3V7QA

Crystal structure of b. subtilis ylxq at 1.55 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
GMEWFPLLGLANRARKVVSGEDLVIKEIRNARAKLVLLTEDASSNTAKKVTDKCNYYKVPYKKVESRAVLGRSIGKEARVVVAVTDQGFANKLISLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribosomal protein ylxQ
publication title YbxF and YlxQ are bacterial homologs of L7Ae and bind K-turns but not K-loops.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3v7qA00
1VQ7F 3NVKE 3CD6F 3FFMA 3CPQA 3CCVF 2OZBA 3JCMM 2LBXA 4BW0B 3CCLF 4X3LA 1YITF 3NMUC 2I6DA 5G4VC 1VQ4F 1VQNF 3CMEF 1GO1A 3HAXD 3GYQA 2VGNA 2CZWA 5DCVA 3E1YA 1SDSA 1Q81H 5A2QM 1RA4A 3CCRF 2KTVA 3V7QA 1VQLF 5GINC 3CCQF 3CCJF 1PXWA 3N4YA 1W42A 3OBWA 3J80M 2VGMA 1VQ9F 3CCSF 3VI6A 1VQ5F 3LWRC 1KC8H 1S72F 1VQ6F 3G71F 2OTJF 3NK6A 3CCEF 1YJWF 2QA4F 3MCAB 5FLXM 1W3EX 2QEXF 4C4WC 3CXCF 1KQSF 3O85A 3G6EF 5EWRA 1M1KH 3LFOA 1Q82H 5FJ4C 3CC2F 1VQMF 1GO0A 1NJIH 1E7KA 1X52A 4X3MA 1X7OA 1YJ9F 5GANK 3VMFB 3J81M 3LWOC 1YJNF 5GAPK 2WALA 4TZZA 3E20B 2HVYD 1VQPF 1W40A 2JNBA 2OHWA 3CG6A 1YHQF 3PAFA 2ALEA 4LCKA 1K73H 1VQKF 5GIPC 3LWQC 3WXMB 2AIFA 1VQOF 3I55F 2OTLF 1VQ8F 3AGKA 1IPAA 1T0KB 1KD1H 1ZWZA 1QVGF 3OBYA 3CC7F 1W2BF 3RA5A 3NK7A 1CN7A 1N8RH 3HJWC 3LWPC 3JAMM 1H7MA 1CK2A 1NMUB 3CCUF 3SIVA 1X7PA 1RLGA 3I56F 5EO3A 2KTUA 2LBWA 1GZ0A 3CC4F 3G4SF 2FC3A 1K9MH 1XBIA 5IT9M 1QVFF 2KG4A 3ON1A 3J7AR 3SIUA 1W41A 3V7EA 3CCMF 3NVIB 3RA6A 3OW2F 3PLAC 3N4ZA 1DT9A 1JJ2F 2QI2A 3CPWF 1K8AH 3IR9A 2BO1A 1YIJF 1YI2F 5G4UC 1Q7YH 3CMAF 4BY9D 4NUTA 5GIOC 3LWVC 1Q86H 1M90H
chains in the Genus database with same CATH superfamily
4YJ3A 3MQWA 1VQ7F 3NVKE 1JY8A 3CCVF 3FPIA 3HKEB 3NMUC 2UZHA 3WGKA 1H47A 3IEQA 5LYJB 4B62A 5C8YA 3HKBB 4C8GA 5EZYA 3GYQA 2HS3A 1ODEA 2DT4A 1Z5VA 2RHOA 4TUYB 1Q81H 2UYPA 5A2QM 4FFBB 5JVDB 1H48A 2GZLA 2HRUA 3JAWB 5LA6A 3VYSC 4G4VA 2FGYA 5KMGB 3MDOA 5LXTA 3RYHA 3R0PA 3VYUC 3CCQF 4IIJA 4I55B 3N4YA 3C9RA 4ZK7A 3J80M 4O2AA 4F6RB 2PHNA 5CB4A 3CCSF 3VOAA 1VQ5F 3LWRC 2HP0A 1IV3A 1S72F 5IJ9A 2OTJF 5BMVB 1TVKA 1J7HA 5IYZB 4O2BB 2IAFA 4ZHQA 3O85A 3G6EF 5EWRA 3LFOA 4WBNA 3RYCA 1VQMF 1NJIH 1X52A 4X3MA 1W5FA 5GANK 3F0FA 3HKCB 2HX0A 2CSLA 1YJNF 1U3LA 4EI7A 2F9ZC 2Z1EA 5GONA 3B6NA 1QAHA 1VQPF 1W40A 4ZI7A 1K73H 5GIPC 3LWQC 3WXMB 4R40B 1JFFB 3VTIC 1FFXA 3FD5A 3K12A 4BT6A 3OBYA 3N2GA 1QVGF 3RA5A 3IMPA 5KX5B 1QD9A 3HJWC 1DBFA 4ERHA 3TD4A 1H7MA 3JATB 1CK2A 4LNUA 4O4JA 3CCUF 1X7PA 3WGNA 1RLGA 3I56F 4X1YB 2KTUA 4U39A 2I6RA 1FNKA 3LMEA 4C8EA 2FC3A 3UT5A 5J2TB 1K9MH 4I50A 4O4IA 5J2UA 2KG4A 2W8BC 3J7AR 4ZHVA 2CHSA 2CVLA 3JAKA 3OW2F 1SA0B 4RHAA 1DT9A 3HKDA 4O4HA 1QU9A 2BO1A 1YIJF 5CA0B 3CYPB 5G4UC 5LOVA 5EIBC 3E22A 3WPWA 1VQKF 3RYFA 5HP7A 1UI9A 3JASB 1IV4A 3CD6F 1TUBB 3JARB 5IJ0B 3I3FA 4BW0B 4X3LA 3CMEF 3D54A 4BVTA 3HKEA 1GO1A 3KHNA 1ONIA 2CZWA 2P6YA 5DCVA 1W55A 1SDSA 2VAMA 5LYJA 5HY1A 3HKBA 3ERNA 3QTYA 1RA4A 3CCRF 2KTVA 4G4WA 5CA1B 1XRGA 4TUYA 4G4ZA 4C82A 5JVDA 1W42A 3JAWA 4BT3A 5KMGA 5HXZA 5HP8A 4DRXB 5HY4A 2VGMA 4I55A 4X20B 3CB2A 4F6RA 3RE3A 2UYKA 4BVRA 3NK6A 3LDTA 3N2KA 2QA4F 3HTNA 3P4EA 1W3EX 2K1SA 3OONA 2QEXF 2G9IA 4I4TB 2V9YA 3KJKA 1M1KH 5IYZA 2IQQA 2Z1UA 4O2BA 3CC2F 2LBTA 1GO0A 5EB0A 2OTMA 4TV8B 1YJ9F 3VMFB 3J81M 3KJJA 2QTPA 5GAPK 3GHZA 3HKCA 3MBMA 2HVYD 2VXYA 3I7TA 2BTUA 3ZO8A 1VH8A 3C9TA 3CG6A 4HNAB 3S0WA 1VQOF 2HS0A 2OTLF 4C8IA 1IPAA 5EYPB 1KD1H 1T0KB 1JFFA 3NK7A 1NMUB 3SIVA 2ZVYA 3K0TA 1U3PA 4YJ2B 5KX5A 1RLUA 4PWTA 3CC4F 2BTOA 3JATA 3F0DA 4X1KB 3D00A 5LP6B 2RHJA 4X1YA 4NWOB 1QVFF 5IT9M 4BT2A 1YGYA 1XV2A 1W41A 1IV2A 5J2TA 1UFYA 2L26A 3F0GA 3N4ZA 2Z1FA 5EIBD 1JD1A 1VK3A 2B33A 2HS4A 2Q1YA 4ZOLB 5LA6B 1SA0A 5HY0A 1Z5WA 3V3TA 4BY9D 3WJRA 5JH7B 5GIOC 5CA0A 3U0OA 3IKEA 1Q86H 4RQOA 4B5CA 4O4LB 2RHHA 3JALB 2OZBA 4C81A 2LBXA 3CCLF 5MN6A 3GTZA 4X1IB 3JASA 4BT7A 2I6DA 5G4VC 1TUBA 3JARA 5IJ0A 1W581 1VQNF 1PF5A 4ZHYB 2HQSC 2UYNB 4TV9B 4EB6B 2Z1TA 3V7QA 5ITZB 1VQLF 3QUWA 4BT4A 2YXZA 2ZF8A 1JN1A 1PXWA 2CWJA 5CA1A 2DYYA 1KNJA 4IHJB 3RYIB 3P10A 1FNJA 4M8IA 3VO8A 3DC2A 4DRXA 1VQ6F 1SZQA 3L7QA 4BVSA 3N2GB 1YJWF 4X20A 5EB1B 4B46A 4O4JB 1KQSF 1COMA 5FNVB 1W5BA 3M1XA 5FJ4C 2Z01A 1E7KA 4U3JB 1X7OA 4I4TA 5J2UB 5HWEA 4FFBA 3V4DA 2UYJA 4TV8A 2WALA 4TZZA 3M4SA 1W5EA 1RQ7A 1YHQF 1OFUA 4LCKA 2ALEA 3VOBA 3I55F 3AGKA 3M84A 2H8CA 1NQ3A 4HNAA 3CC7F 5BMVA 2GLZA 1W2BF 1N8RH 5MN4A 3LWPC 2ZAUA 5EYPA 5JQGB 3JAMM 3ESJA 1CLIA 2EWCA 1GZ0A 5MN5A 3G4SF 3EORA 3VYTC 1XBIA 4YJ2A 4B45A 3WJQA 2CW4A 2MQEA 3ELCA 1W5AA 3S0HA 3MCQA 4X1KA 3SIUA 2GVIA 2H6LA 5LP6A 3CCMF 4EI9A 3NVIB 2H8EA 3VIUA 2QI2A 1K8AH 2VAWA 1R1MA 1XHOA 5HY2A 3BYQA 4DXDA 5HXUA 4LNUB 3C9UA 4ZOLA 4NQ3A 4YJ3B 4BT5A 3K14A 1X25A 3Q8HA 3FBAA 1Q8RA 1M90H 3TD3A 1RQ2A 3WGMA 5JH7A 3ZOPA 3FFMA 3CPQA 3N2KB 4O4LA 5LP6C 3JCMM 2Q1XA 3CYQA 5C8YB 1YITF 3JALA 4EI8A 2R6R1 1IV1A 5EZYB 2N48A 1VQ4F 4G4XA 4X1IA 3HAXD 2VGNA 3VCZA 2ZODA 3E1YA 3KIZA 4BVQA 2PMPA 5LXTB 3RYHB 4IIJB 3S02A 3ZP7A 1YQNA 3C8LA 4KWEA 2HRYA 5GINC 1KNKA 4O2AB 2R751 2UYNA 4TV9A 4EB6A 5CB4B 3CCJF 3IEWA 3OBWA 5ITZA 2HP0B 1VQVA 2LCAA 1VQ9F 5IJ9B 3VI6A 1TVKB 3TD5A 1KC8H 4IHJA 1W57A 3G71F 3RYIA 4ZHQB 3CCEF 3MCAB 2IG8A 5JCOA 2RHLA 4XCQA 5FLXM 4WBNB 3RYCB 4C4WC 3CXCF 3S03A 2YYEA 1Q82H 1U40A 2AIZP 3F0EA 2HP3A 4G88A 2BTQB 5FNVA 1T0AA 3LWOC 3DDNA 5GONB 2CHTA 4U3JA 1OAPA 3C9SA 4ZI7B 3E20B 1FFXB 2OHWA 2JNBA 5JCOC 3PAFA 2NMUA 2KGWA 1U43A 2AIFA 3K2XA 3WGLA 5EAZA 1VQ8F 3S0YA 1ZWZA 3WJPA 1GX1A 3LYBA 1CN7A 3D01A 3QHDA 1VHAA 2VAPA 3UT5B 5EO3A 2RB9A 4I50B 4O4IB 2LBWA 3P0ZA 5B8FA 3T80A 5JQGA 4ZHWA 1FSZA 3JAKB 3ZP4A 3IKFA 4E6EA 3ON1A 3KE1A 1W59A 3V7EA 3F6MA 2ZOVA 3HKDB 4O4HB 3RA6A 3PLAC 3WGJA 5LOVB 3CPWF 1JJ2F 3IR9A 3JVHA 3WPXA 1YI2F 3E22B 2ZVZA 2AMTA 1Q7YH 3CMAF 3S06A 3RYFB 3HWUA 4NUTA 5AVMA 3LWVC 4G4YA 3FD6A
chains in the Genus database with same CATH topology
1VQ7F 3NVKE 3CD6F 3FFMA 3CPQA 3CCVF 2OZBA 3JCMM 2LBXA 4BW0B 3CCLF 4X3LA 1YITF 3NMUC 4EI8A 2I6DA 5G4VC 1VQ4F 1VQNF 3CMEF 4BVTA 1GO1A 3HAXD 3GYQA 2VGNA 2CZWA 5DCVA 3E1YA 1SDSA 4BVQA 5HY1A 1Q81H 5A2QM 1RA4A 3CCRF 2KTVA 3V7QA 1VQLF 2FGYA 5GINC 3CCQF 3CCJF 1PXWA 3N4YA 1W42A 3OBWA 3J80M 5HXZA 5HY4A 2VGMA 1VQ9F 3CCSF 3VI6A 1VQ5F 3LWRC 1KC8H 1S72F 1VQ6F 3G71F 4BVRA 4BVSA 2OTJF 3NK6A 3CCEF 1YJWF 2QA4F 3MCAB 4XCQA 5FLXM 1W3EX 2QEXF 4C4WC 3CXCF 1KQSF 3O85A 3G6EF 5EWRA 1M1KH 3LFOA 1Q82H 5FJ4C 3CC2F 1VQMF 1GO0A 1NJIH 1E7KA 1X52A 4X3MA 1X7OA 1YJ9F 3VMFB 5GANK 3J81M 5HWEA 3LWOC 1YJNF 5GAPK 2WALA 4TZZA 4EI7A 2F9ZC 3E20B 2HVYD 1VQPF 1W40A 2JNBA 2OHWA 3CG6A 1YHQF 3PAFA 2ALEA 4LCKA 1K73H 1VQKF 5GIPC 3LWQC 3WXMB 2AIFA 1VQOF 3I55F 2OTLF 1VQ8F 3AGKA 1IPAA 1T0KB 1KD1H 1ZWZA 1QVGF 3OBYA 3CC7F 1W2BF 2GLZA 3NK7A 3RA5A 1CN7A 1N8RH 3HJWC 3LWPC 1H7MA 3JAMM 1CK2A 1NMUB 3CCUF 3SIVA 1X7PA 1RLGA 3I56F 5EO3A 2KTUA 2LBWA 1GZ0A 3CC4F 3G4SF 2FC3A 3D00A 1K9MH 1XBIA 5IT9M 1QVFF 2KG4A 3ON1A 3J7AR 3SIUA 1W41A 3V7EA 3CCMF 4EI9A 3NVIB 3RA6A 3OW2F 3PLAC 3N4ZA 1DT9A 1JJ2F 2QI2A 3CPWF 1K8AH 3IR9A 2BO1A 1YIJF 1YI2F 5HY2A 5HY0A 5HXUA 5G4UC 3V3TA 1Q7YH 3CMAF 4BY9D 4NQ3A 4NUTA 5GIOC 3LWVC 1Q86H 1M90H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 F;  3NVK E;  3CD6 F;  3FFM A;  3CPQ A;  3CCV F;  2OZB A;  3JCM M;  2LBX A;  4BW0 B;  3CCL F;  4X3L A;  1YIT F;  3NMU C;  2I6D A;  5G4V C;  1VQ4 F;  1VQN F;  3CME F;  1GO1 A;  3HAX D;  3GYQ A;  2VGN A;  2CZW A;  5DCV A;  3E1Y A;  1SDS A;  1Q81 H;  5A2Q M;  1RA4 A;  3CCR F;  2KTV A;  3V7Q A;  1VQL F;  5GIN C;  3CCQ F;  3CCJ F;  1PXW A;  3N4Y A;  1W42 A;  3OBW A;  3J80 M;  2VGM A;  1VQ9 F;  3CCS F;  3VI6 A;  1VQ5 F;  3LWR C;  1KC8 H;  1S72 F;  1VQ6 F;  3G71 F;  2OTJ F;  3NK6 A;  3CCE F;  1YJW F;  2QA4 F;  3MCA B;  5FLX M;  1W3E X;  2QEX F;  4C4W C;  3CXC F;  1KQS F;  3O85 A;  3G6E F;  5EWR A;  1M1K H;  3LFO A;  1Q82 H;  5FJ4 C;  3CC2 F;  1VQM F;  1GO0 A;  1NJI H;  1E7K A;  1X52 A;  4X3M A;  1X7O A;  1YJ9 F;  5GAN K;  3VMF B;  3J81 M;  3LWO C;  1YJN F;  5GAP K;  2WAL A;  4TZZ A;  3E20 B;  2HVY D;  1VQP F;  1W40 A;  2JNB A;  2OHW A;  3CG6 A;  1YHQ F;  3PAF A;  2ALE A;  4LCK A;  1K73 H;  1VQK F;  5GIP C;  3LWQ C;  3WXM B;  2AIF A;  1VQO F;  3I55 F;  2OTL F;  1VQ8 F;  3AGK A;  1IPA A;  1T0K B;  1KD1 H;  1ZWZ A;  1QVG F;  3OBY A;  3CC7 F;  1W2B F;  3RA5 A;  3NK7 A;  1CN7 A;  1N8R H;  3HJW C;  3LWP C;  3JAM M;  1H7M A;  1CK2 A;  1NMU B;  3CCU F;  3SIV A;  1X7P A;  1RLG A;  3I56 F;  5EO3 A;  2KTU A;  2LBW A;  1GZ0 A;  3CC4 F;  3G4S F;  2FC3 A;  1K9M H;  1XBI A;  5IT9 M;  1QVF F;  2KG4 A;  3ON1 A;  3J7A R;  3SIU A;  1W41 A;  3V7E A;  3CCM F;  3NVI B;  3RA6 A;  3OW2 F;  3PLA C;  3N4Z A;  1DT9 A;  1JJ2 F;  2QI2 A;  3CPW F;  1K8A H;  3IR9 A;  2BO1 A;  1YIJ F;  1YI2 F;  5G4U C;  1Q7Y H;  3CMA F;  4BY9 D;  4NUT A;  5GIO C;  3LWV C;  1Q86 H;  1M90 H; 
#chains in the Genus database with same CATH topology
 4YJ3 A;  3MQW A;  1VQ7 F;  3NVK E;  1JY8 A;  3CCV F;  3FPI A;  3HKE B;  3NMU C;  2UZH A;  3WGK A;  1H47 A;  3IEQ A;  5LYJ B;  4B62 A;  5C8Y A;  3HKB B;  4C8G A;  5EZY A;  3GYQ A;  2HS3 A;  1ODE A;  2DT4 A;  1Z5V A;  2RHO A;  4TUY B;  1Q81 H;  2UYP A;  5A2Q M;  4FFB B;  5JVD B;  1H48 A;  2GZL A;  2HRU A;  3JAW B;  5LA6 A;  3VYS C;  4G4V A;  2FGY A;  5KMG B;  3MDO A;  5LXT A;  3RYH A;  3R0P A;  3VYU C;  3CCQ F;  4IIJ A;  4I55 B;  3N4Y A;  3C9R A;  4ZK7 A;  3J80 M;  4O2A A;  4F6R B;  2PHN A;  5CB4 A;  3CCS F;  3VOA A;  1VQ5 F;  3LWR C;  2HP0 A;  1IV3 A;  1S72 F;  5IJ9 A;  2OTJ F;  5BMV B;  1TVK A;  1J7H A;  5IYZ B;  4O2B B;  2IAF A;  4ZHQ A;  3O85 A;  3G6E F;  5EWR A;  3LFO A;  4WBN A;  3RYC A;  1VQM F;  1NJI H;  1X52 A;  4X3M A;  1W5F A;  5GAN K;  3F0F A;  3HKC B;  2HX0 A;  2CSL A;  1YJN F;  1U3L A;  4EI7 A;  2F9Z C;  2Z1E A;  5GON A;  3B6N A;  1QAH A;  1VQP F;  1W40 A;  4ZI7 A;  1K73 H;  5GIP C;  3LWQ C;  3WXM B;  4R40 B;  1JFF B;  3VTI C;  1FFX A;  3FD5 A;  3K12 A;  4BT6 A;  3OBY A;  3N2G A;  1QVG F;  3RA5 A;  3IMP A;  5KX5 B;  1QD9 A;  3HJW C;  1DBF A;  4ERH A;  3TD4 A;  1H7M A;  3JAT B;  1CK2 A;  4LNU A;  4O4J A;  3CCU F;  1X7P A;  3WGN A;  1RLG A;  3I56 F;  4X1Y B;  2KTU A;  4U39 A;  2I6R A;  1FNK A;  3LME A;  4C8E A;  2FC3 A;  3UT5 A;  5J2T B;  1K9M H;  4I50 A;  4O4I A;  5J2U A;  2KG4 A;  2W8B C;  3J7A R;  4ZHV A;  2CHS A;  2CVL A;  3JAK A;  3OW2 F;  1SA0 B;  4RHA A;  1DT9 A;  3HKD A;  4O4H A;  1QU9 A;  2BO1 A;  1YIJ F;  5CA0 B;  3CYP B;  5G4U C;  5LOV A;  5EIB C;  3E22 A;  3WPW A;  1VQK F;  3RYF A;  5HP7 A;  1UI9 A;  3JAS B;  1IV4 A;  3CD6 F;  1TUB B;  3JAR B;  5IJ0 B;  3I3F A;  4BW0 B;  4X3L A;  3CME F;  3D54 A;  4BVT A;  3HKE A;  1GO1 A;  3KHN A;  1ONI A;  2CZW A;  2P6Y A;  5DCV A;  1W55 A;  1SDS A;  2VAM A;  5LYJ A;  5HY1 A;  3HKB A;  3ERN A;  3QTY A;  1RA4 A;  3CCR F;  2KTV A;  4G4W A;  5CA1 B;  1XRG A;  4TUY A;  4G4Z A;  4C82 A;  5JVD A;  1W42 A;  3JAW A;  4BT3 A;  5KMG A;  5HXZ A;  5HP8 A;  4DRX B;  5HY4 A;  2VGM A;  4I55 A;  4X20 B;  3CB2 A;  4F6R A;  3RE3 A;  2UYK A;  4BVR A;  3NK6 A;  3LDT A;  3N2K A;  2QA4 F;  3HTN A;  3P4E A;  1W3E X;  2K1S A;  3OON A;  2QEX F;  2G9I A;  4I4T B;  2V9Y A;  3KJK A;  1M1K H;  5IYZ A;  2IQQ A;  2Z1U A;  4O2B A;  3CC2 F;  2LBT A;  1GO0 A;  5EB0 A;  2OTM A;  4TV8 B;  1YJ9 F;  3VMF B;  3J81 M;  3KJJ A;  2QTP A;  5GAP K;  3GHZ A;  3HKC A;  3MBM A;  2HVY D;  2VXY A;  3I7T A;  2BTU A;  3ZO8 A;  1VH8 A;  3C9T A;  3CG6 A;  4HNA B;  3S0W A;  1VQO F;  2HS0 A;  2OTL F;  4C8I A;  1IPA A;  5EYP B;  1KD1 H;  1T0K B;  1JFF A;  3NK7 A;  1NMU B;  3SIV A;  2ZVY A;  3K0T A;  1U3P A;  4YJ2 B;  5KX5 A;  1RLU A;  4PWT A;  3CC4 F;  2BTO A;  3JAT A;  3F0D A;  4X1K B;  3D00 A;  5LP6 B;  2RHJ A;  4X1Y A;  4NWO B;  1QVF F;  5IT9 M;  4BT2 A;  1YGY A;  1XV2 A;  1W41 A;  1IV2 A;  5J2T A;  1UFY A;  2L26 A;  3F0G A;  3N4Z A;  2Z1F A;  5EIB D;  1JD1 A;  1VK3 A;  2B33 A;  2HS4 A;  2Q1Y A;  4ZOL B;  5LA6 B;  1SA0 A;  5HY0 A;  1Z5W A;  3V3T A;  4BY9 D;  3WJR A;  5JH7 B;  5GIO C;  5CA0 A;  3U0O A;  3IKE A;  1Q86 H;  4RQO A;  4B5C A;  4O4L B;  2RHH A;  3JAL B;  2OZB A;  4C81 A;  2LBX A;  3CCL F;  5MN6 A;  3GTZ A;  4X1I B;  3JAS A;  4BT7 A;  2I6D A;  5G4V C;  1TUB A;  3JAR A;  5IJ0 A;  1W58 1;  1VQN F;  1PF5 A;  4ZHY B;  2HQS C;  2UYN B;  4TV9 B;  4EB6 B;  2Z1T A;  3V7Q A;  5ITZ B;  1VQL F;  3QUW A;  4BT4 A;  2YXZ A;  2ZF8 A;  1JN1 A;  1PXW A;  2CWJ A;  5CA1 A;  2DYY A;  1KNJ A;  4IHJ B;  3RYI B;  3P10 A;  1FNJ A;  4M8I A;  3VO8 A;  3DC2 A;  4DRX A;  1VQ6 F;  1SZQ A;  3L7Q A;  4BVS A;  3N2G B;  1YJW F;  4X20 A;  5EB1 B;  4B46 A;  4O4J B;  1KQS F;  1COM A;  5FNV B;  1W5B A;  3M1X A;  5FJ4 C;  2Z01 A;  1E7K A;  4U3J B;  1X7O A;  4I4T A;  5J2U B;  5HWE A;  4FFB A;  3V4D A;  2UYJ A;  4TV8 A;  2WAL A;  4TZZ A;  3M4S A;  1W5E A;  1RQ7 A;  1YHQ F;  1OFU A;  4LCK A;  2ALE A;  3VOB A;  3I55 F;  3AGK A;  3M84 A;  2H8C A;  1NQ3 A;  4HNA A;  3CC7 F;  5BMV A;  2GLZ A;  1W2B F;  1N8R H;  5MN4 A;  3LWP C;  2ZAU A;  5EYP A;  5JQG B;  3JAM M;  3ESJ A;  1CLI A;  2EWC A;  1GZ0 A;  5MN5 A;  3G4S F;  3EOR A;  3VYT C;  1XBI A;  4YJ2 A;  4B45 A;  3WJQ A;  2CW4 A;  2MQE A;  3ELC A;  1W5A A;  3S0H A;  3MCQ A;  4X1K A;  3SIU A;  2GVI A;  2H6L A;  5LP6 A;  3CCM F;  4EI9 A;  3NVI B;  2H8E A;  3VIU A;  2QI2 A;  1K8A H;  2VAW A;  1R1M A;  1XHO A;  5HY2 A;  3BYQ A;  4DXD A;  5HXU A;  4LNU B;  3C9U A;  4ZOL A;  4NQ3 A;  4YJ3 B;  4BT5 A;  3K14 A;  1X25 A;  3Q8H A;  3FBA A;  1Q8R A;  1M90 H;  3TD3 A;  1RQ2 A;  3WGM A;  5JH7 A;  3ZOP A;  3FFM A;  3CPQ A;  3N2K B;  4O4L A;  5LP6 C;  3JCM M;  2Q1X A;  3CYQ A;  5C8Y B;  1YIT F;  3JAL A;  4EI8 A;  2R6R 1;  1IV1 A;  5EZY B;  2N48 A;  1VQ4 F;  4G4X A;  4X1I A;  3HAX D;  2VGN A;  3VCZ A;  2ZOD A;  3E1Y A;  3KIZ A;  4BVQ A;  2PMP A;  5LXT B;  3RYH B;  4IIJ B;  3S02 A;  3ZP7 A;  1YQN A;  3C8L A;  4KWE A;  2HRY A;  5GIN C;  1KNK A;  4O2A B;  2R75 1;  2UYN A;  4TV9 A;  4EB6 A;  5CB4 B;  3CCJ F;  3IEW A;  3OBW A;  5ITZ A;  2HP0 B;  1VQV A;  2LCA A;  1VQ9 F;  5IJ9 B;  3VI6 A;  1TVK B;  3TD5 A;  1KC8 H;  4IHJ A;  1W57 A;  3G71 F;  3RYI A;  4ZHQ B;  3CCE F;  3MCA B;  2IG8 A;  5JCO A;  2RHL A;  4XCQ A;  5FLX M;  4WBN B;  3RYC B;  4C4W C;  3CXC F;  3S03 A;  2YYE A;  1Q82 H;  1U40 A;  2AIZ P;  3F0E A;  2HP3 A;  4G88 A;  2BTQ B;  5FNV A;  1T0A A;  3LWO C;  3DDN A;  5GON B;  2CHT A;  4U3J A;  1OAP A;  3C9S A;  4ZI7 B;  3E20 B;  1FFX B;  2OHW A;  2JNB A;  5JCO C;  3PAF A;  2NMU A;  2KGW A;  1U43 A;  2AIF A;  3K2X A;  3WGL A;  5EAZ A;  1VQ8 F;  3S0Y A;  1ZWZ A;  3WJP A;  1GX1 A;  3LYB A;  1CN7 A;  3D01 A;  3QHD A;  1VHA A;  2VAP A;  3UT5 B;  5EO3 A;  2RB9 A;  4I50 B;  4O4I B;  2LBW A;  3P0Z A;  5B8F A;  3T80 A;  5JQG A;  4ZHW A;  1FSZ A;  3JAK B;  3ZP4 A;  3IKF A;  4E6E A;  3ON1 A;  3KE1 A;  1W59 A;  3V7E A;  3F6M A;  2ZOV A;  3HKD B;  4O4H B;  3RA6 A;  3PLA C;  3WGJ A;  5LOV B;  3CPW F;  1JJ2 F;  3IR9 A;  3JVH A;  3WPX A;  1YI2 F;  3E22 B;  2ZVZ A;  2AMT A;  1Q7Y H;  3CMA F;  3S06 A;  3RYF B;  3HWU A;  4NUT A;  5AVM A;  3LWV C;  4G4Y A;  3FD6 A; 
#chains in the Genus database with same CATH homology
 1VQ7 F;  3NVK E;  3CD6 F;  3FFM A;  3CPQ A;  3CCV F;  2OZB A;  3JCM M;  2LBX A;  4BW0 B;  3CCL F;  4X3L A;  1YIT F;  3NMU C;  4EI8 A;  2I6D A;  5G4V C;  1VQ4 F;  1VQN F;  3CME F;  4BVT A;  1GO1 A;  3HAX D;  3GYQ A;  2VGN A;  2CZW A;  5DCV A;  3E1Y A;  1SDS A;  4BVQ A;  5HY1 A;  1Q81 H;  5A2Q M;  1RA4 A;  3CCR F;  2KTV A;  3V7Q A;  1VQL F;  2FGY A;  5GIN C;  3CCQ F;  3CCJ F;  1PXW A;  3N4Y A;  1W42 A;  3OBW A;  3J80 M;  5HXZ A;  5HY4 A;  2VGM A;  1VQ9 F;  3CCS F;  3VI6 A;  1VQ5 F;  3LWR C;  1KC8 H;  1S72 F;  1VQ6 F;  3G71 F;  4BVR A;  4BVS A;  2OTJ F;  3NK6 A;  3CCE F;  1YJW F;  2QA4 F;  3MCA B;  4XCQ A;  5FLX M;  1W3E X;  2QEX F;  4C4W C;  3CXC F;  1KQS F;  3O85 A;  3G6E F;  5EWR A;  1M1K H;  3LFO A;  1Q82 H;  5FJ4 C;  3CC2 F;  1VQM F;  1GO0 A;  1NJI H;  1E7K A;  1X52 A;  4X3M A;  1X7O A;  1YJ9 F;  3VMF B;  5GAN K;  3J81 M;  5HWE A;  3LWO C;  1YJN F;  5GAP K;  2WAL A;  4TZZ A;  4EI7 A;  2F9Z C;  3E20 B;  2HVY D;  1VQP F;  1W40 A;  2JNB A;  2OHW A;  3CG6 A;  1YHQ F;  3PAF A;  2ALE A;  4LCK A;  1K73 H;  1VQK F;  5GIP C;  3LWQ C;  3WXM B;  2AIF A;  1VQO F;  3I55 F;  2OTL F;  1VQ8 F;  3AGK A;  1IPA A;  1T0K B;  1KD1 H;  1ZWZ A;  1QVG F;  3OBY A;  3CC7 F;  1W2B F;  2GLZ A;  3NK7 A;  3RA5 A;  1CN7 A;  1N8R H;  3HJW C;  3LWP C;  1H7M A;  3JAM M;  1CK2 A;  1NMU B;  3CCU F;  3SIV A;  1X7P A;  1RLG A;  3I56 F;  5EO3 A;  2KTU A;  2LBW A;  1GZ0 A;  3CC4 F;  3G4S F;  2FC3 A;  3D00 A;  1K9M H;  1XBI A;  5IT9 M;  1QVF F;  2KG4 A;  3ON1 A;  3J7A R;  3SIU A;  1W41 A;  3V7E A;  3CCM F;  4EI9 A;  3NVI B;  3RA6 A;  3OW2 F;  3PLA C;  3N4Z A;  1DT9 A;  1JJ2 F;  2QI2 A;  3CPW F;  1K8A H;  3IR9 A;  2BO1 A;  1YIJ F;  1YI2 F;  5HY2 A;  5HY0 A;  5HXU A;  5G4U C;  3V3T A;  1Q7Y H;  3CMA F;  4BY9 D;  4NQ3 A;  4NUT A;  5GIO C;  3LWV C;  1Q86 H;  1M90 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...