
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5ewrA00
2JNBA 3CPWF 3NK7A 3O85A 3JAMM 2QI2A 1VQOF 3CCUF 1VQNF 3G6EF 2OTLF 3CC7F 3NVKE 3LWVC 3CCQF 3E20B 3FFMA 4TZZA 1X52A 2KG4A 3OW2F 3LWQC 1QVGF 1W41A 1T0KB 2OTJF 1X7OA 1H7MA 1W3EX 1YI2F 3NVIB 1JJ2F 2KTUA 1VQ6F 2AIFA 1RLGA 1IPAA 2QEXF 3GYQA 1K73H 3LWPC 4NUTA 1YIJF 3CCVF 1CK2A 3J80M 5G4UC 1YHQF 2FC3A 1M1KH 1W2BF 5GAPK 2BO1A 3MCAB 1N8RH 3CC4F 1M90H 1VQ8F 3E1YA 3LFOA 1NJIH 4X3MA 4C4WC 4BY9D 5EO3A 3CCMF 5G4VC 1YJWF 3G4SF 3N4YA 3CCEF 1VQ5F 5FJ4C 1K8AH 1VQLF 3VMFB 2LBXA 4X3LA 3G71F 3V7EA 3IR9A 3CG6A 5GIPC 3PAFA 4LCKA 3CD6F 1E7KA 1K9MH 4BW0B 2VGMA 2LBWA 3LWRC 5GANK 3CCLF 2QA4F 1PXWA 1GO1A 3V7QA 1YITF 1Q82H 3HAXD 3J7AR 3SIUA 2VGNA 5EWRA 1X7PA 3OBWA 3CCJF 1KQSF 1YJNF 1VQKF 3OBYA 1Q86H 5GIOC 2HVYD 3RA5A 3JCMM 1Q81H 3CCSF 1VQ4F 1QVFF 1GZ0A 2OHWA 3CXCF 1ZWZA 1KC8H 1W42A 1VQ7F 1GO0A 1VQPF 2I6DA 2WALA 1YJ9F 1CN7A 1S72F 2KTVA 3NK6A 1Q7YH 5A2QM 3N4ZA 3CMEF 5IT9M 3I56F 1VQ9F 2OZBA 3AGKA 3HJWC 1XBIA 1DT9A 3CCRF 3RA6A 3I55F 1VQMF 1KD1H 1RA4A 2ALEA 1W40A 2CZWA 5FLXM 5DCVA 3NMUC 3SIVA 3LWOC 3VI6A 3CPQA 5GINC 3ON1A 3WXMB 3CMAF 1SDSA 3J81M 1NMUB 3PLAC 3CC2F
chains in the Genus database with same CATH superfamily
3VIUA 3IKFA 4C8EA 3S0YA 3VOBA 3CC7F 5J2TA 3FPIA 3CCQF 1W5AA 2YXZA 2KG4A 5HY2A 3VCZA 3M84A 1GX1A 2OTJF 3QUWA 2RHHA 2Z01A 3TD3A 3LDTA 4BT5A 1R1MA 1YQNA 1IPAA 3GYQA 2UYNA 2H6LA 4X1KB 5HXZA 2N48A 4ZOLB 5CA0B 4X1YA 5G4UC 5ITZB 3D54A 5FNVB 2AMTA 2I6RA 2NMUA 2CHTA 1JN1A 3VYUC 4EB6B 4HNAB 2HQSC 1J7HA 1Q8RA 5KX5A 1KNJA 5LOVA 1VHAA 4BVRA 5EZYB 4BY9D 3HKBB 3ZP4A 3N4YA 3ZOPA 5FJ4C 3C9TA 2LCAA 3VOAA 3UT5A 3ERNA 3G71F 4TV8B 1RQ2A 3S0WA 1VH8A 5EAZA 1SZQA 4ZK7A 1K9MH 1ONIA 3JASB 2W8BC 3WJQA 4WBNB 5IJ9A 1TVKA 1SA0A 4U39A 3QHDA 2Z1TA 5GANK 3GHZA 3CCLF 5LA6A 1GO1A 2Z1UA 2HP0B 4B45A 4O2AB 1X7PA 4O4HA 3TD4A 3S03A 4F6RA 1KQSF 1VQKF 3C9RA 5MN4A 1VQ4F 5HY4A 4B62A 1QVFF 3VYSC 2K1SA 5GONB 1Z5WA 5HXUA 1KC8H 2VXYA 1W57A 3HWUA 2I6DA 4G4VA 5LP6B 1S72F 3JAKA 1Q7YH 2B33A 3MQWA 4TUYA 3CMEF 3ZO8A 4ZI7A 2CSLA 4ZHQB 4B5CA 2CW4A 5EYPB 1FNJA 3LYBA 1VQ9F 4IIJA 3CCRF 3RA6A 1VQMF 1W59A 2ALEA 3RYHA 2BTUA 4O2BB 4M8IA 4C8GA 4LNUB 1IV4A 4O4LB 4G4XA 3J81M 5C8YA 4I50A 3NK7A 3WPXA 2DYYA 3HKEA 2IAFA 4YJ2A 3N2GA 3CCUF 3G6EF 1TUBA 3ESJA 5J2TB 3S02A 1W41A 4R40B 4KWEA 2HRYA 4NQ3A 3C8LA 3JAWA 1YI2F 1W3EX 1X25A 2RHOA 3N2KA 1UI9A 3RYIB 1VQ6F 2AIFA 1RLGA 4BT4A 4FFBA 3JATA 2QEXF 3HKCB 1K73H 5JH7A 4NUTA 1H48A 1YIJF 3CCVF 1KNKA 3J80M 2UYNB 3K12A 4DRXA 3MCAB 3CC4F 3RE3A 1M90H 3TD5A 3E1YA 2HRUA 5LYJB 5IJ0A 5KX5B 4X3MA 1W5BA 3M1XA 4BT6A 3WGKA 3FBAA 3CCEF 4C8IA 1JD1A 5LOVB 5CA1A 3IEQA 4RHAA 4X3LA 3FD5A 5JVDA 4E6EA 3PAFA 3UT5B 3CD6F 1E7KA 1OAPA 4YJ3A 2ZF8A 3WPWA 2LBWA 2IG8A 5IJ9B 1PXWA 3K0TA 3HKDA 5KMGA 3J7AR 3HAXD 1TVKB 3JARA 3S0HA 3SIUA 1SA0B 5LA6B 2FGYA 1U43A 3OBWA 3CCJF 4G4WA 4O4HB 2HVYD 3RA5A 4F6RB 2UYJA 1Q81H 2G9IA 1FSZA 3S06A 2OHWA 3CXCF 4ERHA 2L26A 1GO0A 1VQPF 2WALA 2KGWA 2GVIA 2KTVA 3NK6A 3ZP7A 3EORA 2ZODA 2LBTA 5IT9M 1ODEA 3T80A 2OZBA 3AGKA 3HJWC 1DT9A 4ZI7B 5HP8A 1RLUA 1YGYA 2UYKA 4IIJB 1RA4A 2ZOVA 3RYHB 3VI6A 5ITZA 5GINC 2HP3A 4LCKA 3CC2F 1JFFB 2JNBA 5JCOC 3CPWF 3JAMM 3F0GA 2UZHA 4O4JA 4HNAA 4BVTA 5C8YB 4I50B 1SDSA 1VQNF 4ZHVA 5AVMA 3LWVC 3HKEB 4TZZA 3N2GB 1X52A 4O4IA 3CYQA 3OW2F 4BVQA 4XCQA 3I7TA 5EZYA 4C82A 1QVGF 2VAPA 4EI7A 1T0KB 1X7OA 3I3FA 4X1IA 1H7MA 1PF5A 2MQEA 3NVIB 2HS0A 2KTUA 5CB4A 5JQGA 3JAWB 4I4TA 3LWPC 1UFYA 4DXDA 3JASA 4FFBB 1DBFA 2VAMA 1YHQF 1QAHA 4BT2A 2GLZA 1COMA 4X20A 2CHSA 5IYZB 1VK3A 2BTQB 2FC3A 1M1KH 4B46A 4DRXB 2BO1A 3MDOA 2V9YA 2Z1FA 1VQ8F 2CWJA 1T0AA 4G4YA 4C4WC 5G4VC 1YJWF 3E22A 3HTNA 3WGMA 1VQ5F 3K2XA 1K8AH 1VQLF 1W5FA 2RHLA 5IJ0B 4ZHWA 1FFXA 3P4EA 3IR9A 3CG6A 5GIPC 3F0DA 2YYEA 2IQQA 5JVDB 4BW0B 2VGMA 2F9ZC 4X1YB 3F0EA 3D00A 2QA4F 4YJ3B 4I55A 2BTOA 2Q1XA 5EWRA 5KMGB 3HKDB 2HX0A 4BVSA 3JARB 3OONA 1YJNF 1XRGA 4U3JA 3GTZA 4PWTA 5LP6C 1JY8A 2QTPA 5GIOC 3JCMM 3F0FA 3CCSF 3RYFA 1GZ0A 4IHJA 2UYPA 3IKEA 5BMVA 4TV9A 1CLIA 4G4ZA 2ZVYA 3IMPA 3JALA 5A2QM 3N4ZA 4EI8A 3R0PA 3RYCA 2EWCA 3IEWA 3WJRA 3RYIA 3I56F 1QD9A 5J2UA 3I55F 3HKCA 3LMEA 3V4DA 1KD1H 1W40A 2RB9A 3NMUC 5LXTA 3DC2A 4NWOB 3C9SA 1NMUB 3PLAC 2DT4A 3O85A 4C81A 2QI2A 3V3TA 1VQOF 2OTLF 3L7QA 5JCOA 3NVKE 4O4JB 3E20B 3FFMA 3VTIC 2H8EA 5LYJA 1RQ7A 5HY0A 3LWQC 1Z5VA 3DDNA 3JAKB 4TUYB 4O4IB 3KJJA 1JJ2F 1U3LA 2GZLA 5HY1A 1U40A 4X1KA 1W581 4X1IB 3F6MA 5CB4B 4ZOLA 1U3PA 5CA0A 5JQGB 3WJPA 3ELCA 5FNVA 1CK2A 1XHOA 3K14A 4ZHYB 4I4TB 4EB6A 3M4SA 1NQ3A 3QTYA 3P10A 4X20B 1W2BF 4G88A 5GAPK 4YJ2B 3VO8A 1IV3A 1N8RH 2PMPA 1TUBB 2ZAUA 3HKBA 3LFOA 4BT3A 2P6YA 2Q1YA 1NJIH 2PHNA 5B8FA 5EO3A 3CCMF 3G4SF 4TV8A 3WGNA 2VAWA 2LBXA 3VMFB 3N2KB 1XV2A 5MN6A 1OFUA 3E22B 3CYPB 3V7EA 3Q8HA 1H47A 4WBNA 3JATB 3WGJA 1FFXB 4EI9A 5JH7B 2Z1EA 5MN5A 3LWRC 2HP0A 5EIBC 3JVHA 4O2AA 3P0ZA 3V7QA 1YITF 1Q82H 3VYTC 1IV2A 2VGNA 5HWEA 4I55B 2HS3A 3OBYA 5HP7A 3MBMA 1JFFA 3KIZA 5EIBD 1Q86H 5GONA 2CVLA 3BYQA 1W5EA 2OTMA 4U3JB 3FD6A 5LP6A 1ZWZA 3WGLA 1W42A 3U0OA 5CA1B 1VQ7F 3RYFB 1QU9A 4IHJB 3D01A 1YJ9F 5EB0A 1CN7A 2ZVZA 4ZHQA 4RQOA 5BMVB 2HS4A 4TV9B 5EYPA 2H8CA 2RHJA 3B6NA 3KHNA 3JALB 1XBIA 1W55A 1FNKA 4O2BA 3RYCB 1VQVA 2R6R1 4LNUA 2AIZP 4O4LA 1IV1A 2CZWA 5FLXM 5DCVA 3MCQA 5J2UB 3SIVA 3KE1A 4BT7A 3LWOC 3CPQA 3ON1A 2R751 3WXMB 5IYZA 5EB1B 3CMAF 3C9UA 3KJKA 3CB2A 5LXTB
chains in the Genus database with same CATH topology
2JNBA 3CPWF 3NK7A 3O85A 3JAMM 2QI2A 3V3TA 1VQOF 4BVTA 3CCUF 1VQNF 3G6EF 2OTLF 3CC7F 3NVKE 3LWVC 3CCQF 3E20B 3FFMA 4TZZA 1X52A 2KG4A 3OW2F 4BVQA 5HY0A 4XCQA 3LWQC 1QVGF 1W41A 5HY2A 4EI7A 1T0KB 4NQ3A 1X7OA 2OTJF 1H7MA 1W3EX 1YI2F 3NVIB 1JJ2F 2KTUA 5HY1A 1VQ6F 2AIFA 1RLGA 1IPAA 2QEXF 3GYQA 1K73H 3LWPC 4NUTA 1YIJF 5HXZA 3CCVF 1CK2A 3J80M 5G4UC 1YHQF 2GLZA 2FC3A 1M1KH 1W2BF 5GAPK 2BO1A 3MCAB 1N8RH 3CC4F 1M90H 1VQ8F 3E1YA 3LFOA 1NJIH 4BVRA 4X3MA 4C4WC 4BY9D 5EO3A 3CCMF 5G4VC 1YJWF 3G4SF 3N4YA 3CCEF 1VQ5F 5FJ4C 1K8AH 1VQLF 3VMFB 2LBXA 4X3LA 3G71F 3V7EA 3IR9A 3CG6A 5GIPC 3PAFA 4LCKA 4EI9A 3CD6F 1E7KA 1K9MH 4BW0B 2VGMA 2F9ZC 3D00A 2LBWA 3LWRC 5GANK 3CCLF 2QA4F 1PXWA 1GO1A 3V7QA 1YITF 1Q82H 3HAXD 3J7AR 3SIUA 2VGNA 5EWRA 5HWEA 2FGYA 1X7PA 4BVSA 3OBWA 3CCJF 1KQSF 1YJNF 1VQKF 3OBYA 1Q86H 5GIOC 2HVYD 3RA5A 3JCMM 1Q81H 3CCSF 5HY4A 1VQ4F 1QVFF 1GZ0A 2OHWA 3CXCF 1ZWZA 5HXUA 1KC8H 1W42A 1VQ7F 1GO0A 1VQPF 2I6DA 2WALA 1YJ9F 1CN7A 1S72F 2KTVA 3NK6A 1Q7YH 5A2QM 3N4ZA 3CMEF 4EI8A 5IT9M 3I56F 1VQ9F 2OZBA 3AGKA 3HJWC 1XBIA 1DT9A 3CCRF 3RA6A 3I55F 1VQMF 1KD1H 1RA4A 2ALEA 1W40A 2CZWA 5FLXM 5DCVA 3NMUC 3SIVA 3LWOC 3VI6A 3CPQA 5GINC 3ON1A 3WXMB 3CMAF 1SDSA 3J81M 1NMUB 3PLAC 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNB A;  3CPW F;  3NK7 A;  3O85 A;  3JAM M;  2QI2 A;  1VQO F;  3CCU F;  1VQN F;  3G6E F;  2OTL F;  3CC7 F;  3NVK E;  3LWV C;  3CCQ F;  3E20 B;  3FFM A;  4TZZ A;  1X52 A;  2KG4 A;  3OW2 F;  3LWQ C;  1QVG F;  1W41 A;  1T0K B;  2OTJ F;  1X7O A;  1H7M A;  1W3E X;  1YI2 F;  3NVI B;  1JJ2 F;  2KTU A;  1VQ6 F;  2AIF A;  1RLG A;  1IPA A;  2QEX F;  3GYQ A;  1K73 H;  3LWP C;  4NUT A;  1YIJ F;  3CCV F;  1CK2 A;  3J80 M;  5G4U C;  1YHQ F;  2FC3 A;  1M1K H;  1W2B F;  5GAP K;  2BO1 A;  3MCA B;  1N8R H;  3CC4 F;  1M90 H;  1VQ8 F;  3E1Y A;  3LFO A;  1NJI H;  4X3M A;  4C4W C;  4BY9 D;  5EO3 A;  3CCM F;  5G4V C;  1YJW F;  3G4S F;  3N4Y A;  3CCE F;  1VQ5 F;  5FJ4 C;  1K8A H;  1VQL F;  3VMF B;  2LBX A;  4X3L A;  3G71 F;  3V7E A;  3IR9 A;  3CG6 A;  5GIP C;  3PAF A;  4LCK A;  3CD6 F;  1E7K A;  1K9M H;  4BW0 B;  2VGM A;  2LBW A;  3LWR C;  5GAN K;  3CCL F;  2QA4 F;  1PXW A;  1GO1 A;  3V7Q A;  1YIT F;  1Q82 H;  3HAX D;  3J7A R;  3SIU A;  2VGN A;  5EWR A;  1X7P A;  3OBW A;  3CCJ F;  1KQS F;  1YJN F;  1VQK F;  3OBY A;  1Q86 H;  5GIO C;  2HVY D;  3RA5 A;  3JCM M;  1Q81 H;  3CCS F;  1VQ4 F;  1QVF F;  1GZ0 A;  2OHW A;  3CXC F;  1ZWZ A;  1KC8 H;  1W42 A;  1VQ7 F;  1GO0 A;  1VQP F;  2I6D A;  2WAL A;  1YJ9 F;  1CN7 A;  1S72 F;  2KTV A;  3NK6 A;  1Q7Y H;  5A2Q M;  3N4Z A;  3CME F;  5IT9 M;  3I56 F;  1VQ9 F;  2OZB A;  3AGK A;  3HJW C;  1XBI A;  1DT9 A;  3CCR F;  3RA6 A;  3I55 F;  1VQM F;  1KD1 H;  1RA4 A;  2ALE A;  1W40 A;  2CZW A;  5FLX M;  5DCV A;  3NMU C;  3SIV A;  3LWO C;  3VI6 A;  3CPQ A;  5GIN C;  3ON1 A;  3WXM B;  3CMA F;  1SDS A;  3J81 M;  1NMU B;  3PLA C;  3CC2 F; 
#chains in the Genus database with same CATH topology
 3VIU A;  3IKF A;  4C8E A;  3S0Y A;  3VOB A;  3CC7 F;  5J2T A;  3FPI A;  3CCQ F;  1W5A A;  2YXZ A;  2KG4 A;  5HY2 A;  3VCZ A;  3M84 A;  1GX1 A;  2OTJ F;  3QUW A;  2RHH A;  2Z01 A;  3TD3 A;  3LDT A;  4BT5 A;  1R1M A;  1YQN A;  1IPA A;  3GYQ A;  2UYN A;  2H6L A;  4X1K B;  5HXZ A;  2N48 A;  4ZOL B;  5CA0 B;  4X1Y A;  5G4U C;  5ITZ B;  3D54 A;  5FNV B;  2AMT A;  2I6R A;  2NMU A;  2CHT A;  1JN1 A;  3VYU C;  4EB6 B;  4HNA B;  2HQS C;  1J7H A;  1Q8R A;  5KX5 A;  1KNJ A;  5LOV A;  1VHA A;  4BVR A;  5EZY B;  4BY9 D;  3HKB B;  3ZP4 A;  3N4Y A;  3ZOP A;  5FJ4 C;  3C9T A;  2LCA A;  3VOA A;  3UT5 A;  3ERN A;  3G71 F;  4TV8 B;  1RQ2 A;  3S0W A;  1VH8 A;  5EAZ A;  1SZQ A;  4ZK7 A;  1K9M H;  1ONI A;  3JAS B;  2W8B C;  3WJQ A;  4WBN B;  5IJ9 A;  1TVK A;  1SA0 A;  4U39 A;  3QHD A;  2Z1T A;  5GAN K;  3GHZ A;  3CCL F;  5LA6 A;  1GO1 A;  2Z1U A;  2HP0 B;  4B45 A;  4O2A B;  1X7P A;  4O4H A;  3TD4 A;  3S03 A;  4F6R A;  1KQS F;  1VQK F;  3C9R A;  5MN4 A;  1VQ4 F;  5HY4 A;  4B62 A;  1QVF F;  3VYS C;  2K1S A;  5GON B;  1Z5W A;  5HXU A;  1KC8 H;  2VXY A;  1W57 A;  3HWU A;  2I6D A;  4G4V A;  5LP6 B;  1S72 F;  3JAK A;  1Q7Y H;  2B33 A;  3MQW A;  4TUY A;  3CME F;  3ZO8 A;  4ZI7 A;  2CSL A;  4ZHQ B;  4B5C A;  2CW4 A;  5EYP B;  1FNJ A;  3LYB A;  1VQ9 F;  4IIJ A;  3CCR F;  3RA6 A;  1VQM F;  1W59 A;  2ALE A;  3RYH A;  2BTU A;  4O2B B;  4M8I A;  4C8G A;  4LNU B;  1IV4 A;  4O4L B;  4G4X A;  3J81 M;  5C8Y A;  4I50 A;  3NK7 A;  3WPX A;  2DYY A;  3HKE A;  2IAF A;  4YJ2 A;  3N2G A;  3CCU F;  3G6E F;  1TUB A;  3ESJ A;  5J2T B;  3S02 A;  1W41 A;  4R40 B;  4KWE A;  2HRY A;  4NQ3 A;  3C8L A;  3JAW A;  1YI2 F;  1W3E X;  1X25 A;  2RHO A;  3N2K A;  1UI9 A;  3RYI B;  1VQ6 F;  2AIF A;  1RLG A;  4BT4 A;  4FFB A;  3JAT A;  2QEX F;  3HKC B;  1K73 H;  5JH7 A;  4NUT A;  1H48 A;  1YIJ F;  3CCV F;  1KNK A;  3J80 M;  2UYN B;  3K12 A;  4DRX A;  3MCA B;  3CC4 F;  3RE3 A;  1M90 H;  3TD5 A;  3E1Y A;  2HRU A;  5LYJ B;  5IJ0 A;  5KX5 B;  4X3M A;  1W5B A;  3M1X A;  4BT6 A;  3WGK A;  3FBA A;  3CCE F;  4C8I A;  1JD1 A;  5LOV B;  5CA1 A;  3IEQ A;  4RHA A;  4X3L A;  3FD5 A;  5JVD A;  4E6E A;  3PAF A;  3UT5 B;  3CD6 F;  1E7K A;  1OAP A;  4YJ3 A;  2ZF8 A;  3WPW A;  2LBW A;  2IG8 A;  5IJ9 B;  1PXW A;  3K0T A;  3HKD A;  5KMG A;  3J7A R;  3HAX D;  1TVK B;  3JAR A;  3S0H A;  3SIU A;  1SA0 B;  5LA6 B;  2FGY A;  1U43 A;  3OBW A;  3CCJ F;  4G4W A;  4O4H B;  2HVY D;  3RA5 A;  4F6R B;  2UYJ A;  1Q81 H;  2G9I A;  1FSZ A;  3S06 A;  2OHW A;  3CXC F;  4ERH A;  2L26 A;  1GO0 A;  1VQP F;  2WAL A;  2KGW A;  2GVI A;  2KTV A;  3NK6 A;  3ZP7 A;  3EOR A;  2ZOD A;  2LBT A;  5IT9 M;  1ODE A;  3T80 A;  2OZB A;  3AGK A;  3HJW C;  1DT9 A;  4ZI7 B;  5HP8 A;  1RLU A;  1YGY A;  2UYK A;  4IIJ B;  1RA4 A;  2ZOV A;  3RYH B;  3VI6 A;  5ITZ A;  5GIN C;  2HP3 A;  4LCK A;  3CC2 F;  1JFF B;  2JNB A;  5JCO C;  3CPW F;  3JAM M;  3F0G A;  2UZH A;  4O4J A;  4HNA A;  4BVT A;  5C8Y B;  4I50 B;  1SDS A;  1VQN F;  4ZHV A;  5AVM A;  3LWV C;  3HKE B;  4TZZ A;  3N2G B;  1X52 A;  4O4I A;  3CYQ A;  3OW2 F;  4BVQ A;  4XCQ A;  3I7T A;  5EZY A;  4C82 A;  1QVG F;  2VAP A;  4EI7 A;  1T0K B;  1X7O A;  3I3F A;  4X1I A;  1H7M A;  1PF5 A;  2MQE A;  3NVI B;  2HS0 A;  2KTU A;  5CB4 A;  5JQG A;  3JAW B;  4I4T A;  3LWP C;  1UFY A;  4DXD A;  3JAS A;  4FFB B;  1DBF A;  2VAM A;  1YHQ F;  1QAH A;  4BT2 A;  2GLZ A;  1COM A;  4X20 A;  2CHS A;  5IYZ B;  1VK3 A;  2BTQ B;  2FC3 A;  1M1K H;  4B46 A;  4DRX B;  2BO1 A;  3MDO A;  2V9Y A;  2Z1F A;  1VQ8 F;  2CWJ A;  1T0A A;  4G4Y A;  4C4W C;  5G4V C;  1YJW F;  3E22 A;  3HTN A;  3WGM A;  1VQ5 F;  3K2X A;  1K8A H;  1VQL F;  1W5F A;  2RHL A;  5IJ0 B;  4ZHW A;  1FFX A;  3P4E A;  3IR9 A;  3CG6 A;  5GIP C;  3F0D A;  2YYE A;  2IQQ A;  5JVD B;  4BW0 B;  2VGM A;  2F9Z C;  4X1Y B;  3F0E A;  3D00 A;  2QA4 F;  4YJ3 B;  4I55 A;  2BTO A;  2Q1X A;  5EWR A;  5KMG B;  3HKD B;  2HX0 A;  4BVS A;  3JAR B;  3OON A;  1YJN F;  1XRG A;  4U3J A;  3GTZ A;  4PWT A;  5LP6 C;  1JY8 A;  2QTP A;  5GIO C;  3JCM M;  3F0F A;  3CCS F;  3RYF A;  1GZ0 A;  4IHJ A;  2UYP A;  3IKE A;  5BMV A;  4TV9 A;  1CLI A;  4G4Z A;  2ZVY A;  3IMP A;  3JAL A;  5A2Q M;  3N4Z A;  4EI8 A;  3R0P A;  3RYC A;  2EWC A;  3IEW A;  3WJR A;  3RYI A;  3I56 F;  1QD9 A;  5J2U A;  3I55 F;  3HKC A;  3LME A;  3V4D A;  1KD1 H;  1W40 A;  2RB9 A;  3NMU C;  5LXT A;  3DC2 A;  4NWO B;  3C9S A;  1NMU B;  3PLA C;  2DT4 A;  3O85 A;  4C81 A;  2QI2 A;  3V3T A;  1VQO F;  2OTL F;  3L7Q A;  5JCO A;  3NVK E;  4O4J B;  3E20 B;  3FFM A;  3VTI C;  2H8E A;  5LYJ A;  1RQ7 A;  5HY0 A;  3LWQ C;  1Z5V A;  3DDN A;  3JAK B;  4TUY B;  4O4I B;  3KJJ A;  1JJ2 F;  1U3L A;  2GZL A;  5HY1 A;  1U40 A;  4X1K A;  1W58 1;  4X1I B;  3F6M A;  5CB4 B;  4ZOL A;  1U3P A;  5CA0 A;  5JQG B;  3WJP A;  3ELC A;  5FNV A;  1CK2 A;  1XHO A;  3K14 A;  4ZHY B;  4I4T B;  4EB6 A;  3M4S A;  1NQ3 A;  3QTY A;  3P10 A;  4X20 B;  1W2B F;  4G88 A;  5GAP K;  4YJ2 B;  3VO8 A;  1IV3 A;  1N8R H;  2PMP A;  1TUB B;  2ZAU A;  3HKB A;  3LFO A;  4BT3 A;  2P6Y A;  2Q1Y A;  1NJI H;  2PHN A;  5B8F A;  5EO3 A;  3CCM F;  3G4S F;  4TV8 A;  3WGN A;  2VAW A;  2LBX A;  3VMF B;  3N2K B;  1XV2 A;  5MN6 A;  1OFU A;  3E22 B;  3CYP B;  3V7E A;  3Q8H A;  1H47 A;  4WBN A;  3JAT B;  3WGJ A;  1FFX B;  4EI9 A;  5JH7 B;  2Z1E A;  5MN5 A;  3LWR C;  2HP0 A;  5EIB C;  3JVH A;  4O2A A;  3P0Z A;  3V7Q A;  1YIT F;  1Q82 H;  3VYT C;  1IV2 A;  2VGN A;  5HWE A;  4I55 B;  2HS3 A;  3OBY A;  5HP7 A;  3MBM A;  1JFF A;  3KIZ A;  5EIB D;  1Q86 H;  5GON A;  2CVL A;  3BYQ A;  1W5E A;  2OTM A;  4U3J B;  3FD6 A;  5LP6 A;  1ZWZ A;  3WGL A;  1W42 A;  3U0O A;  5CA1 B;  1VQ7 F;  3RYF B;  1QU9 A;  4IHJ B;  3D01 A;  1YJ9 F;  5EB0 A;  1CN7 A;  2ZVZ A;  4ZHQ A;  4RQO A;  5BMV B;  2HS4 A;  4TV9 B;  5EYP A;  2H8C A;  2RHJ A;  3B6N A;  3KHN A;  3JAL B;  1XBI A;  1W55 A;  1FNK A;  4O2B A;  3RYC B;  1VQV A;  2R6R 1;  4LNU A;  2AIZ P;  4O4L A;  1IV1 A;  2CZW A;  5FLX M;  5DCV A;  3MCQ A;  5J2U B;  3SIV A;  3KE1 A;  4BT7 A;  3LWO C;  3CPQ A;  3ON1 A;  2R75 1;  3WXM B;  5IYZ A;  5EB1 B;  3CMA F;  3C9U A;  3KJK A;  3CB2 A;  5LXT B; 
#chains in the Genus database with same CATH homology
 2JNB A;  3CPW F;  3NK7 A;  3O85 A;  3JAM M;  2QI2 A;  3V3T A;  1VQO F;  4BVT A;  3CCU F;  1VQN F;  3G6E F;  2OTL F;  3CC7 F;  3NVK E;  3LWV C;  3CCQ F;  3E20 B;  3FFM A;  4TZZ A;  1X52 A;  2KG4 A;  3OW2 F;  4BVQ A;  5HY0 A;  4XCQ A;  3LWQ C;  1QVG F;  1W41 A;  5HY2 A;  4EI7 A;  1T0K B;  4NQ3 A;  1X7O A;  2OTJ F;  1H7M A;  1W3E X;  1YI2 F;  3NVI B;  1JJ2 F;  2KTU A;  5HY1 A;  1VQ6 F;  2AIF A;  1RLG A;  1IPA A;  2QEX F;  3GYQ A;  1K73 H;  3LWP C;  4NUT A;  1YIJ F;  5HXZ A;  3CCV F;  1CK2 A;  3J80 M;  5G4U C;  1YHQ F;  2GLZ A;  2FC3 A;  1M1K H;  1W2B F;  5GAP K;  2BO1 A;  3MCA B;  1N8R H;  3CC4 F;  1M90 H;  1VQ8 F;  3E1Y A;  3LFO A;  1NJI H;  4BVR A;  4X3M A;  4C4W C;  4BY9 D;  5EO3 A;  3CCM F;  5G4V C;  1YJW F;  3G4S F;  3N4Y A;  3CCE F;  1VQ5 F;  5FJ4 C;  1K8A H;  1VQL F;  3VMF B;  2LBX A;  4X3L A;  3G71 F;  3V7E A;  3IR9 A;  3CG6 A;  5GIP C;  3PAF A;  4LCK A;  4EI9 A;  3CD6 F;  1E7K A;  1K9M H;  4BW0 B;  2VGM A;  2F9Z C;  3D00 A;  2LBW A;  3LWR C;  5GAN K;  3CCL F;  2QA4 F;  1PXW A;  1GO1 A;  3V7Q A;  1YIT F;  1Q82 H;  3HAX D;  3J7A R;  3SIU A;  2VGN A;  5EWR A;  5HWE A;  2FGY A;  1X7P A;  4BVS A;  3OBW A;  3CCJ F;  1KQS F;  1YJN F;  1VQK F;  3OBY A;  1Q86 H;  5GIO C;  2HVY D;  3RA5 A;  3JCM M;  1Q81 H;  3CCS F;  5HY4 A;  1VQ4 F;  1QVF F;  1GZ0 A;  2OHW A;  3CXC F;  1ZWZ A;  5HXU A;  1KC8 H;  1W42 A;  1VQ7 F;  1GO0 A;  1VQP F;  2I6D A;  2WAL A;  1YJ9 F;  1CN7 A;  1S72 F;  2KTV A;  3NK6 A;  1Q7Y H;  5A2Q M;  3N4Z A;  3CME F;  4EI8 A;  5IT9 M;  3I56 F;  1VQ9 F;  2OZB A;  3AGK A;  3HJW C;  1XBI A;  1DT9 A;  3CCR F;  3RA6 A;  3I55 F;  1VQM F;  1KD1 H;  1RA4 A;  2ALE A;  1W40 A;  2CZW A;  5FLX M;  5DCV A;  3NMU C;  3SIV A;  3LWO C;  3VI6 A;  3CPQ A;  5GIN C;  3ON1 A;  3WXM B;  3CMA F;  1SDS A;  3J81 M;  1NMU B;  3PLA C;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...