3V7QA

Crystal structure of b. subtilis ylxq at 1.55 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
GMEWFPLLGLANRARKVVSGEDLVIKEIRNARAKLVLLTEDASSNTAKKVTDKCNYYKVPYKKVESRAVLGRSIGKEARVVVAVTDQGFANKLISLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Probable ribosomal protein ylxQ
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7qA00
1ZWZA 3LWRC 5A2QM 3CPWF 2QEXF 3O85A 5EO3A 5GAPK 3CCQF 1Q81H 3I55F 3CCRF 1Q86H 1VQMF 3NK6A 1NJIH 3N4ZA 3N4YA 2BO1A 1H7MA 1K73H 3CMEF 1M90H 1VQNF 5EWRA 4LCKA 2OHWA 4NUTA 1Q7YH 1VQ5F 5FLXM 3AGKA 1QVFF 3G6EF 2JNBA 1YHQF 1W42A 1E7KA 3WXMB 1YJNF 3RA6A 3LWOC 4C4WC 1T0KB 2I6DA 2OZBA 1XBIA 3CMAF 3CD6F 1N8RH 2CZWA 4BW0B 3LWQC 2KG4A 3CCUF 3HAXD 1DT9A 3ON1A 3CC2F 1YJ9F 1X7PA 1SDSA 1GZ0A 2VGNA 2KTUA 2QI2A 2VGMA 1CN7A 1W40A 5GIPC 1GO1A 1W3EX 3VMFB 2LBXA 5GANK 3G4SF 2AIFA 3I56F 1VQ6F 1CK2A 1GO0A 3SIUA 1VQLF 1M1KH 3NVKE 3RA5A 1RLGA 1K9MH 3V7QA 1VQ9F 1VQPF 3CCLF 3NK7A 1YJWF 1VQ7F 3CPQA 5GIOC 1PXWA 3CCMF 5GINC 3CXCF 3CG6A 5G4UC 3J80M 1YITF 2WALA 3CCJF 3OW2F 1W41A 3IR9A 1X7OA 2ALEA 1S72F 1QVGF 3SIVA 3CC4F 1KC8H 2KTVA 2QA4F 5FJ4C 3OBWA 4BY9D 2OTLF 2LBWA 1YIJF 1NMUB 3E20B 4X3LA 3LWVC 1VQKF 3CCSF 2HVYD 1JJ2F 3HJWC 2OTJF 3J81M 1IPAA 3JAMM 3JCMM 1YI2F 3CCEF 3MCAB 5G4VC 4X3MA 1K8AH 5DCVA 1W2BF 3VI6A 3J7AR 5IT9M 1VQ8F 3E1YA 4TZZA 3OBYA 3LFOA 1Q82H 3PAFA 1VQOF 3CCVF 1VQ4F 3FFMA 3NMUC 3V7EA 3PLAC 1X52A 1KQSF 1RA4A 3NVIB 3CC7F 2FC3A 3LWPC 3G71F 3GYQA 1KD1H
chains in the Genus database with same CATH superfamily
2CW4A 5A2QM 3QUWA 2W8BC 5LA6B 4TV9A 3T80A 2QEXF 4X1KB 3WGMA 5GAPK 2RHOA 3JAWB 4BT5A 4TV8A 1J7HA 3S06A 1W59A 2RHHA 4EI9A 3JATA 3N4ZA 3N4YA 1H7MA 3ERNA 1M90H 3S02A 5EYPA 5JVDA 4ZOLA 4X20B 1VQNF 2ZVYA 4LCKA 1QVFF 3UT5B 1KNJA 3KIZA 3M84A 4U3JA 3ZO8A 3U0OA 1ONIA 3RYHA 1YHQF 2UYPA 3WXMB 3DC2A 1JY8A 3JAKB 4C4WC 3M1XA 5HY4A 1T0KB 1IV4A 3JASA 3HKCB 1W5BA 3M4SA 4BT2A 4WBNB 3CD6F 2CZWA 3LWQC 5EYPB 5JVDB 1DT9A 3F0GA 2Z1TA 2H8CA 2BTUA 4HNAA 1SDSA 2IG8A 2QI2A 3DDNA 5EB1B 4F6RB 1CN7A 4O4LB 5LP6A 5GIPC 5JCOC 1FFXB 3D00A 3ZP7A 1VQ6F 4G4YA 3R0PA 3Q8HA 3E22A 2HS3A 1FNJA 3RA5A 1RLGA 1UFYA 5JH7B 2YYEA 2HS0A 5MN6A 5IYZB 2OTMA 2VAPA 5HY0A 1PXWA 3CXCF 1QU9A 3CG6A 1TVKA 3QTYA 5G4UC 3TD3A 5CA0A 3K14A 3IR9A 2ALEA 1S72F 4YJ2A 1QVGF 3SIVA 2KTVA 3N2KB 4O2AA 1ODEA 3OBWA 2LBWA 1NMUB 3I7TA 4G4WA 2V9YA 5B8FA 5LYJA 1VQKF 5LOVB 5LXTA 2GZLA 4BVRA 2HRUA 2OTJF 1XHOA 1DBFA 3QHDA 2UYJA 2G9IA 3CCEF 1U3LA 5EZYB 3JARB 3WGJA 1YGYA 4X1IB 4X3MA 1W5FA 3J7AR 1VQ8F 4I4TA 3E1YA 1W5AA 5HP7A 2MQEA 1U3PA 3RYFB 2Q1YA 1XV2A 5LXTB 5MN5A 1VQOF 3CCVF 3RYCA 5CB4A 3F0EA 2HRYA 1U43A 4I50A 4YJ3B 4EI8A 3RE3A 2IAFA 5KX5B 2FC3A 4O4JB 3G71F 3IKEA 3LWRC 1VQVA 4LNUB 3HKBA 3L7QA 5GONB 4EB6A 3O85A 5EO3A 5CB4B 3IEWA 4FFBA 3CCQF 4ERHA 5BMVA 3V3TA 3I55F 4PWTA 4I50B 5HY2A 1VQMF 3K2XA 3NK6A 1NJIH 4IHJB 1RQ7A 2CSLA 5LA6A 3VIUA 3WGLA 1K73H 4RQOA 2VXYA 4BVTA 2OHWA 3MDOA 3HKBB 1Q7YH 5FLXM 3G6EF 1RQ2A 3LYBA 3N2GB 2JNBA 5BMVB 1E7KA 5J2UB 4X20A 3VTIC 1NQ3A 1XBIA 1CLIA 1W5EA 2BTOA 4BW0B 3UT5A 5KMGB 5MN4A 2KGWA 2KG4A 3EORA 5HY1A 3FD5A 4BT7A 3JAKA 2VGNA 2H6LA 3C9UA 3MCQA 2ZAUA 3FPIA 1W57A 3WPXA 1W40A 3HKCA 4WBNA 4E6EA 5GANK 2AIFA 5J2TB 3SIUA 3FD6A 3C8LA 3MBMA 4G88A 3IMPA 3V7QA 2HQSC 4F6RA 4O4LA 1FFXA 3CPQA 4BT4A 3CCMF 1SA0B 4O4HB 5AVMA 2R6R1 3CYQA 3J80M 3JVHA 1YITF 2WALA 5JH7A 1W41A 3P4EA 1TUBA 5IYZA 3LMEA 4BT3A 2QA4F 2DYYA 2I6RA 2F9ZC 3MQWA 3CCSF 2HVYD 2UYNB 4R40B 3S0WA 3KJKA 5HWEA 1JJ2F 3HJWC 3J81M 3BYQA 1PF5A 2VAMA 3LDTA 3JCMM 5CA1B 3JAMM 3K0TA 2Q1XA 3N2KA 5JCOA 3ZOPA 5G4VC 1TUBB 1W2BF 3VI6A 3S03A 4BT6A 3KJJA 5LOVA 3TD4A 4TZZA 3K12A 2CHSA 2HX0A 2PHNA 2RHLA 3OONA 1Q82H 5EZYA 3JARA 3PAFA 4X1IA 4I55B 2AIZP 4NWOB 1JN1A 4G4XA 3B6NA 1VHAA 1H47A 3PLAC 2R751 3RYFA 3WJRA 3CC7F 3GTZA 1H48A 4C81A 1VK3A 3GYQA 1ZWZA 1IV3A 2ZVZA 3F0FA 3CPWF 2HP0B 4C8GA 4YJ3A 3C9TA 5KX5A 2GLZA 1OFUA 4B46A 4O4JA 1JFFB 2LBTA 3CCRF 1Q86H 1W55A 2UZHA 3P10A 4O4IA 1Q8RA 2HP3A 4LNUA 4C8IA 2Z1FA 2EWCA 4EI7A 5GONA 3CMEF 2K1SA 2UYKA 3HTNA 1IV2A 3AGKA 4C82A 2HS4A 5EIBD 4IHJA 3RYIA 3ZP4A 2QTPA 3RA6A 4O4IB 3C9RA 2I6DA 3WJQA 4X1YB 4M8IA 2OZBA 1JD1A 5EB0A 1N8RH 5EIBC 3N2GA 5IJ9A 5J2UA 3CC2F 1IV1A 1T0AA 1X7PA 5HXZA 3ESJA 2Z1UA 3RYIB 3F0DA 3TD5A 5KMGA 1GO1A 1W3EX 2DT4A 3G4SF 3I56F 4ZHQA 3P0ZA 2CWJA 3NVKE 1Z5VA 3D01A 1X25A 5C8YB 5IJ9B 4B62A 3VYUC 3VO8A 1VQPF 1VQ9F 2NMUA 1VQ7F 5IJ0B 5EAZA 4U39A 1RLUA 5J2TA 4DRXB 5GINC 3VOAA 1XRGA 4NQ3A 1U40A 3HWUA 3WGKA 4ZHQB 3CCJF 3GHZA 5FNVB 1KC8H 1SA0A 4O4HA 3V4DA 4BY9D 2OTLF 1SZQA 2AMTA 1FNKA 3E20B 3HKDB 1Z5WA 4X3LA 3LWVC 2GVIA 4IIJB 2BTQB 3CB2A 5HP8A 3MCAB 1K8AH 5DCVA 5HXUA 4DXDA 1YQNA 2ZODA 4ZHVA 4ZI7A 2UYNA 1QAHA 3IEQA 3IKFA 3D54A 4TUYB 2Z01A 3WGNA 3WPWA 5CA1A 2P6YA 3VCZA 3ELCA 2H8EA 1R1MA 1VQ4F 3FFMA 2ZF8A 3NMUC 3V7EA 3KE1A 2CVLA 4TV9B 5JQGA 1X52A 4TV8B 4B45A 3LWPC 4ZI7B 4I55A 3FBAA 2B33A 3JATB 4O2BA 5LP6C 4ZOLB 2RHJA 1Q81H 3KHNA 3CYPB 5JQGB 4U3JB 4ZHYB 2BO1A 2HP0A 3RYHB 1QD9A 1GX1A 3VYSC 3WJPA 5EWRA 4NUTA 3JASB 1JFFA 1VQ5F 2Z1EA 1VH8A 4O2BB 5ITZA 1W42A 1COMA 1W581 4G4ZA 1YJNF 4HNAB 3LWOC 4B5CA 4ZHWA 5LP6B 3CMAF 4BVQA 3CCUF 3HAXD 4ZK7A 3ON1A 3E22B 3S0HA 2ZOVA 3C9SA 1YJ9F 5ITZB 1GZ0A 2KTUA 2VGMA 4X1YA 4RHAA 3VMFB 2L26A 2LBXA 3VOBA 2RB9A 3HKEA 1CK2A 2YXZA 1GO0A 1TVKB 1VQLF 1M1KH 4BVSA 1K9MH 5CA0B 3CCLF 3NK7A 1YJWF 4YJ2B 5GIOC 4C8EA 2FGYA 4O2AB 5LYJB 5C8YA 1KNKA 1OAPA 3HKEB 3OW2F 2LCAA 2VAWA 1X7OA 5IJ0A 3CC4F 3JALA 4DRXA 5FJ4C 4KWEA 1YIJF 3I3FA 1UI9A 4I4TB 3F6MA 2PMPA 1IPAA 1YI2F 5FNVA 3RYCB 2CHTA 3HKDA 3VYTC 5IT9M 4XCQA 4G4VA 3JALB 3OBYA 4IIJA 3LFOA 2N48A 3S0YA 4X1KA 3JAWA 2IQQA 4EB6B 4TUYA 1KQSF 4FFBB 1RA4A 3NVIB 1FSZA 1KD1H
chains in the Genus database with same CATH topology
1ZWZA 3LWRC 5A2QM 3CPWF 2QEXF 3O85A 5EO3A 5GAPK 3CCQF 2GLZA 1Q81H 3V3TA 3I55F 3CCRF 5HY2A 1Q86H 1VQMF 3NK6A 4EI9A 1NJIH 3N4ZA 3N4YA 2BO1A 4EI7A 1H7MA 1K73H 3CMEF 1M90H 1VQNF 4BVTA 5EWRA 4LCKA 2OHWA 4NUTA 1Q7YH 1VQ5F 5FLXM 3AGKA 1QVFF 3G6EF 2JNBA 1YHQF 1W42A 1E7KA 3WXMB 1YJNF 3RA6A 3LWOC 4C4WC 5HY4A 2I6DA 1T0KB 2OZBA 1XBIA 3CMAF 3CD6F 1N8RH 2CZWA 4BW0B 3LWQC 4BVQA 2KG4A 3CCUF 3HAXD 1DT9A 5HY1A 3ON1A 3CC2F 1YJ9F 1X7PA 1SDSA 5HXZA 1GZ0A 2VGNA 2KTUA 2QI2A 2VGMA 1CN7A 1W40A 5GIPC 1GO1A 1W3EX 3D00A 3VMFB 2LBXA 5GANK 3G4SF 2AIFA 3I56F 1VQ6F 1CK2A 1GO0A 3SIUA 1VQLF 1M1KH 4BVSA 3NVKE 3RA5A 1RLGA 1K9MH 3V7QA 1VQ9F 1VQPF 3CCLF 3NK7A 1YJWF 1VQ7F 3CPQA 5HY0A 5GIOC 1PXWA 3CCMF 2FGYA 5GINC 3CXCF 3CG6A 5G4UC 3J80M 4NQ3A 1YITF 2WALA 3CCJF 3OW2F 1W41A 3IR9A 1X7OA 2ALEA 1S72F 1QVGF 3SIVA 3CC4F 1KC8H 2KTVA 2QA4F 5FJ4C 2F9ZC 3OBWA 4BY9D 2OTLF 2LBWA 1YIJF 1NMUB 3E20B 4X3LA 3LWVC 1VQKF 3CCSF 4BVRA 2HVYD 5HWEA 1JJ2F 3HJWC 2OTJF 3J81M 1IPAA 3JAMM 3JCMM 1YI2F 3CCEF 3MCAB 5G4VC 4X3MA 1K8AH 5DCVA 1W2BF 5HXUA 3VI6A 3J7AR 5IT9M 4XCQA 1VQ8F 3E1YA 4TZZA 3OBYA 3LFOA 1Q82H 3PAFA 1VQOF 3CCVF 1VQ4F 3FFMA 3NMUC 3V7EA 3PLAC 1X52A 1KQSF 4EI8A 1RA4A 3NVIB 3CC7F 2FC3A 3LWPC 3G71F 3GYQA 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZWZ A;  3LWR C;  5A2Q M;  3CPW F;  2QEX F;  3O85 A;  5EO3 A;  5GAP K;  3CCQ F;  1Q81 H;  3I55 F;  3CCR F;  1Q86 H;  1VQM F;  3NK6 A;  1NJI H;  3N4Z A;  3N4Y A;  2BO1 A;  1H7M A;  1K73 H;  3CME F;  1M90 H;  1VQN F;  5EWR A;  4LCK A;  2OHW A;  4NUT A;  1Q7Y H;  1VQ5 F;  5FLX M;  3AGK A;  1QVF F;  3G6E F;  2JNB A;  1YHQ F;  1W42 A;  1E7K A;  3WXM B;  1YJN F;  3RA6 A;  3LWO C;  4C4W C;  1T0K B;  2I6D A;  2OZB A;  1XBI A;  3CMA F;  3CD6 F;  1N8R H;  2CZW A;  4BW0 B;  3LWQ C;  2KG4 A;  3CCU F;  3HAX D;  1DT9 A;  3ON1 A;  3CC2 F;  1YJ9 F;  1X7P A;  1SDS A;  1GZ0 A;  2VGN A;  2KTU A;  2QI2 A;  2VGM A;  1CN7 A;  1W40 A;  5GIP C;  1GO1 A;  1W3E X;  3VMF B;  2LBX A;  5GAN K;  3G4S F;  2AIF A;  3I56 F;  1VQ6 F;  1CK2 A;  1GO0 A;  3SIU A;  1VQL F;  1M1K H;  3NVK E;  3RA5 A;  1RLG A;  1K9M H;  3V7Q A;  1VQ9 F;  1VQP F;  3CCL F;  3NK7 A;  1YJW F;  1VQ7 F;  3CPQ A;  5GIO C;  1PXW A;  3CCM F;  5GIN C;  3CXC F;  3CG6 A;  5G4U C;  3J80 M;  1YIT F;  2WAL A;  3CCJ F;  3OW2 F;  1W41 A;  3IR9 A;  1X7O A;  2ALE A;  1S72 F;  1QVG F;  3SIV A;  3CC4 F;  1KC8 H;  2KTV A;  2QA4 F;  5FJ4 C;  3OBW A;  4BY9 D;  2OTL F;  2LBW A;  1YIJ F;  1NMU B;  3E20 B;  4X3L A;  3LWV C;  1VQK F;  3CCS F;  2HVY D;  1JJ2 F;  3HJW C;  2OTJ F;  3J81 M;  1IPA A;  3JAM M;  3JCM M;  1YI2 F;  3CCE F;  3MCA B;  5G4V C;  4X3M A;  1K8A H;  5DCV A;  1W2B F;  3VI6 A;  3J7A R;  5IT9 M;  1VQ8 F;  3E1Y A;  4TZZ A;  3OBY A;  3LFO A;  1Q82 H;  3PAF A;  1VQO F;  3CCV F;  1VQ4 F;  3FFM A;  3NMU C;  3V7E A;  3PLA C;  1X52 A;  1KQS F;  1RA4 A;  3NVI B;  3CC7 F;  2FC3 A;  3LWP C;  3G71 F;  3GYQ A;  1KD1 H; 
#chains in the Genus database with same CATH topology
 2CW4 A;  5A2Q M;  3QUW A;  2W8B C;  5LA6 B;  4TV9 A;  3T80 A;  2QEX F;  4X1K B;  3WGM A;  5GAP K;  2RHO A;  3JAW B;  4BT5 A;  4TV8 A;  1J7H A;  3S06 A;  1W59 A;  2RHH A;  4EI9 A;  3JAT A;  3N4Z A;  3N4Y A;  1H7M A;  3ERN A;  1M90 H;  3S02 A;  5EYP A;  5JVD A;  4ZOL A;  4X20 B;  1VQN F;  2ZVY A;  4LCK A;  1QVF F;  3UT5 B;  1KNJ A;  3KIZ A;  3M84 A;  4U3J A;  3ZO8 A;  3U0O A;  1ONI A;  3RYH A;  1YHQ F;  2UYP A;  3WXM B;  3DC2 A;  1JY8 A;  3JAK B;  4C4W C;  3M1X A;  5HY4 A;  1T0K B;  1IV4 A;  3JAS A;  3HKC B;  1W5B A;  3M4S A;  4BT2 A;  4WBN B;  3CD6 F;  2CZW A;  3LWQ C;  5EYP B;  5JVD B;  1DT9 A;  3F0G A;  2Z1T A;  2H8C A;  2BTU A;  4HNA A;  1SDS A;  2IG8 A;  2QI2 A;  3DDN A;  5EB1 B;  4F6R B;  1CN7 A;  4O4L B;  5LP6 A;  5GIP C;  5JCO C;  1FFX B;  3D00 A;  3ZP7 A;  1VQ6 F;  4G4Y A;  3R0P A;  3Q8H A;  3E22 A;  2HS3 A;  1FNJ A;  3RA5 A;  1RLG A;  1UFY A;  5JH7 B;  2YYE A;  2HS0 A;  5MN6 A;  5IYZ B;  2OTM A;  2VAP A;  5HY0 A;  1PXW A;  3CXC F;  1QU9 A;  3CG6 A;  1TVK A;  3QTY A;  5G4U C;  3TD3 A;  5CA0 A;  3K14 A;  3IR9 A;  2ALE A;  1S72 F;  4YJ2 A;  1QVG F;  3SIV A;  2KTV A;  3N2K B;  4O2A A;  1ODE A;  3OBW A;  2LBW A;  1NMU B;  3I7T A;  4G4W A;  2V9Y A;  5B8F A;  5LYJ A;  1VQK F;  5LOV B;  5LXT A;  2GZL A;  4BVR A;  2HRU A;  2OTJ F;  1XHO A;  1DBF A;  3QHD A;  2UYJ A;  2G9I A;  3CCE F;  1U3L A;  5EZY B;  3JAR B;  3WGJ A;  1YGY A;  4X1I B;  4X3M A;  1W5F A;  3J7A R;  1VQ8 F;  4I4T A;  3E1Y A;  1W5A A;  5HP7 A;  2MQE A;  1U3P A;  3RYF B;  2Q1Y A;  1XV2 A;  5LXT B;  5MN5 A;  1VQO F;  3CCV F;  3RYC A;  5CB4 A;  3F0E A;  2HRY A;  1U43 A;  4I50 A;  4YJ3 B;  4EI8 A;  3RE3 A;  2IAF A;  5KX5 B;  2FC3 A;  4O4J B;  3G71 F;  3IKE A;  3LWR C;  1VQV A;  4LNU B;  3HKB A;  3L7Q A;  5GON B;  4EB6 A;  3O85 A;  5EO3 A;  5CB4 B;  3IEW A;  4FFB A;  3CCQ F;  4ERH A;  5BMV A;  3V3T A;  3I55 F;  4PWT A;  4I50 B;  5HY2 A;  1VQM F;  3K2X A;  3NK6 A;  1NJI H;  4IHJ B;  1RQ7 A;  2CSL A;  5LA6 A;  3VIU A;  3WGL A;  1K73 H;  4RQO A;  2VXY A;  4BVT A;  2OHW A;  3MDO A;  3HKB B;  1Q7Y H;  5FLX M;  3G6E F;  1RQ2 A;  3LYB A;  3N2G B;  2JNB A;  5BMV B;  1E7K A;  5J2U B;  4X20 A;  3VTI C;  1NQ3 A;  1XBI A;  1CLI A;  1W5E A;  2BTO A;  4BW0 B;  3UT5 A;  5KMG B;  5MN4 A;  2KGW A;  2KG4 A;  3EOR A;  5HY1 A;  3FD5 A;  4BT7 A;  3JAK A;  2VGN A;  2H6L A;  3C9U A;  3MCQ A;  2ZAU A;  3FPI A;  1W57 A;  3WPX A;  1W40 A;  3HKC A;  4WBN A;  4E6E A;  5GAN K;  2AIF A;  5J2T B;  3SIU A;  3FD6 A;  3C8L A;  3MBM A;  4G88 A;  3IMP A;  3V7Q A;  2HQS C;  4F6R A;  4O4L A;  1FFX A;  3CPQ A;  4BT4 A;  3CCM F;  1SA0 B;  4O4H B;  5AVM A;  2R6R 1;  3CYQ A;  3J80 M;  3JVH A;  1YIT F;  2WAL A;  5JH7 A;  1W41 A;  3P4E A;  1TUB A;  5IYZ A;  3LME A;  4BT3 A;  2QA4 F;  2DYY A;  2I6R A;  2F9Z C;  3MQW A;  3CCS F;  2HVY D;  2UYN B;  4R40 B;  3S0W A;  3KJK A;  5HWE A;  1JJ2 F;  3HJW C;  3J81 M;  3BYQ A;  1PF5 A;  2VAM A;  3LDT A;  3JCM M;  5CA1 B;  3JAM M;  3K0T A;  2Q1X A;  3N2K A;  5JCO A;  3ZOP A;  5G4V C;  1TUB B;  1W2B F;  3VI6 A;  3S03 A;  4BT6 A;  3KJJ A;  5LOV A;  3TD4 A;  4TZZ A;  3K12 A;  2CHS A;  2HX0 A;  2PHN A;  2RHL A;  3OON A;  1Q82 H;  5EZY A;  3JAR A;  3PAF A;  4X1I A;  4I55 B;  2AIZ P;  4NWO B;  1JN1 A;  4G4X A;  3B6N A;  1VHA A;  1H47 A;  3PLA C;  2R75 1;  3RYF A;  3WJR A;  3CC7 F;  3GTZ A;  1H48 A;  4C81 A;  1VK3 A;  3GYQ A;  1ZWZ A;  1IV3 A;  2ZVZ A;  3F0F A;  3CPW F;  2HP0 B;  4C8G A;  4YJ3 A;  3C9T A;  5KX5 A;  2GLZ A;  1OFU A;  4B46 A;  4O4J A;  1JFF B;  2LBT A;  3CCR F;  1Q86 H;  1W55 A;  2UZH A;  3P10 A;  4O4I A;  1Q8R A;  2HP3 A;  4LNU A;  4C8I A;  2Z1F A;  2EWC A;  4EI7 A;  5GON A;  3CME F;  2K1S A;  2UYK A;  3HTN A;  1IV2 A;  3AGK A;  4C82 A;  2HS4 A;  5EIB D;  4IHJ A;  3RYI A;  3ZP4 A;  2QTP A;  3RA6 A;  4O4I B;  3C9R A;  2I6D A;  3WJQ A;  4X1Y B;  4M8I A;  2OZB A;  1JD1 A;  5EB0 A;  1N8R H;  5EIB C;  3N2G A;  5IJ9 A;  5J2U A;  3CC2 F;  1IV1 A;  1T0A A;  1X7P A;  5HXZ A;  3ESJ A;  2Z1U A;  3RYI B;  3F0D A;  3TD5 A;  5KMG A;  1GO1 A;  1W3E X;  2DT4 A;  3G4S F;  3I56 F;  4ZHQ A;  3P0Z A;  2CWJ A;  3NVK E;  1Z5V A;  3D01 A;  1X25 A;  5C8Y B;  5IJ9 B;  4B62 A;  3VYU C;  3VO8 A;  1VQP F;  1VQ9 F;  2NMU A;  1VQ7 F;  5IJ0 B;  5EAZ A;  4U39 A;  1RLU A;  5J2T A;  4DRX B;  5GIN C;  3VOA A;  1XRG A;  4NQ3 A;  1U40 A;  3HWU A;  3WGK A;  4ZHQ B;  3CCJ F;  3GHZ A;  5FNV B;  1KC8 H;  1SA0 A;  4O4H A;  3V4D A;  4BY9 D;  2OTL F;  1SZQ A;  2AMT A;  1FNK A;  3E20 B;  3HKD B;  1Z5W A;  4X3L A;  3LWV C;  2GVI A;  4IIJ B;  2BTQ B;  3CB2 A;  5HP8 A;  3MCA B;  1K8A H;  5DCV A;  5HXU A;  4DXD A;  1YQN A;  2ZOD A;  4ZHV A;  4ZI7 A;  2UYN A;  1QAH A;  3IEQ A;  3IKF A;  3D54 A;  4TUY B;  2Z01 A;  3WGN A;  3WPW A;  5CA1 A;  2P6Y A;  3VCZ A;  3ELC A;  2H8E A;  1R1M A;  1VQ4 F;  3FFM A;  2ZF8 A;  3NMU C;  3V7E A;  3KE1 A;  2CVL A;  4TV9 B;  5JQG A;  1X52 A;  4TV8 B;  4B45 A;  3LWP C;  4ZI7 B;  4I55 A;  3FBA A;  2B33 A;  3JAT B;  4O2B A;  5LP6 C;  4ZOL B;  2RHJ A;  1Q81 H;  3KHN A;  3CYP B;  5JQG B;  4U3J B;  4ZHY B;  2BO1 A;  2HP0 A;  3RYH B;  1QD9 A;  1GX1 A;  3VYS C;  3WJP A;  5EWR A;  4NUT A;  3JAS B;  1JFF A;  1VQ5 F;  2Z1E A;  1VH8 A;  4O2B B;  5ITZ A;  1W42 A;  1COM A;  1W58 1;  4G4Z A;  1YJN F;  4HNA B;  3LWO C;  4B5C A;  4ZHW A;  5LP6 B;  3CMA F;  4BVQ A;  3CCU F;  3HAX D;  4ZK7 A;  3ON1 A;  3E22 B;  3S0H A;  2ZOV A;  3C9S A;  1YJ9 F;  5ITZ B;  1GZ0 A;  2KTU A;  2VGM A;  4X1Y A;  4RHA A;  3VMF B;  2L26 A;  2LBX A;  3VOB A;  2RB9 A;  3HKE A;  1CK2 A;  2YXZ A;  1GO0 A;  1TVK B;  1VQL F;  1M1K H;  4BVS A;  1K9M H;  5CA0 B;  3CCL F;  3NK7 A;  1YJW F;  4YJ2 B;  5GIO C;  4C8E A;  2FGY A;  4O2A B;  5LYJ B;  5C8Y A;  1KNK A;  1OAP A;  3HKE B;  3OW2 F;  2LCA A;  2VAW A;  1X7O A;  5IJ0 A;  3CC4 F;  3JAL A;  4DRX A;  5FJ4 C;  4KWE A;  1YIJ F;  3I3F A;  1UI9 A;  4I4T B;  3F6M A;  2PMP A;  1IPA A;  1YI2 F;  5FNV A;  3RYC B;  2CHT A;  3HKD A;  3VYT C;  5IT9 M;  4XCQ A;  4G4V A;  3JAL B;  3OBY A;  4IIJ A;  3LFO A;  2N48 A;  3S0Y A;  4X1K A;  3JAW A;  2IQQ A;  4EB6 B;  4TUY A;  1KQS F;  4FFB B;  1RA4 A;  3NVI B;  1FSZ A;  1KD1 H; 
#chains in the Genus database with same CATH homology
 1ZWZ A;  3LWR C;  5A2Q M;  3CPW F;  2QEX F;  3O85 A;  5EO3 A;  5GAP K;  3CCQ F;  2GLZ A;  1Q81 H;  3V3T A;  3I55 F;  3CCR F;  5HY2 A;  1Q86 H;  1VQM F;  3NK6 A;  4EI9 A;  1NJI H;  3N4Z A;  3N4Y A;  2BO1 A;  4EI7 A;  1H7M A;  1K73 H;  3CME F;  1M90 H;  1VQN F;  4BVT A;  5EWR A;  4LCK A;  2OHW A;  4NUT A;  1Q7Y H;  1VQ5 F;  5FLX M;  3AGK A;  1QVF F;  3G6E F;  2JNB A;  1YHQ F;  1W42 A;  1E7K A;  3WXM B;  1YJN F;  3RA6 A;  3LWO C;  4C4W C;  5HY4 A;  2I6D A;  1T0K B;  2OZB A;  1XBI A;  3CMA F;  3CD6 F;  1N8R H;  2CZW A;  4BW0 B;  3LWQ C;  4BVQ A;  2KG4 A;  3CCU F;  3HAX D;  1DT9 A;  5HY1 A;  3ON1 A;  3CC2 F;  1YJ9 F;  1X7P A;  1SDS A;  5HXZ A;  1GZ0 A;  2VGN A;  2KTU A;  2QI2 A;  2VGM A;  1CN7 A;  1W40 A;  5GIP C;  1GO1 A;  1W3E X;  3D00 A;  3VMF B;  2LBX A;  5GAN K;  3G4S F;  2AIF A;  3I56 F;  1VQ6 F;  1CK2 A;  1GO0 A;  3SIU A;  1VQL F;  1M1K H;  4BVS A;  3NVK E;  3RA5 A;  1RLG A;  1K9M H;  3V7Q A;  1VQ9 F;  1VQP F;  3CCL F;  3NK7 A;  1YJW F;  1VQ7 F;  3CPQ A;  5HY0 A;  5GIO C;  1PXW A;  3CCM F;  2FGY A;  5GIN C;  3CXC F;  3CG6 A;  5G4U C;  3J80 M;  4NQ3 A;  1YIT F;  2WAL A;  3CCJ F;  3OW2 F;  1W41 A;  3IR9 A;  1X7O A;  2ALE A;  1S72 F;  1QVG F;  3SIV A;  3CC4 F;  1KC8 H;  2KTV A;  2QA4 F;  5FJ4 C;  2F9Z C;  3OBW A;  4BY9 D;  2OTL F;  2LBW A;  1YIJ F;  1NMU B;  3E20 B;  4X3L A;  3LWV C;  1VQK F;  3CCS F;  4BVR A;  2HVY D;  5HWE A;  1JJ2 F;  3HJW C;  2OTJ F;  3J81 M;  1IPA A;  3JAM M;  3JCM M;  1YI2 F;  3CCE F;  3MCA B;  5G4V C;  4X3M A;  1K8A H;  5DCV A;  1W2B F;  5HXU A;  3VI6 A;  3J7A R;  5IT9 M;  4XCQ A;  1VQ8 F;  3E1Y A;  4TZZ A;  3OBY A;  3LFO A;  1Q82 H;  3PAF A;  1VQO F;  3CCV F;  1VQ4 F;  3FFM A;  3NMU C;  3V7E A;  3PLA C;  1X52 A;  1KQS F;  4EI8 A;  1RA4 A;  3NVI B;  3CC7 F;  2FC3 A;  3LWP C;  3G71 F;  3GYQ A;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...